@3v@EX|&lQ\m p773`G;((l@@, `  92453-07B10.37;o| 92453-07B10.29 (aCC)8ot@ @@%X"[a[aLX [d\(kd\(tX 4ǐ4X X ((X! ||X! xxX!  X! X!wX XX!lpx|pxX!brX!]ԄmԄX!2DBDX! <L0<LX! H0HX!$*$X!!\&\X!#XDXDX!% !X!' HT#HTX!) %X!+ /' /X 8+<P'LPX H+(X((XX I,h((hX X,h((h(>(, @`>(, @<>( , @P>(, d@dh>(3;p d@+p dt>(&3F H@6 H >('3R $@B $>((3UH@EH>(P@EX>(R@IH>3`Y (l? , @@>`@P $PRIVATE$$DLT$$PLT$ $SHLIB_DATA$$TEXT$ $SHLIB_INFO$ $DATA_START$ $MILLICODE$$LIT$$CODE$$UNWIND_START$$UNWIND$MILLICODE$$UNWIND$ $UNWIND_END$$RECOVER_START$$RECOVER$MILLICODE$ $RECOVER$ $RECOVER_END$ $PFA_COUNTER$$PFA_COUNTER_END$$DATA$ $SHORTDATA$$GLOBAL$ $SHORTBSS$$BSS$$ANS$$CI$00 0,@0`"@EX0 p@0|@0 @0#0 @0 @0 @ 0 @30 @K0 @S0  @[0 @w0 ,'L0 @(0 P((h0 d((h0 x"@EP0 "@EL0 "@EH0#0@0 @0 @0 @0@0@ $@ 0 ,@l 0 <@+H$@ 0((l0$@` 0 p@0 Q@30 $@ 0 @UU0 ,@$00 @@#0 UT@#z0 Ql@$+U|x0U8LUXh0 U@#0 U@k0 U@K0 Q@`0 A@*c0 U@U$0 Q4@#~0 UD@! 0 UT@Γ0 U`@{0 t@"0 @eK0 A@# C0 U@#30 Q@0 @$1UH¼U0 A0@$GS 0 <@_ 0 L@c0 U\@$0 Ut@& 0 @C 0 @W 0 @[ 0 @S 0 @W 0 @g0 U@n0 U@0 U@E+ 0 @o0 U,@ 0 D@ 0 T@w 0 h@O 0 x@k 0 @_0 U@ 0 @O0 @0 U@N0 A@ ={0 U@0 U@B0 U @X{0 U @0  (@rS0 U <@|0 U P@30 U h@ 0 U @0 U @͓0 U @ S0 @@0 U @#l0 Q @(3 0 8@c0 Q H@0  `@g[0 U p@#k+0 U @#n0 U @#lU hU U P0 U @0 U @0 U @ 0 U $@~0 U 8@k0 A H@;0 Q `@c0 Q x@0 $@0 $@_ 0 @K 0 @G0 U @#K0 Q ,@0 U @@C0 U P@#T 0 \@GU l4 0 |@ 0 @0 U @ {0  @ 0 @0  @[0 U @0 U @0 U @s0 U @ӣ0 U 0@ 0  @@0 U P@{0  `@;0 U t@ 0 U @e;0 A @i 0 U @i0  @0 A @$G0 U @#c0  @mS0 U@9k0 U@{0 U$@sC0 A8@=S0 P@$k0 `@0 Ux@y0 U@#O{0 U@ { 0 @0 U@0 @f 0 U@0 U@0 U@0 U@ų0 U @0 0@+0 U@@#0 UP@k0 Ud@0 x@0 A@ >[0 U@ ?S0 U@ Sk0 @ Ls0 U@ k0 U@ #0 U@K0 U@ r[0 U@ 0 (@ 0 U@@ s0 UT@#k0 Uh@ 0 U@ s0 U@ s0 U@!#[0 U@ 0 U@ 0 U@ г 0 @0 U@#0 U @ k0 @0 Q,@$/U<UL0 U\@ 0 Ul@ 0 U@g0 U@֫0 U@ 0 @ 0 U@ S0 U@ k0 U@ <+0 @as0 U@ DK0 U0@ c0 U@@ n;0 UP@ 0 U`@;0 Ut@ 0 U@ 0 U@ s0 Q@ ǫ0 @0 @0 @0  @$30 $@s0 @@0 T@0 l@0 @[0 @C0 @0 @k0 @ 0 U@ 0 U@#0 U@ 0 0@"S 0 H@C0 UX@!#0 Ul@ 0 U|@ ;0 U@ 0 U@#I 0 U@ 0 @ 0 @ 0 U@ 0 Q@#q0 U @!0 @ 4c0 U,@0 UD@0 UX@ 0# 0 h@o0 U@#+;U~0 U@#0 @f0 A@#n0 U@ 0 @ 0 (@0 U8@#k0 At@ U 0 @U0 0 @0 U@#X0 U@UX\0 Uh@0 A|@3 0 @7 0 @/0 U@0 Q@C0 Q@:0 U@%0 Q@(0 U(@a0 U<@|0 UP@P0 Ud@# 0 p@?0 Q@0 @_K0 U@ c0 A@%;0 A@0 D@aU`0 Up@ 0 U@ 0 @'0 U@ 0 U@ mk0 A@ 0 A4@ k0 UH@0 UX@#;0 Uh@0 U|@[0 U@#0 U@!P0 U@ ˋU0 (@e0 <@d0 P@d0 d@dX0 Qx@ 2 U0@0 U@ ƳU0hU@ 0 P@~0 h@~0 @~P0 @~0 @}0 @}h0 @}(0 U@#0 U@#0 U@+0 U,@"U<@ULU\pUlU|(UDU`U|U0 U@#o0 U@#dU0 U@#+0 Q@$0$@ 0 Td@ ,#0 Ux@ Kk0 U@ +30 U@ @0 U@ M+0 U@ ~#0 U@ 0 U@ +0 U@ 0 U(@ 0 <@ s0 UT@ 0 Uh@ C0 U|@ 0 U@ H0 U@ {0 U@ bK0 U@  0 U@ 0 U@ 50 U @ V0 U @ #0 U 8@ 0 U L@ g0 U `@ [0 U t@ s0  @$10 A @0 A @S0 U!H@#^3 0 !T@K 0 !d@0 !@#0 !@#x0 !@#(0 U"@ 80 U",@#0 U"<@ H0 U"P@0 U"`@?{0 U"p@0 Q"@cC0 "@bc0"@ 0 U#@ 0 #<@'`0 #P@'0 #d@&0 #x@&h0 #@&0 #@%0 #@%0 #@%00 #@$0 #@$0 $@$`0 $ @$U$8U$HU$XU$h  0 $t@ 0 $@70$@0 U$@"C0 Q$@#0 Q$@#~0 U%\@"0 %$@u0 %@50 %@50 %@50 %@50 %@50 %@5(0 &@40 U&@ 0 U&(@ %30 U&8@ [ 0 U&H@ #0 U&\@ a0 U&l@A0 U&|@ +0 U&@ x{0 Q&@#ߛ0 U&@ TU&0 U&@ 0 U&@ 0 U'@ 0 U'@ 30 Q'8@#k0 U'D@ =0 U'T@ -0 'd@ rK0 U'x@ 0 U'@ T0 U'@ 0 U'@ |0 U'@ 0 U'@ sk0 U'@ s0 U(,@ SU(`U(p0 U(@0 )$@0 U)4@ 0 U)H@ 80 Q)`@ .0 U)|@ (0 U)@ "#0 )@>0 )@>0 * @>0 *$@>0 *<@>0 *T@>(0 *l@=0 U*@Z{0 U*@l0 U*@0 U*@ 0 U*@ >0 U*@ Sc0 U*@ 0 A*@ #0 U+@ \+ 0 +,@0 U+<@ C0 U+P@ ǣ0 U+`@0 U+p@ K0 U+@ 0 U+@ "0 U+@ 0 U+@#30 U+@ 0 U,@ 0 A,@ !0 U,0@ 0 U,@@ 0 U,x@ +0 A,@ C0 U,@ #0 U,@ E0 U,@{0 A- @ Ds0 Q-$@ 0 -<@ S0 Q-P@ k0 Q-h@ c0 -$@80 U-@ 0 A-@ [0 U-@k0 U. @ 9 0 U.@ G#0 U.4@ 0 U.L@ c0 U.`@##0 U.@ 0 A.@ 0 U.@ ;0 U.@k0 / @h0 A/8@ 30 U/P@ 0 U/h@ ;0 U/@ { 0 /@[ 0 /@ 0 /@g0 U/@30 U0D@ 0 0@q0 U0@ y0 U0@#0 A0@#0 A0@ c0 U1@ 0 1h@P0 1@0 U1@ 0 P1@#r[0 2 @0 28@0 2P@@0 2h@0 2@0 2@@0 2@0 2@0 2@H0 2@0 3@0 3(@@0 3@@0 3X@0 3@0 3@` 0 4<@#0 P4L@#~0 P4X@#k0 4@$10 U4@ ~0 U4@!M0 U5@ 0 5H@0 5\@0 5p@0 5@0 5@X0 5@@0 5@P0 6 @0 U6 @ 0 U6<@#0 U6P@!k0 U6`@!0 6@0 U6@ 30 6@00 6@U|x `UX |0 74@h0 7H@0 7\@0 7p@0 7@p0 7@0 7@0 7@h0 U7@0C 0 8h@U8x@( 0 U8@)30 U8@s0 U9,@ K0 U9D@ 0 U9@ S0 U9@0 9@0 U9@0 U:\@G0 :@0 :@p0 :@H0 :@(0 :@0 ;@0 ;(@0 ;@@0 ;X@h0 ;p@@0 ;@(0 ;@0 ;@0 U;@0 U;@40 U;@ 0 U< @#U l D$0 <@0 U @ 3{0 >D@0 >X@80 U>l@ 0 Q>@0 A>@7 0 ?@0 ?@@.h0 ?X@.(0 U?p@#U? U8 0U? L 0 ?@O0 U?@ U` 0 U?@"0 @8@.0 @T@.0 U@p@!)0 @@20 @@20 @@1x0 @@10 A@00 A(@00 A@@080 AX@/0 Ap@/0 A@/h0 A@/(0 UA@!CU 0 A@30 UB@!/0 UB<@!H0 UB@!0 UB@#0 C@@30 CX@3X0 QC@"0 QC@0 UC@*0 DL@3 0 Dh@0 D@;0 D@;0 E@;0 E@;`0 E8@;00 ET@;0 Ep@:0 E@:0 E@:p0 E@:@0 E@:0 E@90 F@90 F4@90 FP@9P0 Fl@9 0 F@80 F@80 F@80 F@8`0 F@800 UG@0 AG(@ 0 UG4@20 UGH@ /{0 UG\@0 AGl@ 50 UG@0 UG@ +0 UG@0 UG@+0 UG@0 UG@0 UG@UX@ \ 0 HD@s0 H@>0 H@>@0 H@=0 H@=0 H@=H0 I@<0 I0@0 Uh@ :0 U@ 20 U@ /U lܔ0 @;0 @;@0 U@@ 0 @0 `@>0 |@>0 Ș@>0 ȴ@>(0 U@"S0 @B(0 $@A0 @D0 @C0 U@_0 U4@^0 UL@f;0 Ud@b;0 Tʴ@&s0 T@DH0 H@E0 `@E`0 x@E0 ̐@D0 T̨@00 @G0 @F0 ,@FX0 D@E0 @H 0 @G0 U$@.0 U8@'0 QP@)0 Uh@+0 ϸ@L0 @LX0 @K0 @K0 (@K@0 D@J0 `@J0 |@J@0 И@J 0 д@I0 @I0 @I0 @IP0 $@H0 @@H0 \@Hh0 Ѭ@M0 @Mh0Ҝ$@ `0Ҭ$@x0Ҹ$@`0$@DU0Ӕ$@0Ӥ$@ p0 Ӱ@ S0 0 @Ԝ@ 0 ԰@ 0 @ {0x$@0 @NU(x0U800 ׈@Bs0 Uל@K0 װ@k0 Q׼@0 Q@K0 Q@#0 @?0 @= 0  @:#0 U|@٣0 Uؐ@[0 U@ 0 U@ ;0 Q@K0 Q@ 0 U@#0 U$@޻0 U|@0 Uِ@0 U٠@σ0 Qٸ@c0 U@0 U$@0 ڰ$@80 U@C0 U0@ 0 UD@ 0 UT@ 0 Aۘ@s0 ۨ@0 A@U e0 U@$-+0 A@0 UL@J0 Ud@0 Uܘ@0 Q@0 @$@ 0 X@Z0 t@Z0 ݐ@Z0 ݬ@Z0 @Z0 @Zx0 @ZXU80 U@# 0 U0@#.0 U@@#w0 UT@"0 Uh@#0 U|@# 0 Uސ@`{0 Uި@ZU$U0@0 U@p0 U@"k0 U@#30 U@#0 U @0 A @0 Ad@0 ߸$@w0 $@ 0 $@u0 U@0 U@t0 A@{0 U,@s0 U@@;0 UT@30 Uh@{0 U|@0 U@0 AD@S0 A@0 U@0 U@0 U@Ó0 U@{0 U@@k0 UX@+0 U@0 U@0 U(@30 U@@+0 A@Hk0 U@0 X@\0 t@\@0 @\(0 @\0 @[0 @[0 U@{0 UL@k 0 d@30 Ut@0 U@ɓ 0 @ 0 @70 U@K0 U@S0 U@30 UP@S0 Uh@c0 U@0 U@0 A@0 Ud@0 U|@c0 U@30 U@C0 U@s0 U@0 U@0 U @0 UP@ʋ0 Uh@0 U@ 0 U@[0 U@0 U@0 U@0 h@a0 @aU$8`U$H0 @b(0 @b0 @a0 U4@0 U@[0 U@U(p@L0 U<@K0 AT@0 At@S0 U@0 @bP0 @bHU|x0 A@#ʛUX0 L@d0 \@d0 @e(0 @d0 @d0 @d0 @d0 @dp0 @dh0 U @{0 U$@#0 @f0 @f0 @fh0 @fP0 @f00 $@f0 D@e0 d@e0 @e0 @e0 U@0 U@K0 P$@ 0 $@uh0 $@0 $@p0 $$@ 0 h$@ 0 |$@ʘ0 $@vX0 $@ 0 $@_`0 $@vp0 $@Đ0 0$@0 H$@00 $@ 0 $@ 0 $@v0 $@Ę0 $@`0 $@0 $@ 0 $@ (0 $@0 0$@0 $@ x0 $@80 $@ h0 $@ 0 $@0 T$@u0 $@0 $@x0 $@ 0 $@P0 t$@v0 $@ʈ0 `$@0 t$@ 0 Q@0 Ax@ 0 A@ 0 A@s0 U@#0 U@ 0 A<@0 AP@0 Ad@ 0 U@0 @j0 @jp0 @j00 @j0 4@j0 UH@ U lN0 U\@UX@ZD0 U@`0 $@ 0 $@(0 $@x0 $@ 0 $$@ 80 Qh@Z0 Ax@0 A@0 Q@{0  @{0 Q @:0 U<@s0 L@_0 d@^S0 Ux@s0 U@l0 U@G30 $@ 0 @l0 @lh0 @l80 @l0 @k0 (@k0 <@kp0 P@k@0 d@k0 x@jU,0 A@F0 A|@V0 Q@N#0 @l0 A@QsU8x@(l0 A@O0 @m0 @mp0 @m`0 @m(0 @m0 U@0 UX@0 U@0 U@M0 U@S0 A@ֻ0 U@Sk0 U@1[0 U@ S0 U@ x[0 ` J0 Ut@H0 U@$#S0 A@<0 U@8s0 U(@.k0 U@@70 UP@(C0 U`@4#0 p$@ 0 $@ 0 $@0 $@ x0 $@ 0 $@0 $@̀0  $@b 0  $@ 0 U4@<0 UH@2+0 U@P{0 U@Q0 U @R0 U 4@X0 U D@@UJtU$h [0 U @j30 U $@j0 U @V0 U @[S0 U @D0  $@H0 U@I0 Uh@' 0 $@ 0 $@ 0 $@L`0 $@8p0 $@ 0 $@ 0 $@b0 $@h0 $@0 $@ @0 $@P0 U @T0 U0@V0 UD@T0 @0 U@0 U@vk0 $@ 0 $@0 $$@0 @O30 @_+0 A@s0 @Ush8U`\0 $@(0 U@J30  @P0 l@0 U@Ks0 U@e;0 U@w0 @0 Ul@/0 U@0 U@{0 U@|0 U@0 U@ UG0 V  :0 V  w0 U @0  @C0  @0 !@#0 !,@0 !@@0 !X@S0 !p@0 !@c0 !@0 !@0 !@k0 !@K0 !@C0 U"@s0 U#@k0 U#@{0 $$@0 U%(@30 U%@#0 U&,@0 &D@Ǜ0 &X@0 U&p@c0 U&@0 &@k0 &@[0 &@0 &@0 &@0 &@˃0 '@0 ',@0 'H@S0 '`@c0 )@p0 A*@@֛0 U*@0 *@0 U*@+0 *$@0 U+4@ 60 V+H 6k0 . @UU00 U/(@k0 T/@As0 U/@s0 0@+0 0@~0 T0D@0 U0T@0 0@*0 T1@K{0 1T@`0 1l@0 T1@~0 U1@0 U2@ 0 T2@630 U2(@0 2d@0 @2|@x0 U2@0 T2@N#0 T3$@\0 P3@k0 4@0 4@0 4@X0 4@00 4@0 4@0 T5p@30 @5@z0 U5@0 @6@|C0 A6(@0 @6h@{[0 A6@k0 @6@}c0 U6@[0 @7@}0 A74@K0 @7x@}0 A7@30 @7@~0 A7@0 8 @g;0 T8X@!30 T8h@K0 U8@0 U8@0 T8@,0 U8@Ɠ0 T9@.30 U9 @0 U9@%[0 U9@-{0 :,@KK0 T:@@;0 U:P@s0 P;d@0 U;x@a0 T;@G0 U;@l0 P<@m30 <\@0 T<@0 U<@0 U<@#0 P=@zs0 Q=8@30 @=|@zS0 A=@0 =@0 @=@yk0 U>@0 >@@ 0 @>T@yC0 A>h@+0 @>@y0 A>@S0 U? @jk0 U?$@k{0 ?\@+s0 ?p@0 P?@0 @$@_T0 A$@0 A$@ P0 A($@ x0 A<@ 0 AP@0 Ad@`0 Ax@ 0 A@0 A@0 A@UA(l0 B @p0 B @0 B4@0 BH@p0 B\@X0 Bp@@0 D@0 D@X0 D@0 D@p0 E @0 E @0 E4@0 E@0 E@0 E@X0 F@00 F@0 F0@U(p@0 G@8U|x(UXD0 RH< ;0 TH@8k0J$@ 0J$@ 0J$@ l0J$@ 0K$@ 0K($@̼0K<$@ \0KP$@ 0Kd$@ 0Kx$@ p0K$@,h0K$@0K$@th0K$@ 0K$@ 0K$@h0K$@0L$@ 0L$@ 80L0$@ 0LD$@LH0LX$@u0Ll$@ 0L$@\0L$@ t0L$@ 0L$@ 0L$@0L$@̴0L$@80M$@u0M$@ 0M($@0M@$@ l0MX$@u0Ml$@x0M$@_X0M$@0M$@0M$@0M$@ 0M$@ h0N$@ 0N$$@ h0N8$@,d0NL$@0N\$@ 0Nx$@ P0N$@ 0N$@0N$@0N$@̰0N$@̸0O$@H0O$@,0O,$@Ą0O<$@ x0OL$@vl0O\$@ 0Ol$@u0O|$@ 00O$@ 0O$@$0O$@80O$@_0O$@ 0O$@ 0P $@Č0P$$@x0P<$@ʴ0PT$@vh0Pl$@0P|$@Ĉ0P$@ d0P$@u0P$@ 0P$@ t0P$@ 0P$@vd0P$@,`0P$@8h0Q $@ 0Q$@u0Q($@ 0Q8$@b@0QD$@td0QX@30Ql@30Q@30 AQ@UQPHQUQd0 Q@UQ $UR  @U UR \UR0 xURD UR\ 0 Rp@$H3UR0 UR URxXUR!URtUR8US 0 S@uUS,0 AS<@USPPUS\*$USp*@US*\US*tUS+TUS+US+US-US(-US`.UT60TmUT, 7LU7h0T<%3UTH7UTX@8(0Th%0Tp%kUTx7UT@7UTH7UT08 UT8LUTXA8UATUT(K\UTxMUUpNUU$M0 AU4@30 TUP@U0 UUd@iUU|TUUTUUmlUUhu8UU8uTUU`upUUuUVuUVuUV(X{<UV8|$0 VH@UV`pPUVxlUV0 UV@UVHUVUVUVUVh0W%0W% UW@0 UYp@0 UY@"k0 UY@"[0 AZ8@"{;U8x@(UZ0 UZ@0 UZ@!0 UZ@!0 U[@![0 U[@!0 \x@0 \@0 \@0 \@XU$8 U$H  0 U]@"0 U]@%GK0 ^$@U_@ J0 U`8@"0 Q`D@"~0 U`P@"+ 0 A`\@"r0 U`h@"t U U0 U`@"A0 U`@"s0 Qa8@ oG0 aH@0 a\@0 ap@0 a@p0 a@@U@8 Y0 Ua@ r0 Ua@ sUX@ ~t0 UcD@"Y0 dd@ 0 Ugp@"#0 Ug@"30 h4@0 hL@U`!0 h@0 h@P0 i@0 Qj0@"0 Uk@!Sk0 kP@0 kd@0 kx@Ġ0 k@X0 k@(0 k@0 k@ø0 k@È0 k@`0 l@0 l@0 l4@0 lL@x0 ld@H0 l|@0 l@0 l@0 l@X0 l@0 l@0 m @0 m$@h0 m<@ 0 mT@0 ml@0 m@x0 m@00 m@0 m@0 m@0 m@@0 n@0 n,@0 nD@0 n\@p0 nt@H0 Un@"Unp!Ǭ0o@0 UoP@"0 Uo`@"0 Uo@!cU0@h"0 px@00 p@0 p@ȸ0 p@Ȉ0 p@@0 p@0 q@0 q @ǘ0 q8@P0 qP@ 0 qh@0 q@ƨ0 q@`0 q@00 q@0 q@Ÿ0 r@p0 r,@@0 s\@0 st@0 s@x0 Us@"0 Us@"0 Us@"30 Us@";0 Us@" U"Y0 Bt8"Σ0 Uu@"0 u@P0 Uv@%kU"0U0"LU l"|0 wd@ʈU "40 Tw@%!0 Tx@%${ 0 y@U"t0 Pyt@%$0 Uy@%#0 z@%%S0 Pzp@$U# U# U$`# U@#0 U{@$R[0 {l@%UvT#"0 U{@$T0 U|D@$VU|x`#+U|X#+0 P|@%%sU#3@UP#3\U@#:|0 }@0 }@0 }@0 }@ʸ0 P~@$NU|x#I|U8#IUX#I0 U~@%0 U~(@$0 U~<@%0 ~h@p0 ~x@h0 ~@@0 ~@80 ~@0 ~@0 ~@˸0 U~@%0  @(0 0@ 0 @@0 P@0 @x0 @p0 U@$C0 @̨0 @̠0 U\@$Hc0 `$@80 p$@ 0 $@0 $@0 @Θ0  @΀0 @h0 ,@P0 <@80 L@ 0 \@0 l@0 |@0 @0 @ͨ0 @͐0 @x0 @`0 @H0 @00 @0  @0 @0 ,@0 Uh@$0 @0 @0 @0 @ΰU?#zhU?#z0 P@%%0 @0 U@%0 U @%0 U4@%U #Ush#d0 @ϐ0 @`0 @H0 @0 @0 h@0 @P0 ,@80 <@ 0 L@0 \@0 l@0 |@0 @Р0 @Ј0 @h0 @P0 @80 @ 0 @0 @0  @0 P@0 l@0 @ѐ0 @р0 @p0 U@#S0 A@#{0 @#0 L@%&K0 @@%&0 @(0 P@$k0 U@% 0 P8@%&0 l$@ P0 $@ʄ0 @0 @ҘU&#U h#U P#0 @ӈ0 @X0 ,@(0 @@U$X#0 U@%0 U@# 0 U@#30 U @$\s0 U @$Y30 U0@$0 0@0 L@0 h@Ԙ0 @X0 @0 @ӸU$8$U$H$0 D@0 T@ؠU(`@$#40 @0 @0 @0 @0 @ِ0 @x0 4@(0 p@٠0 U@% #0 $@0 @$M0 T@ٸ 0 d@' 0 t@ 0 @+ 0 @ 0 @/ 0 @; 0 @?0 @%'0 0@X0 @@@0 P@(0 `@0 p@0 @0 @0 @ݠ0 @݈0 @p0 @X0 @80 PP@%30 U@$\0 U@$d[0 U@$vc0 U0@$0 U@@$q[0 UT@$0 Uh@$S0 U|@$0 U@$0 U@$0 U@$#0 U@$ 0 U@$0 U@$k0 U @$C0 U$@$0 U8@$0 UP@$0 Ud@$0 Ux@$#0 @0 @x0 U@${U8x@($U$U$U0$U$UZ@$0UH$U@8$LU@$$U@@$@U$dUW@$ȀUX@$ȜU$U x$U0$U@x$U$ȸU_@$U(p@$$0 Ux@%([0 T@%70 U@%,0 U,@%5[0 P@%8{0 @߈0 @X0 @(0 @U`%0 UX@%+0 Ul@%*#0 @߸U`% Ul%!0Ux0%!LU%!hUh%!UP%!U%!U%!U(%%4U%%U%&,U%&U%&0 Th@%Es0 T@%F30 @x0 @h0 @P0 @@0 U@%90 (@%80 T@@%FU$p%7HU0(%7dU@%7U%7U%8\0 ,@0 t@0 @p0 @80 @0 @U8%ETU<X%EUH@%F0 @%0 @&;0 L@ 0 \@0 l@0 |@p0 @00 @0 @0 @0 @`0 @80 @0 @0  @0 @h0 ,@80 <@0 L@0 U\@%S#0 U@%c0 U@%0 U@%0 U@%|0 U@%0 U@%~;0 V%0%0@%0%;0%K0@%0 %k0D%0P%0\@% 0l@%$0|@%0@%0%0%0%c0%#0 %+0@40 @%ԣ0 @%0%s0%k0%ݛ04%k0D%0T% 0d%+0t%K0%k0%0%0@40%s0%s0%0%0%ۃ0 %0@40 ,% 0@%+0P%0`%0p%0%0%K0%0%0%{0%0%{0%#0 %0%S0$%04%0D%+0T%0d%0d@%l0t@%0@%0@%0@%P0$@%ʰ08@%0L@%L0%ԫ0%ԫ0%+0%+0%c0%c0(%כ04%כ0@%{0L%أ0\%أ0h%0x%ۃ0%ۣ0%ۣ0%C0%C0%k0%ܳ0%ܳ0%0%0%K0%K0%0@40@40@40,$@ʰ0<$@ 0L$@0X$@u0d$@˸0p$@L0„$@a0œ$@0´$@ 0$@x0$@ 0@50 @50 @508@50P@5 0`@50t@50È@50à@40ø@40@40@40@40@400@40D@40T@40h@40Ā@40Ġ@40ļ@40@40@40@40@40@@40d@40ŀ@40Ŕ@0 Ű@&0 @%[0@5T0 @&ӻ0 @5P0 (@&C0 @@%UQ%޴0 \@&0p@60 Aƌ@&*0 ƨ@%0 @&s0@6hU%߸0 @' Up(%0 A@&{0 @&0 Q$@&0 @@&[0 \@&;0 p@%;UnjP%0 ǜ@%0 Ǵ@&#0 A@%0@0 @&/s0 A@%k 0 @kg0 $@&0 @@%0 X@%0p@6t0 Ȍ@&0 Ȥ@' 0 AȰ@% U%UP%0 A@%0 @&0 @&K0 0@&0 PL@&0 `@&;0 x@&0 ɔ@' 0 ɨ@'0 @&D0 @'k0 @&0$@b0($@ 08$@t`0H$@0 \@&C0ʀ@60 ʔ@'0ʬ@50@50 @&M0 Q@&K0 A4@& C0 @P@&0 Ah@& #0 Aˀ@%+0 Aː@%0 ˠ@&Ǔ0 ˴@&0 @&0 U@&Ɠ0 A@%U`%T0 @%C0 4@%0 H@&sUd%0p@6d0 T̈@&0 A̘@%[0 A̬@&0 @%c0 P@%0 @&;0 @&0 A@%30 A0@%[0 AD@%0 AX@%0 p@&c0 À@%0͔@50ͬ@50 @&Ã0 @@&S0 @&ʃ0  @&0,@60 AD@%0 X@&s0 Ap@%U΄%hUΐ8%0 AΜ@%0 ά@& 0 @&0 A@%0 A@%+0 @&+0  @&0 8@&ͻ0 AP@%K0 A`@%s0 Ap@&Uτ@%,0 Aϐ@&0 Ϩ@&ɣ0 A@%30 A@%0 A@%0 A$@&OS0 A@@%0 AX@%0 Al@%0 AЄ@&0 AМ@&0 Aа@&0 A@&c0 Q@&K0 A@&0 A@&00@5 0 L@& 0 `@&0 x@&#0 ѐ@&0 AѤ@&{0 A@&0 @&0 @&0 @& [0 A@& 0 A,@& 0 AL@& k0 Ad@& 0@$@0T$@ 0l$@X0Ӏ@5(0 Ӕ@& 0 Ӵ@& C0 @& 0 @&+0 @&c0 @&0 A$@' k0 4@&0 H@&0 \@&0 t@&0 Ԍ@& UմX&0 A@&0 A@&0 A@&0 A@&0 A@&0 A@&0 A4@&0 AL@'0 Ap@'+0 A֔@&+0 A֨@'0 A@'0 A@&0 A@&0 @&j0 A,@&Ns0 A<@&0 AT@& 0 Ah@&C0 A|@&0 Aא@&0 Aנ@&!C0 Aװ@&30 A@&#0 A@&0 A@&%0 A@&)c0 A@&)0 A @&*0 A8@&*s0L@0d@6`0 A؀@&,s0 Aؘ@&,0 Aج@&-C0 A@&/0 A@&30 A@&/0 A@&/0 @&0 A@&40 A0@&50 AD@&70 X@&0 Ah@&80 A|@&9;0 A٘@&90 Aٰ@&:0 @&30 A@&;30 @&= 0 A@&=0 A@&>0 A @&0 A4@&?0 AL@&@0 Ah@&A0 |@&F0 Aڔ@&B0 Aڨ@&CC0|$@0ۈ$@ 0 A۰@&أ0 A@& 0 A@&0 A@&#0 A@&0 A0@&0 AL@&;0 Ah@&0 A܀@&0 Aܔ@&;0 Aܬ@&0 A@'30 A@';0 A@'0 A$@&O0 A@@&0 AX@&{0 Al@&{0 A݀@&u0 Aݘ@&[0 Aݴ@'0 A@&0 A@&0 A@&;0 A@& 0 A4@&0 AL@&0 A\@&C0 t@&E;0 Aވ@&KUި&E0޴@0@0ߐ@ 0ߨ@0 @&F[0 @&F0 @&G0 d@&K0 |@&LCU&G|U &GU`&GU&HU8&J0$@ʸ0 @'0 A @&MU$&L0 A0@&MC0$@ 0$@ 0$$@0D@50h@50@50@50@50@50 @508@50\@50@50@50@50@50@5|0(@5x0L@5t0d@5p0@5l0@5h0@5d0@5`0 @5\0$@5XUL&PUX&PUdH&QUp&R,0 @'@0 A@&pS0 A@&m0 P@&_0 @'0@50 A @&nU0H&n U@&n<UP&nXU\0&ntUl&p40p$@H0 Q@&y#0 A@&yk0 Q@&y0 @&z+0 A@&zS0 A@&z{0 A@&z0 4@&0 QL@&{;0 U\@&|0 Qp@&{s0 Q@&}0 @&UH&U0&U8p&,0 @&C0@50 A@&#U&0 @&S0 8@&#0L@60 h@&0 @&30 @&s0 @&0 A@&CUV&Uh&$0 @&0 @&0 4@&0 H@&K0 A`@&ۃ0 @&0@60@50 @(@'0D$@u0P$@ ,0 \@'3U&0 @'0@60$@ 0$@ 0 @&ij0 Q@'IS0 @&30$@ H0$$@(U4&0@$@x0L$@@0X$@ 0d$@ L0 p@&{0 @&л0@6$0@6 0 @& 0 @&փU8X&|UH&јUT &Ѵ0 `@&0 |@&Ux&0 @&K0d@6(0@6p0 @&3U`&U&,0 @&s0 @&ܓ0 @&ܳ0 @&0 ,@&0 @@&[0 T@&ݛ0 h@&0 @& 0 Q@'80 Q@&0 \@&0 |@&0 @&0@60@6Uh&U& U&<0 @&S0 ,@&,$@ 4$@ <$@ 0D$@0T$@ 0h$@ 0t$@v`0 @@&U&0 @@' 0 @@&KU&U'`U'x0 @'S0 @'U@'U'LU' LUR' 0 @' +0 T@' SUh ' Ut' 0 @' 0 A@'Hs0 A@'H30|$@ t0@60@60@60@60@60 Q8@'#0P@60 At@'.;0 @'>30@60@60@60 @60 @@'D#0 Q@'HU'I40 `@'I0 Q@'K30 U @'Lk0 Q@'JS0 A@'J0 @'J0 @'K0 A@'Kk0 @'J0 A@'L0 Q@'K0 @'J0 A (@'LD$@ P$@ Up'I0 A @'L3 0  L@k 0  h@k 0  x@k 0  @k 0  @k 0  @k 0  @k 0  @l 0  @l/ 0  @lG 0  @lw 0  @l 0  @m+ 0  (@mO 0  8@mc 0  H@m{ 0  X@m 0  h@m 0  x@m 0  @nw 0  @n 0  @n 0  @n 0  @n 0  ,@+ 0  X@ 0  @ 0  @ 0 @w 0 @{ 0 (@ 0 8@ 0 H@ 0 X@ 0 h@ 0 @ 0 @ 0 @ 0 @ 0  @ 0 0@ 0 @@ 0 P@ 0 `@ 0 p@ 0 @ 0 @ 0 @ 0 @ 0 @ 0 @ 0 @ 0 @ 0 @ 0 @ 0  @ 0 0@ 0 @@ 0 P@ 0 `@ 0 p@ 0 @ 0 @ 0 @ 0 @ 0 @g 0 @o 0 @w 0 @ 0 @ 0 @ 0  @ 0 @C 0 ,@ 0 8@ 0 D@30t@0@0l((l0x#@EX0$@`0#@EXp'Id%ި&C@%7T&0%7\&Oΐ%0&O%ޠմ&&G%!$%7(0&X%&%!V$(&GX&N$&HP' %&'hH&|P'IPp&O&&XL&N80l%!h' h%%P&yp%EpH%F0d&Nnj%h8&%޸&z@&&z%8x&G@&Ot' RXQ%!%ޠP&O%&Hl&O%7΄%p`%!&GpPx%!&H τ%&y8%!<%F0&׀&X8&yp@$[@0W +0L8\88 H C8-x8@|(p 0$[@|8$Z/ZH$h8x@ $Z_ K$Z-|#+8$x H|0@8h? Ǩ0$8<<@8(` X$Z&Űsh` lx$Z$XvT fAl020 H0|x#+808n! l88? Ǩ8$H$0L0TH!V$(V#HVx#S,XS\U|"V$HV8#xV#SU#HT,!T!RXU#HTX!V$(QV(#`S `U#HU"HT"HU"SRXTx!QXT!RDXS XR0XS U$"HRXST RXV#HR\XU"S `SpRXS `T!RXT!T!SPXT!U#HV$`V`#RXS&&&&&4&0 `@'I'I0 Q@'K0'K0 U @'Lh'LS0 Q@'JP'J;0 A@'J'J0 @'J'J0 Q@'IP'I0 @'K'K0 A@'Kh'KS0 @'J'Js0 A@'L'K0 Q@'K'K0 @'J'J0 A (@'L'L0 @t0 Ul(@PP0 U@P;0 U@80 U@pS0 UL@00 U@0 Ud@k0 U@0 U0@0 AQ@30 A@%h%S0 AȰ@%%0 A@%%0 A4@& @& +0 Ah@& & 0 Aˀ@%(%0 Aː@%%0 A@%%0 A4@&?&?0 AL@&@&@0 A؀@&,p&,[0 AP@%H%0 Aވ@&H&0 A۰@&ؠ&؋0 Ap@%%S0 A@&&0 A@&&0 AX@%%0 AѤ@&x&c0 A@%0%0 A@& & 0 AЄ@&%0 A@&&0 A@&&0 AD@%%0 A,@&Np&N[0 A@&&0 A0@&&k0 AL@&8&#0 A`@%p%[0 A@%%{0 A@%%0 Al@%%0 Ah@&&0 A܀@&&0 Aܔ@&8&#0 Ad@& & 0 Aܬ@&&{0 A@&&0 A0@%X%C0 A,@& & 0 A@%0%0 A@'0'0 AD@%%s0 A@'8'#0 A@''k0 A@@%%0 A$@&O&O{0 A@@&&0 A @&&k0 AX@&x&c0 Al@&x&c0 A݀@&u&u0 A֨@''0 A@''0 Ap@'('0 AL@''s0 A$@&OP&O;0 A@%%0 Aݘ@&X&C0 À@%%0 Aݴ@''0 A@&x&c0 AΜ@%%0 A@& & 0 A@&&0 A@%(%0 AT@&&0 A@&`&K0 Aа@&&0 A@&&0 A@&&0 A@&8&#0 A@&&0 AX@%%k0 A@&0&0 A4@&&0 A@&&{0 AL@&&0 A @&*&*0 A@&)&)0 Aؘ@&,&,0 A|@&98&9#0 Aא@&&0 @&=&<0 Aנ@&!@&!+0 Aج@&-@&-+0 A@&=&=s0 A0@&5&5{0 Aٰ@&:&90 A@&/&/0 A@&&0 Ah@&8&8{0 A@&4&40 A@&&0 AL@& h& S0 A@&&0 A8@&*p&*[0 A@&%&%0 Aװ@&0&0 A@&&0 A٘@&9&90 A@& & 0 Aڨ@&C@&C+0 A@&)`&)K0 Aƌ@&*&*0 A@&;0&;0 A|@&&0 Ah@&@&+0 A@&/&.0 A@&&0 Ah@&A&A0 A֔@&(&0 A4@&&0 Aڔ@&B&B0 A@&>&>0 A<@&&0 A@&&0 AD@&7&7{0 A@&&k0 A@&pP&p0 \@'0'0 A@'H0'H0 A@'Hp'H[0 |@&L@&L+0 d@&K&J0 @&&0 @&0& __text_start ___stack_zero __data_startcrt0.oPA-RISC 2.0 Assembler HP92453-03UX.10.20.02 (DAVIS)mapdld ccom options = -ESlit -DA1.0 -DS1.0 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AcHPC HP92453-01 A.10.32_is_89_0L$0002L$0004L$0001 __map_dld DS$mapdlderrorC$2writestrlenitoa__exitopenreadlseekmmapclose_utssyssyserror$global$$START$$ARGV_environ _fp_status _CPU_REVISION_CPU_KEYBITS_1 _FPU_MODEL_start_mcount_clear_counters _sr4export__d_trap $UNWIND_START $UNWIND_END$RECOVER_START $RECOVER_END __dld_flags __dld_hook __dld_list __SYSTEM_ID _SYSTEM_ID _FPU_REVISIONenviron __d_trap_fptr $PFA_C_START $PFA_C_ENDerrno $$divI_10$$remI __dld_loc_etext_end $$dyncallfit2dHP F77 B3906/8AAB.10.20.DS$SD$ S$2$fit2dfit2dexpg_f2d_arrays _15_fit2d FTN_SET_AR FTN_300CHARS st_def_systemio_mset_optionsio_load_databaseio_write FTN_S_WSFI FTN_DO_CHIO FTN_E_WSFIio_textf2d_mset_optionsf2d_inp_datastorelg_window_titlegs_inq_windowformat gs_set_gpp FTN_WS_STOP io_malloc ma_rvaluef2d_gui f2d_keyboardio_close_logfilegs_close_graphicsio_freeio_save_database f2d_trailerst_out FTN_F_EXITU_EXITf2d_gui S$2$f2d_gui S$2DD$f2d_guist_save $$lr_wa_8 $$fill_12gs_inq_guiregiongs_inq_message $$fill_20 $$fill_15 $$fill_14 $$fill_16 $$lr_wa_9 $$fill_11 gs_promptgs_set_menulayoutgs_menu$$fill_9gs_inp_menuchoice $$scmp_fill $$wa_scmp_neq $$lr_wa_10 $$fill_10 $$fill_13gs_inpl $$fill_17 gs_update gs_message f2d_guihelp f2d_gui_2dfit f2d_gui_fs f2d_gui_ip gs_fpromptf2d_gui_macros f2d_gui_mfitgs_set_imagescalef2d_gui_xtallography f2d_gui_pd f2d_gui_saxs f2d_gui_testf2d_inp_datastoreS$2$f2d_inp_datastore_27_f2d_inp_datastoreio_inq_keyvaluegs_inq_lutchoice $$scmp_bytegs_set_lutchoice gs_coloursio_inq_ikeyvalueio_inq_rkeyvalueio_inq_lkeyvalue FTN_S_RSFI FTN_DO_L4IO FTN_E_RSFIgs_set_curvestylegs_inq_autoddr gs_inq_ddrgs_set_autoddr gs_set_ddrlg_set_logzscalinggs_inq_dataloglings_set_dataloglin f2d_keyboardS$2$f2d_keyboardS$9$f2d_keysub expg_io_dbdbexpg_io_dbinteractive $$fill_18 $$lr_wa_11io_menu lg_inp_resize f2d_keysubio_inpl $$fill_19 FTN_F_CLOS $$move_fill$$scmp_and_fillma_raddgs_inp_alabels $$copy_fillf2d_aspectratiof2d_autocorrelationf2d_axesscales f2d_bannerf2d_blurma_rcopy f2d_braggf2d_caddf2d_calculatorf2d_calibrationf2d_cdiv f2d_changes f2d_cmult gs_inp_lutslenio_set_keyvaluef2d_concatenation gs_2dcontour gs_xysgraphf2d_createdatags_inp_curvestyles io_variablef2d_filesequencef2d_difpatternio_inpi ma_l1valuef2d_displaylimits f2d_divide gs_close_ps f2d_entropy f2d_exchange f2d_extendf2d_fitf2d_flip gs_inp_fontf2d_fuji f2d_gaussian f2d_geometry gs_inp_gridf2d_help f2d_histogram f2d_imagef2d_i2cf2d_information fio_input gs_set_idrf2d_internalmemory f2d_linearisef2d_listvariables f2d_logarithmio_open_inmacrof2d_medianfilter f2d_messagef2d_move ma_rvarmult ma_rmultiply f2d_normalise f2d_offset $$fill_31io_open_logfile fio_output gs_inp_gpp io_writena FTN_S_RSLE FTN_E_RSLEf2d_peepf2d_pixelregiongs_plot ma_2dpoissonf2d_polarisationf2d_postscript f2d_powerspec f2d_predictor f2d_printgs_mset_publication f2d_question f2d_power f2d_rebin f2d_reflectgs_inp_2dregionf2d_powderring f2d_rotatelutf2d_selectpixel f2d_sequencegs_inp_alabelstylesgs_inp_arrowstylesgs_inp_axesstylesgs_inp_backgroundgs_inp_enumerationstylegs_inp_acoloursgs_inp_gridstyle gs_inp_layout gs_inp_lticksgs_inp_titlestylegs_inp_xlabelstylegs_inp_ylabelstyle f2d_sleepf2d_spatialfilterio_open_outmacrof2d_statisticsio_close_outmacro $$lr_wa_unk ma_rsubtract f2d_surface f2d_symfun f2d_thresholdio_inpc f2d_transpose f2d_undefinef2d_reciprocal f2d_variancesio_iswap ma_waverage f2d_zscalef2d_1dinterpolate f2d_3dsurface f2d_xygraph$$mulIf2d_mset_optionsS$2$f2d_mset_options io_getargs F77_INDEXio_toktigs_open_graphicsio_inq_inmacro f2d_gui_sizes $$lr_wa_18 $$lr_wa_17io_set_ikeyvalue f2d_trailerS$2$f2d_trailerf2d_logoU_dDget $$move_byte U_dDreleasef2d_1dinterpolateS$2$f2d_1dinterpolate $$lr_wa_16io_inprma_1dintercorr f2d_3dsurfaceS$2$f2d_3dsurfaceS$2DD$f2d_3dsurface FTN_ALOG10$gs_inq_3dstylelg_inq_logzscaling $$lr_wa_13 $$lr_wa_14 gs_inq_3daxeslg_inq_imagerangelg_set_imagerangegs_inq_imagescalegs_inq_pixellimits gs_cal_zrange gs_set_3dview gs_3dsurfacegs_inpr $$lr_wa_12gs_set_pixellimitsgs_cal_colours f2d_3dstylef2d_aspectratioS$2$f2d_aspectratiogs_inq_iaspectgs_set_iaspectf2d_autocorrelationS$2$f2d_autocorrelation_37_f2d_autocorrelation FTN_DO_I4IOma_rmovema_autocorrelationf2d_axesscalesS$2$f2d_axesscales $$lr_wa_15f2d_axes f2d_bannerS$2$f2d_bannerf2d_draw_bannerf2d_conditionshelpf2d_bannerhelp gs_inq_dddr gs_inq_gpp lg_datawindow lg_viewportf2d_blur S$2$f2d_blurgs_inpi ma_tophatcon ma_rcmult f2d_bragg S$2$f2d_braggS$2DD$f2d_bragg FTN_ASIN$ _20_f2d_bragg _24_f2d_bragg _26_f2d_bragg _27_f2d_braggf2d_inp_wavelength FTN_DO_R4IO$$sinff2d_cadd S$2$f2d_caddma_rcaddf2d_calculatorBS$S$2$f2d_calculatorS$2DD$f2d_calculator FTN_ACOS$ FTN_ATAN$_94_f2d_calculator_126_f2d_calculator_127_f2d_calculator_128_f2d_calculator_129_f2d_calculator_153_f2d_calculator_178_f2d_calculator io_tokensio_toktr f2d_pushstack io_command FTN_CABS$FTN_CCOSFTN_DIVCFTN_CEXPFTN_CLOG FTN_DO_C8IOFTN_CTOCFTN_CSIN FTN_CSQRT io_inq_varnum io_inptokenNINTio_set_variable io_var_number$$tanff2d_calibrationSB$S$2$f2d_calibration f2d_ffdclutcf2d_cal_distortion f2d_decayf2d_destroypeaksf2d_display2ddistortion f2d_falsepeak f2d_corr_fastf2d_calibrate2dgrid f2d_fit2dgrid f2d_flatfieldf2d_help_calibratef2d_idealspacef2d_in_spatialf2d_clinearisef2d_learnprofile f2d_inp_dclut f2d_sdlutf2d_out_spatialf2d_2ddistortion f2d_residualsf2d_save2dpeaksf2d_corr_spatial f2d_out_dclut f2d_dist2memf2d_view2dpeaksf2d_xriiflatfieldf2d_cdiv S$2$f2d_cdiv f2d_changesst_goodlg_inq_textfont lg_textfont f2d_cmult S$2$f2d_cmultf2d_concatenationS$2$f2d_concatenationio_inps $$fill_big $$lr_na_unkf2d_createdataS$2$f2d_createdataf2d_difpatternS$2$f2d_difpattern_23_f2d_difpattern_24_f2d_difpattern_25_f2d_difpatternf2d_inq_geometry gs_set_dddrf2d_diffraction gs_xygraph gs_2dimage gs_xycurves gs_on_print gs_off_print$$cosff2d_displaylimitsS$2$f2d_displaylimits f2d_divideS$2$f2d_divide ma_rdivide f2d_entropyS$2$f2d_entropy_44_f2d_entropy_45_f2d_entropy_51_f2d_entropy_52_f2d_entropy_57_f2d_entropy_58_f2d_entropy_71_f2d_entropy_95_f2d_entropy_96_f2d_entropy_101_f2d_entropy_102_f2d_entropy_103_f2d_entropy FTN_S_WSFE FTN_E_WSFE FTN_DO_D8IOIDNINT$$fill_unk_unk $$lr_unk_unk$$log f2d_exchangeS$2$f2d_exchangeio_cswapio_rswapio_lswap f2d_extendS$2$f2d_extendf2d_filesequenceS$2$f2d_filesequenceio_filesequencef2d_fit S$2$f2d_fitexpg_f2d_lsqinc _44_f2d_fit _45_f2d_fit _46_f2d_fit _47_f2d_fit _48_f2d_fit _53_f2d_fit _58_f2d_fitf2d_2thetatoringsf2d_cake f2d_scale f2d_constrainf2d_mask gs_2dmimagef2d_parameters f2d_maskstatsio_times f2d_lsqfit2d FTN_PARSE_FMT f2d_featuref2d_uninormalisef2d_out_parametersf2d_powderdiffractionio_rset f2d_rtheta f2d_radialf2d_maskcolour f2d_setup f2d_calibrant f2d_chebyshevf2d_maskthresholdf2d_tiltcentref2d_maskmemoryf2d_set_geometryf2d_flip S$2$f2d_flipma_rflipf2d_fuji S$2$f2d_fuji FTN_RTOI$ FTN_RTOR$ f2d_gaussianS$2$f2d_gaussianS$2DD$f2d_gaussian ma_2dgaussian f2d_geometryS$2$f2d_geometryS$2DD$f2d_geometryexpg_f2d_comcirclef2d_beamcentref2d_gui_geometryf2d_inp_sampledistancef2d_inp_pixelsizesf2d_inp_detectortilt f2d_gui_2dfitS$2$f2d_gui_2dfit_56_f2d_gui_2dfit_57_f2d_gui_2dfit_58_f2d_gui_2dfit_59_f2d_gui_2dfit_60_f2d_gui_2dfit_65_f2d_gui_2dfit_70_f2d_gui_2dfitgs_mplot gs_ppromptgs_fmenu f2d_clickf2d_1dconstraints f2d_displayf2d_fullf2d_gui_2dfithelpf2d_gui_parameters $$lr_na_8 fio_gui_input f2d_options gs_fwarningfio_gui_output f2d_mfitsetup f2d_zoominf2d_gui_zscaleio_set_rkeyvalue f2d_gui_fsS$2$f2d_gui_fs f2d_average f2d_compositef2d_gui_fshelp f2d_fsinputf2d_fsintegrate f2d_gui_ipS$2$f2d_gui_ipf2d_gui_filterf2d_gui_iphelpf2d_gui_geometric f2d_gui_maths gs_inp_unzoomf2d_gui_macrosS$2$f2d_gui_macrosf2d_gui_macroshelpf2d_open_outmacro f2d_open_logf2d_open_inmacrof2d_gui_sequence f2d_gui_mfitS$2$f2d_gui_mfitexpg_f2d_lsqmfitincf2d_mfitdisplayf2d_gui_mfithelpgs_inps_fcoordinates ma_dc2pixcf2d_1dinitialisef2d_mfitoptimisef2d_gui_vectorsio_set_lkeyvalue f2d_gui_pdS$2$f2d_gui_pdf2d_gui_correctionf2d_gui_pdhelp f2d_integrategs_inq_curvestyle f2d_gui_saxsS$2$f2d_gui_saxs_83_f2d_gui_saxsf2d_gui_saxshelpf2d_gui_projectionf2d_spherical_modf2d_1dtransforms f2d_gui_sizesS$2$f2d_gui_sizes $$lr_na_13 $$lr_na_10 $$lr_na_12gs_form f2d_gui_testS$2$f2d_gui_testS$2DD$f2d_gui_test f2d_trianglef2d_gui_xtallographyS$2$f2d_gui_xtallography_38_f2d_gui_xtallographyf2d_draw_peaksio_newfilenameio_sleepf2d_gui_xtalhelpf2d_gui_peaksearch f2d_guihelpf2d_help f2d_histogramS$2$f2d_histogram_30_f2d_histogram_31_f2d_histogram ma_rminmaxf2d_i2c S$2$f2d_i2cio_itoc f2d_image S$2$f2d_imagef2d_informationS$2$f2d_information_18_f2d_information_19_f2d_information_23_f2d_information_24_f2d_information_25_f2d_information_26_f2d_information_27_f2d_information_28_f2d_information_31_f2d_information_32_f2d_information_33_f2d_information_34_f2d_information_35_f2d_information_36_f2d_informationf2d_internalmemoryS$2$f2d_internalmemory_28_f2d_internalmemory_33_f2d_internalmemory f2d_lineariseS$2$f2d_linearisef2d_listvariablesS$2$f2d_listvariables $$fill_28io_ltocio_rtoc f2d_logarithmS$2$f2d_logarithm st_errorcode ma_logarithm ma_thresholdf2d_logof2d_medianfilterS$2$f2d_medianfilter ma_medfilter f2d_messageS$2$f2d_message_22_f2d_message_23_f2d_message_27_f2d_message_28_f2d_message_29_f2d_message_30_f2d_messagef2d_move S$2$f2d_moveS$2DD$f2d_move _39_f2d_move _50_f2d_movema_cal_2dtransformationma_2dtransform ma_rrotate ma_rtransform f2d_normaliseS$2$f2d_normalise_31_f2d_normalisema_rmax f2d_offsetS$2$f2d_offset_65_f2d_offset_66_f2d_offsetf2d_peep S$2$f2d_peep _33_f2d_peep _34_f2d_peep _35_f2d_peep _44_f2d_peep _53_f2d_peep _55_f2d_peep _56_f2d_peep _57_f2d_peepgs_inp_coordinatesf2d_pixelregionS$2$f2d_pixelregionf2d_polarisationS$2$f2d_polarisationS$2DD$f2d_polarisation $$lr_na_9 FTN_ATAN2$f2d_postscriptS$2$f2d_postscriptgs_inq_postscriptgs_set_postscriptf2d_powderringS$2$f2d_powderringS$2DD$f2d_powderringf2d_inp_beamcentref2d_addpowderring f2d_power S$2$f2d_powerma_power gs_warning f2d_powerspecS$2$f2d_powerspec_39_f2d_powerspec ma_2dfrfft f2d_predictorS$2$f2d_predictorS$2DD$f2d_predictor f2d_print S$2$f2d_print gs_3dlines f2d_questionS$2$f2d_question_22_f2d_question_23_f2d_question_24_f2d_question_26_f2d_question_28_f2d_question_33_f2d_question_42_f2d_question_47_f2d_question_51_f2d_question_52_f2d_question_56_f2d_question_57_f2d_question_58_f2d_questiongs_inps_coordinatesgs_markgs_fileselectiongs_inpslg_clear f2d_rebin S$2$f2d_rebin ma_rrebin ma_rscalef2d_reciprocalS$2$f2d_reciprocal_19_f2d_reciprocal_20_f2d_reciprocal_21_f2d_reciprocal_22_f2d_reciprocal_23_f2d_reciprocal_24_f2d_reciprocal_25_f2d_reciprocal_27_f2d_reciprocal_28_f2d_reciprocal_29_f2d_reciprocal_30_f2d_reciprocal_31_f2d_reciprocal_32_f2d_reciprocal_33_f2d_reciprocalio_inpdf2d_unit2reciprocalf2d_recip2unit f2d_reflectS$2$f2d_reflect_42_f2d_reflect_43_f2d_reflect ma_rreflect f2d_rotatelutS$2$f2d_rotatelutlg_inq_colourmapping lg_rotatelutf2d_selectpixelS$2$f2d_selectpixel $$lr_wa_19 f2d_sequenceS$2$f2d_sequence_27_f2d_sequence_46_f2d_sequenceio_open_asciifile FTN_S_RSFE FTN_E_RSFE $$copy_bytef2d_inp_datatype io_filename f2d_sleep S$2$f2d_sleepf2d_spatialfilterS$2$f2d_spatialfilter_37_f2d_spatialfilter_38_f2d_spatialfilterma_sconvolutionf2d_statisticsS$2$f2d_statistics_28_f2d_statistics_29_f2d_statistics_30_f2d_statistics_31_f2d_statistics_32_f2d_statistics_33_f2d_statistics_34_f2d_statistics_35_f2d_statistics_36_f2d_statistics_37_f2d_statistics_38_f2d_statistics ma_statistics f2d_surfaceS$2$f2d_surface_43_f2d_surfacema_sinterpolate f2d_symfunS$2$f2d_symfun ma_symfun f2d_thresholdS$2$f2d_threshold f2d_transposeS$2$f2d_transpose ma_rtranspose f2d_undefineS$2$f2d_undefineio_unset_variable f2d_variancesS$2$f2d_variancesS$2DD$f2d_variances_38_f2d_variances_79_f2d_variances f2d_xygraphS$2$f2d_xygraphgs_inq_errorbarsgs_set_errorbarsgs_int_xyegraph f2d_zscaleS$2$f2d_zscalef2d_1dconstraintsS$2$f2d_1dconstraintsS$2DD$f2d_1dconstraints_32_f2d_1dconstraints $$lr_na_7f2d_1dinitialiseS$2$f2d_1dinitialiseS$2DD$f2d_1dinitialise_67_f2d_1dinitialise_70_f2d_1dinitialise_71_f2d_1dinitialise_74_f2d_1dinitialise_75_f2d_1dinitialise_77_f2d_1dinitialise_78_f2d_1dinitialise_79_f2d_1dinitialise_81_f2d_1dinitialise_84_f2d_1dinitialise_86_f2d_1dinitialise_88_f2d_1dinitialise_91_f2d_1dinitialise_93_f2d_1dinitialise_94_f2d_1dinitialise_100_f2d_1dinitialise_101_f2d_1dinitialise_102_f2d_1dinitialise_104_f2d_1dinitialise_105_f2d_1dinitialise_106_f2d_1dinitialise lg_clipwindowlg_clip gs_linestyle f2d_1dfeature lg_polylinef2d_1dinithelpma_1dchebyshevma_cal_polynomial ma_1dgaussianma_1dlorentzian ma_1dvoigtian ma_1dexpdecayma_1dsinusoidalf2d_1dtransformsS$2$f2d_1dtransforms$$fill_8f2d_2ddistortionS$2$f2d_2ddistortion_39_f2d_2ddistortion_53_f2d_2ddistortion_56_f2d_2ddistortion_66_f2d_2ddistortion_76_f2d_2ddistortion_90_f2d_2ddistortion_104_f2d_2ddistortion_109_f2d_2ddistortion$$sin$$cosf2d_2thetatoringsS$2$f2d_2thetatoringsS$2DD$f2d_2thetatorings_56_f2d_2thetatorings $$lr_na_11 $$lr_na_14 $$lr_na_17 f2d_3dstyleS$2$f2d_3dstylegs_inq_3dsimagegs_set_3dstyle gs_set_3daxesgs_set_3dsimagef2d_addpowderringS$2$f2d_addpowderring ma_gaussian f2d_averageS$2$f2d_average_42_f2d_average f2d_def_fs io_nodirpath gs_backgroundf2d_axes S$2$f2d_axesf2d_bannerhelpf2d_beamcentreS$2$f2d_beamcentre_72_f2d_beamcentre_73_f2d_beamcentre_74_f2d_beamcentre_76_f2d_beamcentre_77_f2d_beamcentre_90_f2d_beamcentre_91_f2d_beamcentre_93_f2d_beamcentre_94_f2d_beamcentre_99_f2d_beamcentre_100_f2d_beamcentref2d_beamcentrehelpf2d_projectfitgs_cal_wctopixf2d_beamgaussianf2d_lsqellipse f2d_lsqcirclef2d_cake S$2$f2d_cake f2d_inp_cake f2d_draw_cake f2d_cal_cakelg_set_rubberband f2d_cakehelpf2d_cal_distortionS$2$f2d_cal_distortion_37_f2d_cal_distortionf2d_cal2_distortion f2d_calibrantS$2$f2d_calibrantS$2DD$f2d_calibrantexpg_f2d_comrings_86_f2d_calibrant_87_f2d_calibrant_88_f2d_calibrant_90_f2d_calibrant_92_f2d_calibrant_93_f2d_calibrant_95_f2d_calibrant_96_f2d_calibrant_99_f2d_calibrant_103_f2d_calibrant_107_f2d_calibrant_114_f2d_calibrant_115_f2d_calibrant_116_f2d_calibrant_117_f2d_calibrant_118_f2d_calibrant_119_f2d_calibrant_120_f2d_calibrant_136_f2d_calibrant_137_f2d_calibrant_138_f2d_calibrant_139_f2d_calibrant_140_f2d_calibrant_141_f2d_calibrant_142_f2d_calibrant_143_f2d_calibrant_144_f2d_calibrant_150_f2d_calibrant gs_inp_choicef2d_calibrant_user $$lr_na_16 f2d_ellipse f2d_findringsf2d_tiltdisplay f2d_tiltinfof2d_fitcalibrantf2d_lsqpolarisationf2d_calibrate2dgridS$2$f2d_calibrate2dgrid_42_f2d_calibrate2dgrid_43_f2d_calibrate2dgrid_44_f2d_calibrate2dgrid_47_f2d_calibrate2dgrid_48_f2d_calibrate2dgrid_49_f2d_calibrate2dgridf2d_initgridsearchf2d_caltemplatef2d_findcentref2d_find2dgridf2d_findrotatef2d_vignetting f2d_chebyshevS$2$f2d_chebyshev_47_f2d_chebyshevf2d_fitchebyshevma_cal_2dchebyshev f2d_click S$2$f2d_click gs_inq_dgpp gs_inq_dlutpclg_wc2pc gs_fillstyle gs_rectangle gs_textstylelg_textf2d_clineariseS$2$f2d_clinearisefio_in_freeformatma_sortf2d_polynomial f2d_compositeS$2$f2d_compositeS$2DD$f2d_composite_48_f2d_composite f2d_gui_roif2d_conditionshelp f2d_constrainS$2$f2d_constrain_26_f2d_constrain f2d_corr_fastS$2$f2d_corr_fast_32_f2d_corr_fast_39_f2d_corr_fast_40_f2d_corr_fast_43_f2d_corr_fast_44_f2d_corr_fastf2d_corr_fastcf2d_corr_spatialS$2$f2d_corr_spatial_38_f2d_corr_spatial_39_f2d_corr_spatial_41_f2d_corr_spatialf2d_corr5_spatialf2d_corr6_spatial f2d_decay S$2$f2d_decayFTN_EXP$ _39_f2d_decayf2d_destroypeaksS$2$f2d_destroypeaks_36_f2d_destroypeaksf2d_diffractionS$2$f2d_diffraction f2d_peakxyf2d_display2ddistortionS$2$f2d_display2ddistortionS$4$f2d_display1 f2d_display1 f2d_displayS$2$f2d_display f2d_arcslice f2d_continue f2d_distancef2d_displayhelp f2d_numbers f2d_pixelxyf2d_projection f2d_saturated f2d_slicef2d_gstatistics f2d_dist2memS$2$f2d_dist2memf2d_draw_bannerS$2$f2d_draw_bannerS$2DD$f2d_draw_bannergs_doc_controlgs_db_jcoloursgs_drawn_mtitle gs_drawn_menu gs_menustyle gs_menulayout gs_set_dgppgs_set_char_scalinggs_draw_character gs_trianglef2d_draw_peaksS$2$f2d_draw_peaksgs_markerstylelg_markerwidth lg_polymarker f2d_falsepeakS$2$f2d_falsepeakS$2DD$f2d_falsepeak f2d_featureS$2$f2d_featureS$2DD$f2d_feature ma_exdigit ma_2dpolargau f2d_rowline f2d_fit2dgridS$2$f2d_fit2dgridS$9$f2d_fit2dgrid2_52_f2d_fit2dgrid_53_f2d_fit2dgrid_54_f2d_fit2dgrid_66_f2d_fit2dgrid_67_f2d_fit2dgrid_68_f2d_fit2dgridf2d_fit2dgrid2surfit f2d_fit2dtest f2d_flatfieldS$2$f2d_flatfieldS$2DD$f2d_flatfieldf2d_calprofilef2d_calflatfield f2d_fltfield f2d_fsinputS$2$f2d_fsinput $$lr_wa_20f2d_fsintegrateS$2$f2d_fsintegrate_41_f2d_fsintegratef2d_inp_correctionf2d_inq_integratefio_inp_outputgs_inpc f2d_cal2_cakeio_fileextension fio_gui_outf2d_full S$2$f2d_fullf2d_gui_2dfithelpf2d_gui_correctionS$2$f2d_gui_correctionf2d_gui_filterS$2$f2d_gui_filterf2d_gui_fshelpf2d_gui_geometricS$2$f2d_gui_geometric f2d_transformf2d_gui_geometryS$2$f2d_gui_geometryf2d_gui_iphelpf2d_gui_macroshelp f2d_gui_mathsS$2$f2d_gui_mathsf2d_gui_scaledsubf2d_gui_mfithelpf2d_gui_parametersS$2$f2d_gui_parametersS$2DD$f2d_gui_parameters_48_f2d_gui_parameters_55_f2d_gui_parameters_56_f2d_gui_parameters_57_f2d_gui_parameters_58_f2d_gui_parameters_59_f2d_gui_parameters_60_f2d_gui_parameters_61_f2d_gui_parameters_69_f2d_gui_parameters_70_f2d_gui_parameters_72_f2d_gui_parameters_73_f2d_gui_parameters_74_f2d_gui_parameters_75_f2d_gui_parameters_76_f2d_gui_parameters_77_f2d_gui_parameters_84_f2d_gui_parameters_85_f2d_gui_parameters_87_f2d_gui_parameters_88_f2d_gui_parameters_89_f2d_gui_parameters_90_f2d_gui_parameters_91_f2d_gui_parameters_92_f2d_gui_parameters_93_f2d_gui_parameters_94_f2d_gui_parameters_97_f2d_gui_parameters_98_f2d_gui_parameters_99_f2d_gui_parameters_100_f2d_gui_parameters_101_f2d_gui_parameters_102_f2d_gui_parameters_103_f2d_gui_parameters_104_f2d_gui_parameters_105_f2d_gui_parameters_106_f2d_gui_parameters_107_f2d_gui_parameters_108_f2d_gui_parameters_113_f2d_gui_parametersf2d_inputmodelf2d_gui_pdhelpf2d_gui_peaksearchS$2$f2d_gui_peaksearchS$2DD$f2d_gui_peaksearch_39_f2d_gui_peaksearch_41_f2d_gui_peaksearch_42_f2d_gui_peaksearch_43_f2d_gui_peaksearch_48_f2d_gui_peaksearch_54_f2d_gui_peaksearch_105_f2d_gui_peaksearch_114_f2d_gui_peaksearch_143_f2d_gui_peaksearch io_outfilef2d_peaksearch f2d_editpeaksf2d_gui_projectionS$2$f2d_gui_projectionS$2DD$f2d_gui_projectionf2d_inp_projectionf2d_cal_gisaxsf2d_gui_saxshelpf2d_gui_sequenceS$2$f2d_gui_sequence_30_f2d_gui_sequencef2d_gui_vectorsS$2$f2d_gui_vectors gs_xyclickf2d_gui_vechelpgs_inp_xyregionf2d_gui_xtalhelpf2d_gui_zscaleS$2$f2d_gui_zscalelg_pc2wcf2d_help_calibratef2d_idealspaceS$2$f2d_idealspacef2d_in_spatialS$2$f2d_in_spatial_35_f2d_in_spatial_36_f2d_in_spatial_37_f2d_in_spatial_44_f2d_in_spatial_50_f2d_in_spatial_56_f2d_in_spatial_57_f2d_in_spatial_64_f2d_in_spatial_70_f2d_in_spatial_76_f2d_in_spatial fio_openfilefio_asciireadcfio_fileclosecf2d_inp_beamcentreS$2$f2d_inp_beamcentref2d_inp_datatypeS$2$f2d_inp_datatype f2d_inp_dclutS$2$f2d_inp_dclut io_trans_path f2d_in2dclutf2d_inp_detectortiltS$2$f2d_inp_detectortiltf2d_inp_pixelsizesS$2$f2d_inp_pixelsizesf2d_inp_sampledistanceS$2$f2d_inp_sampledistancef2d_inp_wavelengthS$2$f2d_inp_wavelength_21_f2d_inp_wavelength_25_f2d_inp_wavelengthf2d_inq_geometryS$2$f2d_inq_geometry f2d_integrateS$2$f2d_integratef2d_learnprofileS$2$f2d_learnprofileS$2DD$f2d_learnprofile f2d_lsqfit2dS$2$f2d_lsqfit2d L$plab_start_46_f2d_lsqfit2d_47_f2d_lsqfit2d_63_f2d_lsqfit2d f2d_funfit2d ma_modelfit f2d_funtype f2d_pgauintf2d_cal_projectionf2d_mask S$2$f2d_mask f2d_1dmask f2d_maskpeaksf2d_maskpolygon f2d_maskarcf2d_maskcolourS$2$f2d_maskcolourgs_inq_maskcolour gs_inp_colourgs_set_maskcolourf2d_maskmemoryS$2$f2d_maskmemory f2d_maskstatsS$2$f2d_maskstats_35_f2d_maskstats_36_f2d_maskstats_37_f2d_maskstats_38_f2d_maskstatsf2d_maskthresholdS$2$f2d_maskthresholdf2d_mfitdisplayS$2$f2d_mfitdisplayS$3$f2d_submfitdisplayf2d_submfitdisplaygs_inq_axesloglings_inq_vaxesstylegs_set_vaxesstyle gs_xyegraphgs_inq_curvemarkersgs_set_curvemarkers gs_markersgs_inq_backgroundgs_set_backgroundlg_unitytransformgs_textf2d_mfitoptimiseS$2$f2d_mfitoptimiseS$2DD$f2d_mfitoptimise f2d_lsqmfit f2d_mfitsetupS$2$f2d_mfitsetupf2d_open_inmacroS$2$f2d_open_inmacrof2d_open_outmacroS$2$f2d_open_outmacro f2d_open_logS$2$f2d_open_log f2d_optionsS$2$f2d_options gs_inq_lut f2d_colours gs_set_lut f2d_gui_grid f2d_position f2d_out_dclutS$2$f2d_out_dclutS$18$f2d_suboutdclut_33_f2d_out_dclut_47_f2d_out_dclut_52_f2d_out_dclut_57_f2d_out_dclut_62_f2d_out_dclut_67_f2d_out_dclut_72_f2d_out_dclut_78_f2d_out_dclut_83_f2d_out_dclut_127_f2d_out_dclut_128_f2d_out_dclut_144_f2d_out_dclut_145_f2d_out_dclut_165_f2d_out_dclut fio_fileopenf2d_suboutdclutfio_filewritecf2d_out_parametersS$2$f2d_out_parametersS$2DD$f2d_out_parametersio_recl FTN_F_OPEN io_big_endianio_fwrite_stringio_fwrite_l1arrayio_fwrite_integerio_fwrite_realio_fwrite_rarrayio_fwrite_iarrayio_fwrite_carrayf2d_out_spatialS$2$f2d_out_spatial_33_f2d_out_spatial_35_f2d_out_spatial_37_f2d_out_spatial_39_f2d_out_spatial_41_f2d_out_spatial_43_f2d_out_spatial_45_f2d_out_spatial_47_f2d_out_spatial_49_f2d_out_spatial_51_f2d_out_spatial_53_f2d_out_spatial_55_f2d_out_spatial_57_f2d_out_spatial_61_f2d_out_spatial_65_f2d_out_spatial_69_f2d_out_spatial_71_f2d_out_spatial_73_f2d_out_spatial_75_f2d_out_spatial_79_f2d_out_spatial_83_f2d_out_spatial FTN_DO_R4IOAf2d_parametersS$2$f2d_parametersf2d_inp_parametersf2d_powderdiffractionS$2$f2d_powderdiffractionS$2DD$f2d_powderdiffraction_33_f2d_powderdiffraction_34_f2d_powderdiffraction_35_f2d_powderdiffraction_36_f2d_powderdiffraction_37_f2d_powderdiffractionf2d_inp_polarisation f2d_sradialf2d_tiltradial f2d_lorentz fio_out_pds f2d_radialS$2$f2d_radial ma_radialf2d_recip2unitS$2$f2d_recip2unit$$acos f2d_residualsS$2$f2d_residualsma_cal_nbcubspline f2d_rthetaS$2$f2d_rthetaS$2DD$f2d_rtheta_32_f2d_rtheta_33_f2d_rtheta_34_f2d_rtheta_35_f2d_rtheta_36_f2d_rtheta f2d_rtheta2f2d_save2dpeaksS$2$f2d_save2dpeaks_33_f2d_save2dpeaks_34_f2d_save2dpeaks_43_f2d_save2dpeaks f2d_scale S$2$f2d_scale _23_f2d_scale _24_f2d_scale _25_f2d_scale _33_f2d_scale f2d_sdlut S$2$f2d_sdlutS$3$f2d_sdlutsubS$3DD$f2d_sdlutsub f2d_sdlutsub_213_f2d_sdlutsub_214_f2d_sdlutsub_215_f2d_sdlutsub_219_f2d_sdlutsub_221_f2d_sdlutsubma_cal_2dncubspline ma_trirebin f2d_sdadd1 f2d_sdsub1f2d_set_geometryS$2$f2d_set_geometry f2d_setup S$2$f2d_setup _20_f2d_setupf2d_spherical_modS$2$f2d_spherical_mod_31_f2d_spherical_modgs_linef2d_tiltcentreS$2$f2d_tiltcentreS$15$f2d_tiltinfoS$25$f2d_tilt2info_50_f2d_tiltcentref2d_inp_ellipse f2d_inpradia f2d_fitpowder f2d_tilt2info_100_f2d_tiltinfo_101_f2d_tiltinfo_102_f2d_tiltinfo_103_f2d_tiltinfo_104_f2d_tiltinfo_105_f2d_tiltinfo_106_f2d_tiltinfo_108_f2d_tiltinfo_109_f2d_tiltinfo_118_f2d_tilt2info_119_f2d_tilt2info_124_f2d_tilt2info_125_f2d_tilt2info_126_f2d_tilt2info_127_f2d_tilt2info_128_f2d_tilt2info f2d_triangleS$2$f2d_trianglework_27_f2d_triangle_32_f2d_triangle lg_ras_orderylg_ras_trixlimitsf2d_uninormaliseS$2$f2d_uninormalisef2d_unit2reciprocalS$2$f2d_unit2reciprocalS$2DD$f2d_unit2reciprocalf2d_view2dpeaksS$2$f2d_view2dpeaks_36_f2d_view2dpeaks_50_f2d_view2dpeaks_59_f2d_view2dpeaksf2d_xriiflatfieldS$2$f2d_xriiflatfieldS$2DD$f2d_xriiflatfieldf2d_calabsorption f2d_zoominS$2$f2d_zoomin_30_f2d_zoomin_32_f2d_zoomin_51_f2d_zoominf2d_ffdclutc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaS$2$f2d_ffdclutc f2d_1dfeatureS$2$f2d_1dfeatureS$2DD$f2d_1dfeaturef2d_1dinithelp f2d_1dmaskS$2$f2d_1dmaskf2d_1dmaskhelpf2d_1dmaskregion f2d_arcsliceS$2$f2d_arcslicema_cal_circentre ma_arcslicef2d_beamcentrehelpf2d_beamgaussianS$2$f2d_beamgaussian_65_f2d_beamgaussian_66_f2d_beamgaussian_67_f2d_beamgaussian_68_f2d_beamgaussian_69_f2d_beamgaussian_70_f2d_beamgaussian_71_f2d_beamgaussianf2d_lsqgaussian f2d_cakehelp f2d_cal_cakeS$2$f2d_cal_cake $$lr_na_15f2d_cal_gisaxsS$2$f2d_cal_gisaxsS$2DD$f2d_cal_gisaxsf2d_cal_projectionS$2$f2d_cal_projection f2d_cal2_cakeS$2$f2d_cal2_cakeS$2DD$f2d_cal2_cake_89_f2d_cal2_cake_91_f2d_cal2_cakef2d_cal2_distortionS$2$f2d_cal2_distortion_33_f2d_cal2_distortionf2d_calabsorptionS$2$f2d_calabsorptionma_slope ma_linecirclef2d_calflatfieldS$2$f2d_calflatfieldf2d_calibrant_userS$2$f2d_calibrant_userfio_in_1dasciif2d_calprofileS$2$f2d_calprofilef2d_caltemplateS$2$f2d_caltemplateS$2DD$f2d_caltemplate ma_2gaussianma_rmean f2d_coloursS$2$f2d_coloursf2d_colourshelp f2d_continueS$2$f2d_continuef2d_corr5_spatialS$2$f2d_corr5_spatialS$2DD$f2d_corr5_spatial_113_f2d_corr5_spatial_114_f2d_corr5_spatial_115_f2d_corr5_spatial_117_f2d_corr5_spatial_119_f2d_corr5_spatialf2d_corr6_spatialS$2$f2d_corr6_spatialS$2DD$f2d_corr6_spatial_114_f2d_corr6_spatial_115_f2d_corr6_spatial_116_f2d_corr6_spatial_118_f2d_corr6_spatial_120_f2d_corr6_spatial f2d_def_fsS$2$f2d_def_fsf2d_displayhelp f2d_distanceS$2$f2d_distance_29_f2d_distance_30_f2d_distance f2d_draw_cakeS$2$f2d_draw_cake gs_arcellipse f2d_editpeaksS$2$f2d_editpeaksf2d_editpeakshelp f2d_ellipseS$2$f2d_ellipse gs_rellipsef2d_find2dgridS$2$f2d_find2dgrid f2d_findlinef2d_findurquadf2d_findulquadf2d_findlrquadf2d_findllquadf2d_findcentreS$2$f2d_findcentre ma_centre ma_bestcentre f2d_findringsS$2$f2d_findrings_37_f2d_findrings_55_f2d_findringsf2d_ringcoordsf2d_findrotateS$2$f2d_findrotatema_pc2dc f2d_fit2dtestS$2$f2d_fit2dtest_51_f2d_fit2dtest_52_f2d_fit2dtest_53_f2d_fit2dtest_54_f2d_fit2dtestf2d_fitcalibrantS$2$f2d_fitcalibrantf2d_lsqcalibrantf2d_ringoutliersf2d_fitchebyshevS$2$f2d_fitchebyshevf2d_subfitchebyma_2dchebyshev f2d_fitpowderS$2$f2d_fitpowderexpg_f2d_controlpowder f2d_lsqpowder f2d_funfit2dS$2$f2d_funfit2d f2d_funtypeS$2$f2d_funtypef2d_gstatisticsS$2$f2d_gstatistics_46_f2d_gstatistics_47_f2d_gstatistics_48_f2d_gstatistics_50_f2d_gstatistics_51_f2d_gstatistics_52_f2d_gstatistics_53_f2d_gstatistics_54_f2d_gstatistics_55_f2d_gstatistics_56_f2d_gstatistics_58_f2d_gstatistics_63_f2d_gstatisticsma_ga05ama_ga05bgs_set_message f2d_gui_gridS$2$f2d_gui_grid gs_inq_grid gs_set_grid f2d_gui_roiS$2$f2d_gui_roif2d_gui_roihelpf2d_gui_scaledsubS$2$f2d_gui_scaledsub_33_f2d_gui_scaledsub f2d_scaledbisf2d_gui_scaledsubhelpf2d_gui_vechelp f2d_in2dclutS$2$f2d_in2dclut_84_f2d_in2dclut_186_f2d_in2dclut fio_filereadcf2d_subin2dclutf2d_initgridsearchS$2$f2d_initgridsearchgs_arrow f2d_inp_cakeS$2$f2d_inp_cakef2d_inp_correctionS$2$f2d_inp_correctionf2d_inp_polarisationS$2$f2d_inp_polarisation_20_f2d_inp_polarisationf2d_inp_parametersS$2$f2d_inp_parametersS$2DD$f2d_inp_parametersfio_fread_stringfio_fread_l1arrayfio_fread_integerfio_fread_realfio_fread_rarrayfio_fread_iarrayfio_fread_carrayf2d_inp_ellipseS$2$f2d_inp_ellipse_39_f2d_inp_ellipse_40_f2d_inp_ellipsef2d_inp_projectionS$2$f2d_inp_projectionma_perintersect f2d_inpradiaS$2$f2d_inpradia_43_f2d_inpradia_48_f2d_inpradiaf2d_inputmodelS$2$f2d_inputmodelf2d_inputrowlinef2d_inq_integrateS$2$f2d_inq_integrateS$2DD$f2d_inq_integrate f2d_lorentzS$2$f2d_lorentz f2d_lsqcircleS$2$f2d_lsqcircle f2d_funcirclef2d_lsqellipseS$2$f2d_lsqellipsef2d_funellipse f2d_lsqmfitS$2$f2d_lsqmfitS$2DD$f2d_lsqmfit_77_f2d_lsqmfit_78_f2d_lsqmfit_79_f2d_lsqmfit_90_f2d_lsqmfit_95_f2d_lsqmfit_96_f2d_lsqmfit_97_f2d_lsqmfit_103_f2d_lsqmfit_104_f2d_lsqmfit f2d_funmfitma_werff2d_lsqpolarisationS$2$f2d_lsqpolarisation_33_f2d_lsqpolarisationf2d_funpolarisation f2d_maskarcS$2$f2d_maskarcS$2DD$f2d_maskarc ma_clockwise f2d_maskpeaksS$2$f2d_maskpeaksf2d_maskpolygonS$2$f2d_maskpolygon f2d_numbersS$2$f2d_numbers_34_f2d_numbers_35_f2d_numbers_55_f2d_numbers_74_f2d_numbersf2d_peaksearchS$2$f2d_peaksearch f2d_peakstrip f2d_peakxyS$2$f2d_peakxyS$2DD$f2d_peakxy f2d_peakrz f2d_pgauintS$2$f2d_pgauint f2d_pixelxyS$2$f2d_pixelxy_36_f2d_pixelxy_37_f2d_pixelxy_38_f2d_pixelxy_47_f2d_pixelxy_56_f2d_pixelxy_58_f2d_pixelxy_59_f2d_pixelxy_60_f2d_pixelxyf2d_polynomialS$2$f2d_polynomial_40_f2d_polynomial ma_polynomial f2d_polyfit f2d_positionS$2$f2d_position gs_inp_pcf2d_projectionS$2$f2d_projectionS$2DD$f2d_projection ma_projectionf2d_projectfitS$2$f2d_projectfitS$2DD$f2d_projectfitS$3$f2d_subprojectfitf2d_lsq1dsymmetryf2d_subprojectfit gs_continue f2d_rowlineS$2$f2d_rowline f2d_rtheta2S$2$f2d_rtheta2S$2DD$f2d_rtheta2_82_f2d_rtheta2_84_f2d_rtheta2 f2d_saturatedS$2$f2d_saturated_26_f2d_saturated ma_saturated f2d_slice S$2$f2d_slicema_slice f2d_sradialS$2$f2d_sradial_35_f2d_sradial_36_f2d_sradial_38_f2d_sradialf2d_corr2_radialf2d_tiltdisplayS$2$f2d_tiltdisplayf2d_tiltradialS$2$f2d_tiltradialS$2DD$f2d_tiltradial_66_f2d_tiltradial_68_f2d_tiltradial f2d_transformS$2$f2d_transformS$2DD$f2d_transform_38_f2d_transform_39_f2d_transformf2d_vignettingS$2$f2d_vignettingS$2DD$f2d_vignettingf2d_gridbeamcentref2d_corr_fastc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaS$2$f2d_corr_fastcf2d_1dmaskhelpf2d_1dmaskregionS$2$f2d_1dmaskregionf2d_colourshelpf2d_corr2_radialS$2$f2d_corr2_radialS$2DD$f2d_corr2_radial_91_f2d_corr2_radial_92_f2d_corr2_radial_93_f2d_corr2_radialf2d_editpeakshelp f2d_findlineS$2$f2d_findlinef2d_findllquadS$2$f2d_findllquadS$2DD$f2d_findllquad_46_f2d_findllquadf2d_findlrquadS$2$f2d_findlrquadS$2DD$f2d_findlrquad_46_f2d_findlrquadf2d_findulquadS$2$f2d_findulquadS$2DD$f2d_findulquad_46_f2d_findulquadf2d_findurquadS$2$f2d_findurquadS$2DD$f2d_findurquad_46_f2d_findurquad f2d_funcirclef2d_funellipseS$2$f2d_funellipse f2d_funmfitS$2$f2d_funmfitf2d_funpolarisationS$2$f2d_funpolarisationf2d_gridbeamcentreS$2$f2d_gridbeamcentref2d_gui_roihelpf2d_gui_scaledsubhelpf2d_inputrowlineS$2$f2d_inputrowlineS$2DD$f2d_inputrowline_47_f2d_inputrowline FTN_SIGN$f2d_lsq1dsymmetryS$2$f2d_lsq1dsymmetryS$2DD$f2d_lsq1dsymmetryf2d_fun1dsymmetryf2d_lsqcalibrantS$2$f2d_lsqcalibrant_35_f2d_lsqcalibrant_36_f2d_lsqcalibrantf2d_funcalibrantf2d_lsqgaussianS$2$f2d_lsqgaussian_38_f2d_lsqgaussianf2d_fungaussian f2d_lsqpowderS$2$f2d_lsqpowder_41_f2d_lsqpowder_42_f2d_lsqpowder f2d_funpowder f2d_peakrzS$2$f2d_peakrz f2d_peakstripS$2$f2d_peakstrip_95_f2d_peakstrip_96_f2d_peakstrip_120_f2d_peakstrip_121_f2d_peakstripf2d_peakintegrate f2d_polyfitS$2$f2d_polyfitS$3$f2d_polyfit2S$3DD$f2d_polyfit2 f2d_polyfit2f2d_ringcoordsS$2$f2d_ringcoordsS$2DD$f2d_ringcoordsf2d_ringoutliersS$2$f2d_ringoutliers_42_f2d_ringoutliersf2d_fun1dsymmetryS$2$f2d_fun1dsymmetryf2d_funcalibrantS$2$f2d_funcalibrantf2d_fungaussianS$2$f2d_fungaussian f2d_funpowderS$2$f2d_funpowder$$tanf2d_peakintegrateS$2$f2d_peakintegrate fio_fileopenS$2$fio_fileopen fio_fileopencfio_fread_integerS$2$fio_fread_integerfio_fread_searchitem FTN_S_RDUE FTN_E_RDUE io_hextoifio_fread_carrayS$2$fio_fread_carray_22_fio_fread_carray FTN_DO_L1IOAfio_fread_iarrayS$2$fio_fread_iarray_23_fio_fread_iarray FTN_DO_I4IOAfio_fread_l1arrayS$2$fio_fread_l1array_23_fio_fread_l1arrayio_unpack_integerfio_fread_rarrayS$2$fio_fread_rarray_23_fio_fread_rarrayfio_fread_realS$2$fio_fread_real io_hextorfio_fread_stringS$2$fio_fread_string fio_gui_inputS$2$fio_gui_input io_extensionio_lower FTN_F_INQU2 io_isdigit fio_is_bruker fio_is_klora io_fileexist fio_is_adsc fio_in_gas2d fio_in_iq fio_in_binary fio_in_adsc fio_in_bruker fio_in_bslfio_in_chiplot fio_in_fit2dfio_in_bas2000fio_in_hamamatsu fio_in_klora fio_in_marfio_in_photometricsfio_in_princeton fio_in_raxis fio_gui_outS$2$fio_gui_outfio_out_binary fio_out_bslfio_out_chiplot fio_out_mar fio_out_fit2d fio_out_gsasfio_out_powderciffio_out_spread fio_out_tifffio_gui_outputS$2$fio_gui_outputfio_in_1dasciiS$2$fio_in_1dasciifio_in_freeformatS$2$fio_in_freeformat_36_fio_in_freeformat_48_fio_in_freeformat_52_fio_in_freeformat_54_fio_in_freeformat_57_fio_in_freeformat_59_fio_in_freeformat io_read_file FTN_F_REWfio_inp_outputS$2$fio_inp_outputfio_inp_outhelp fio_input S$2$fio_inputfio_in_2dascii fio_in_cddfio_in_dip2000 fio_in_helpfio_in_huffman fio_in_pdsfio_in_unknown fio_in_user fio_in_wess fio_openfileS$2$fio_openfile fio_out_pdsS$2$fio_out_pds_26_fio_out_pds_28_fio_out_pds_30_fio_out_pds_34_fio_out_pds_41_fio_out_pds_57_fio_out_pds_59_fio_out_pds_61_fio_out_pds_63_fio_out_pds fio_outputS$2$fio_output fio_out_3cam fio_out_cdd fio_out_mcafio_out_huffman fio_out_klorafio_fileioc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaM$2 io_file_in io_file_outio_file_in_openio_file_out_open io_file_in_idio_file_out_idstrcpyfopenfclosefreadprintffio_filepreadcfseekfgetsfwritefio_filewrealcfio_fread_searchitemS$2$fio_fread_searchitem_22_fio_fread_searchitemfio_in_2dasciiS$2$fio_in_2dasciiS$2DD$fio_in_2dascii_53_fio_in_2dascii_58_fio_in_2dascii fio_in_adscS$2$fio_in_adsc_77_fio_in_adsc_78_fio_in_adscio_upper fio_inp_2di2fio_in_bas2000S$2$fio_in_bas2000_63_fio_in_bas2000_74_fio_in_bas2000io_noextensionfio_inp_2dbyte fio_in_bslS$2$fio_in_bsl_41_fio_in_bsl_59_fio_in_bsl_64_fio_in_bsl io_dirpath fio_inp_2dr4 fio_in_binaryS$2$fio_in_binary_56_fio_in_binaryfio_in_headerfilefio_gui_in_data fio_inp_2di4 fio_in_brukerS$2$fio_in_bruker_37_fio_in_brukerfio_in_headbrukerfio_in_overbruker fio_in_cddS$2$fio_in_cddS$2DD$fio_in_cdd_37_fio_in_cdd_38_fio_in_cdd_39_fio_in_cddfio_in_chiplotS$2$fio_in_chiplot_40_fio_in_chiplotfio_in_dip2000S$2$fio_in_dip2000S$2DD$fio_in_dip2000 FTN_DO_I2IOA fio_in_fit2dS$2$fio_in_fit2dS$2DD$fio_in_fit2d fio_in_gas2dS$2$fio_in_gas2dS$2DD$fio_in_gas2d_39_fio_in_gas2d_55_fio_in_gas2d_57_fio_in_gas2d_59_fio_in_gas2d_61_fio_in_gas2d_63_fio_in_gas2d_65_fio_in_gas2d_66_fio_in_gas2d_81_fio_in_gas2d io_filesize io_inp_2di2 fio_in_gas4fio_in_hamamatsuS$2$fio_in_hamamatsu_49_fio_in_hamamatsu_50_fio_in_hamamatsu_51_fio_in_hamamatsu_52_fio_in_hamamatsu fio_in_helpfio_in_huffmanS$2$fio_in_huffman_35_fio_in_huffman_36_fio_in_huffman_37_fio_in_huffman fio_in_2di2cfio_in_subhuff fio_in_iq S$2$fio_in_iqS$2DD$fio_in_iq _41_fio_in_iqfio_tiff_imagesizefio_in_iqrimage fio_in_kloraS$2$fio_in_klora_89_fio_in_klora_90_fio_in_klora_94_fio_in_klora_95_fio_in_klora fio_in_marS$2$fio_in_mar fio_in_mar345 fio_in_oldmar fio_in_pdsS$2$fio_in_pds_33_fio_in_pds_42_fio_in_pdsfio_in_photometricsS$2$fio_in_photometrics_39_fio_in_photometrics_43_fio_in_photometricsfio_in_princetonS$2$fio_in_princetonS$2DD$fio_in_princeton_45_fio_in_princeton_49_fio_in_princeton fio_in_raxisS$2$fio_in_raxisfio_in_raxisheadercfio_in_unknownS$2$fio_in_unknownS$2DD$fio_in_unknown_33_fio_in_unknown_87_fio_in_unknown_93_fio_in_unknown_94_fio_in_unknown_95_fio_in_unknown_96_fio_in_unknown_97_fio_in_unknown_98_fio_in_unknown_99_fio_in_unknown_100_fio_in_unknown_103_fio_in_unknown_156_fio_in_unknown_158_fio_in_unknown_160_fio_in_unknownma_expntma_ffa8ma_ffs8 io_inp_2dbyte io_inp_2di4$$logf fio_in_userS$2$fio_in_user fio_in_wessS$2$fio_in_wessS$2DD$fio_in_wessfio_inp_outhelp fio_is_adscS$2$fio_is_adsc fio_is_brukerS$2$fio_is_brukerfio_in_keybruker fio_is_kloraS$2$fio_is_klora fio_out_3camS$2$fio_out_3cam_33_fio_out_3cam_34_fio_out_3cam_37_fio_out_3cam_43_fio_out_3cam_49_fio_out_3camfio_out_binaryS$2$fio_out_binaryS$2DD$fio_out_binary_26_fio_out_binary_28_fio_out_binary_29_fio_out_binary io_rminmaxio_uwrite_rarrayfio_out_headerfile fio_out_bslS$2$fio_out_bslS$2DD$fio_out_bsl_33_fio_out_bsl_35_fio_out_bsl_39_fio_out_bsl_41_fio_out_bsl_43_fio_out_bsl FTN_S_WDUE FTN_E_WDUE fio_out_cddS$2$fio_out_cddS$2DD$fio_out_cdd_27_fio_out_cdd_94_fio_out_cddfio_out_chiplotS$2$fio_out_chiplot_43_fio_out_chiplot_47_fio_out_chiplot_50_fio_out_chiplot_52_fio_out_chiplot_57_fio_out_chiplot_60_fio_out_chiplot_68_fio_out_chiplot_71_fio_out_chiplot_80_fio_out_chiplot_83_fio_out_chiplot fio_inp_1dout fio_out_marS$2$fio_out_marS$2DD$fio_out_mar_25_fio_out_mar_27_fio_out_mar_28_fio_out_mar fio_out_fit2dS$2$fio_out_fit2dS$2DD$fio_out_fit2d fio_out_gsasS$2$fio_out_gsasS$2DD$fio_out_gsas_45_fio_out_gsas_48_fio_out_gsas_55_fio_out_gsas_65_fio_out_gsas_73_fio_out_gsasfio_out_huffmanS$2$fio_out_huffman_41_fio_out_huffman_44_fio_out_huffman_45_fio_out_huffman_46_fio_out_huffman_47_fio_out_huffmanfio_subouthuff fio_out_2di2c fio_out_kloraS$2$fio_out_klorafio_open_kloraheaderfio_add_klorastringfio_add_kloraintegerfio_close_kloraheader fio_out_2dr4 fio_out_mcaS$2$fio_out_mca_25_fio_out_mca_26_fio_out_mca_27_fio_out_mcafio_out_powdercifS$2$fio_out_powdercif_43_fio_out_powdercif_45_fio_out_powdercif_46_fio_out_powdercif_47_fio_out_powdercif_48_fio_out_powdercif_49_fio_out_powdercif_51_fio_out_powdercif_53_fio_out_powdercif_54_fio_out_powdercif_55_fio_out_powdercif_56_fio_out_powdercif_59_fio_out_powdercif_60_fio_out_powdercif_61_fio_out_powdercif_62_fio_out_powdercif_63_fio_out_powdercif_64_fio_out_powdercif_65_fio_out_powdercif_72_fio_out_powdercif_80_fio_out_powdercif_82_fio_out_powdercif_83_fio_out_powdercif_84_fio_out_powdercif io_basenamefio_out_spreadS$2$fio_out_spread_24_fio_out_spread_34_fio_out_spread fio_out_tiffS$2$fio_out_tiffS$2DD$fio_out_tiffS$7$fio_out_tiffshortS$8$fio_out_tifflongS$9$fio_out_tiffratS$10$fio_out_tiffchar_39_fio_out_tiff_40_fio_out_tifffio_out_tifflongfio_out_tiffshortfio_out_tiffcharfio_out_tiffratfio_add_kloraintegerS$2$fio_add_kloraintegerfio_add_klorastringcfio_add_klorastringS$2$fio_add_klorastringfio_gui_in_dataS$2$fio_gui_in_data fio_in_gas4S$2$fio_in_gas4_40_fio_in_gas4fio_in_headbrukerS$2$fio_in_headbrukerfio_in_headerfileS$2$fio_in_headerfilefio_in_keybrukerS$2$fio_in_keybruker fio_in_mar345S$2$fio_in_mar345S$2DD$fio_in_mar345_37_fio_in_mar345_38_fio_in_mar345_39_fio_in_mar345_40_fio_in_mar345 fio_in_pckc fio_in_oldmarS$2$fio_in_oldmarS$2DD$fio_in_oldmar_32_fio_in_oldmar_33_fio_in_oldmar_34_fio_in_oldmar_35_fio_in_oldmarfio_in_overbrukerS$2$fio_in_overbrukerS$2DD$fio_in_overbrukerfio_in_iqrimageS$2$fio_in_iqrimageS$2DD$fio_in_iqrimage_33_fio_in_iqrimage_51_fio_in_iqrimagefio_tread_bytesfio_tiff_integerfio_tiff_intentry fio_tiff_ints fio_inp_1doutS$2$fio_inp_1doutfio_inp_2dbyteS$2$fio_inp_2dbyte fio_inp_2di2S$2$fio_inp_2di2 fio_inp_2di4S$2$fio_inp_2di4 fio_inp_2dr4S$2$fio_inp_2dr4 fio_out_2dr4S$2$fio_out_2dr4fio_out_headerfileS$2$fio_out_headerfile_23_fio_out_headerfile_24_fio_out_headerfile_27_fio_out_headerfile_29_fio_out_headerfile_31_fio_out_headerfile_32_fio_out_headerfile_33_fio_out_headerfile_34_fio_out_headerfile_35_fio_out_headerfile_36_fio_out_headerfile_37_fio_out_headerfile_38_fio_out_headerfile_39_fio_out_headerfile_40_fio_out_headerfile_41_fio_out_headerfile_43_fio_out_headerfilefio_tiff_imagesizeS$2$fio_tiff_imagesize_24_fio_tiff_imagesize_32_fio_tiff_imagesizefio_in_2di2c ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaS$9DD$fio_in_2di2c byte_valueBUFFER bit_position byte_positionmallocfio_in_raxisheaderc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aa temp_bytetempFio_int_byte_swapFio_float_byte_swapfio_out_2di2c ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaS$11DD$fio_out_2di2c io_code_value io_code_int2 io_code_int4fio_out_klorac ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aapositionfio_tiff_integer $0000000Efio_tiff_intentryS$2$fio_tiff_intentry_17_fio_tiff_intentry fio_tiff_intsS$2$fio_tiff_intsfio_tread_bytesS$2$fio_tread_bytesfio_in_pckc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaC$11$fio_in_pckcS$11$fio_in_pckc__filbufsscanf gs_2dcontourS$2$gs_2dcontourS$2DD$gs_2dcontour gs_axisframegs_2dcontlinesgs_gridgs_title gs_xlabel gs_ylabelgs_atext gs_arrows gs_alabels gs_2dimageS$2$gs_2dimage gs_2dmimageS$2$gs_2dmimageS$2DD$gs_2dmimagegs_2dmcellarray gs_lutscale gs_3dlinesS$2$gs_3dlinesma_rmin ma_difzscalegs_inq_axesstylegs_set_axesstyle gs_3dyaxisgs_3dhidelines gs_3dsurfaceS$2$gs_3dsurfaceS$2DD$gs_3dsurface gs_inq_3dview gs_3surfacegs_inq_titlestylelg_inq_scaling lg_inq_maxpc gs_arcellipseS$2$gs_arcellipseS$2DD$gs_arcellipse lg_fillareags_arrow S$2$gs_arrow gs_backgroundS$2$gs_backgroundgs_cal_coloursS$2$gs_cal_colours gs_db_colours lg_bestcolourgs_cal_wctopixS$2$gs_cal_wctopix gs_cal_zrangeS$2$gs_cal_zrangema_rebinminmax ma_rebinmax ma_rebinmings_close_graphicsS$2$gs_close_graphics lg_close_wklg_close gs_close_psS$2$gs_close_ps gs_inq_psfile FTN_F_BACK io_write_file gs_set_psfile gs_coloursS$2$gs_coloursgs_cal_colourtable lg_colours gs_continueS$2$gs_continue lg_inp_eventgs_draw_characterS$2$gs_draw_charactergs_inq_char_scalinggs_fileselectionS$2$gs_fileselectionS$27$gs_subfilegs_db_fileselection_27_gs_fileselection_30_gs_fileselection_190_gs_fileselection_192_gs_fileselection_194_gs_fileselection_196_gs_fileselection_198_gs_fileselectionio_system_name io_getcwd io_listfiles io_directoryio_up_directory io_filesordergs_draw_selectiongs_cal_menuchoice gs_draw_list io_changedir io_filesmatch gs_subfilegs_stringbuttongs_helpfileselect gs_fillstyleS$2$gs_fillstyle lg_fillcolourgs_fmenu S$2$gs_fmenugs_form S$2$gs_formgs_db_fcchoicesgs_db_fichoices gs_db_formgs_give_colourname gs_draw_form gs_helpform gs_gui_colourgs_inp_datatypegs_inp_scantypegs_inp_formmenu gs_spromptgs_set_guiregion gs_fpromptS$2$gs_fprompt gs_fwarningS$2$gs_fwarninggs_inp_2dregionS$2$gs_inp_2dregiongs_inp_acoloursS$2$gs_inp_acoloursgs_mset_coloursgs_inp_alabelsS$2$gs_inp_alabelsgs_inq_maxcurves gs_inq_alabel gs_set_alabel gs_inq_arrow gs_set_arrowgs_inp_alabelstylesS$2$gs_inp_alabelstylesS$2DD$gs_inp_alabelstylesgs_inq_alabelstylegs_set_alabelstylegs_inp_arrowstylesS$2$gs_inp_arrowstylesS$2DD$gs_inp_arrowstylesgs_inq_arrowstylegs_set_arrowstylegs_inp_axesstylesS$2$gs_inp_axesstylesgs_inq_haxesstylegs_set_haxesstylegs_inp_backgroundS$2$gs_inp_background gs_inp_choiceS$2$gs_inp_choiceS$2DD$gs_inp_choice lg_set_update gs_inp_colourS$2$gs_inp_colourgs_give_colourgs_inp_coordinatesS$2$gs_inp_coordinates_33_gs_inp_coordinates_48_gs_inp_coordinates_59_gs_inp_coordinates_64_gs_inp_coordinates_65_gs_inp_coordinates_71_gs_inp_coordinateslg_inp_coordinategs_inp_curvestylesS$2$gs_inp_curvestylesgs_inq_curveline $$fill_24gs_set_curvelinegs_inq_curvesoftmarkers $$lr_wa_30 $$fill_23gs_set_curvesoftmarkersgs_inq_curveerrorsgs_set_curveerrorsgs_inp_enumerationstyleS$2$gs_inp_enumerationstylegs_inq_xaxisenumgs_set_xaxisenumgs_inq_yaxisenumgs_set_yaxisenum gs_inp_fontS$2$gs_inp_font gs_mset_font gs_inp_gppS$2$gs_inp_gpp gs_inp_gridS$2$gs_inp_gridgs_inp_gridstyleS$2$gs_inp_gridstylegs_inq_hcoarsegridgs_set_hcoarsegridgs_inq_vcoarsegridgs_set_vcoarsegridgs_inq_hfinegridgs_set_hfinegridgs_inq_vfinegridgs_set_vfinegrid gs_inp_layoutS$2$gs_inp_layoutgs_inq_graphlayoutgs_set_graphlayout gs_inp_lticksS$2$gs_inp_lticksgs_inq_xlticks gs_cal_ticksgs_set_xlticksgs_inq_ylticksgs_set_ylticks gs_inp_lutS$2$gs_inp_lutgs_inp_menuchoiceS$2$gs_inp_menuchoice_49_gs_inp_menuchoice_51_gs_inp_menuchoice gs_inp_pc S$2$gs_inp_pc _31_gs_inp_pc _32_gs_inp_pc _34_gs_inp_pcgs_inp_titlestyleS$2$gs_inp_titlestylegs_set_titlestyle gs_inp_unzoomS$2$gs_inp_unzoomgs_inp_xlabelstyleS$2$gs_inp_xlabelstylegs_inq_xlabelstylegs_set_xlabelstylegs_inp_xyregionS$2$gs_inp_xyregiongs_inp_ylabelstyleS$2$gs_inp_ylabelstylegs_inq_ylabelstylegs_inq_ylabelorientationgs_set_ylabelorientationgs_set_ylabelstylegs_inpc S$2$gs_inpcgs_inpi S$2$gs_inpi _23_gs_inpi _25_gs_inpiio_startgs_inpl S$2$gs_inplgs_inpr S$2$gs_inpr _23_gs_inpr _25_gs_inprgs_inps S$2$gs_inps S$2DD$gs_inps _54_gs_inps _55_gs_inps _57_gs_inps _60_gs_inps _61_gs_inps _64_gs_inps _66_gs_inpsgs_inq_menulayout io_translategs_inps_coordinatesS$2$gs_inps_coordinatesS$2DD$gs_inps_coordinates_47_gs_inps_coordinates_88_gs_inps_coordinates_104_gs_inps_coordinates_106_gs_inps_coordinates_111_gs_inps_coordinates_112_gs_inps_coordinates_114_gs_inps_coordinates_115_gs_inps_coordinates_117_gs_inps_coordinates_123_gs_inps_coordinates gs_spyglassgs_inp_twoclickgs_inps_fcoordinatesS$2$gs_inps_fcoordinates gs_inq_3daxesS$2$gs_inq_3daxes gs_db_3daxesgs_inq_3dsimageS$2$gs_inq_3dsimage gs_db_3dstyle gs_db_3dviewgs_inq_3dstyleS$2$gs_inq_3dstylegs_inq_autoddrS$2$gs_inq_autoddr gs_dataloglin gs_autoddrgs_inq_axesloglinS$2$gs_inq_axesloglin gs_vaxesstyle gs_haxesstyle gs_axesstyle gs_axesloglin gs_yaxisenum gs_xaxisenumgs_inq_backgroundS$2$gs_inq_backgroundgs_background_colourgs_background_fillgs_windowformatgs_inq_curvemarkersS$2$gs_inq_curvemarkersgs_curveerrors gs_curvelinesgs_curvesoftmarkersgs_curvemarkersgs_curvesstyles gs_errorbarsgs_inq_curvestyleS$2$gs_inq_curvestylegs_inq_dataloglinS$2$gs_inq_dataloglin gs_inq_dddrS$2$gs_inq_dddrgs_dddr gs_inq_ddrS$2$gs_inq_ddrgs_ddr gs_inq_dgppS$2$gs_inq_dgppgs_gpp gs_inq_dlutpcS$2$gs_inq_dlutpc gs_dlutpcgs_inq_errorbarsS$2$gs_inq_errorbars gs_inq_gppS$2$gs_inq_gpp gs_inq_gridS$2$gs_inq_grid gs_vfinegrid gs_hfinegridgs_vcoarsegridgs_hcoarsegrid gs_gridstylegs_inq_guiregionS$2$gs_inq_guiregiongs_inputregiongs_inq_iaspectS$2$gs_inq_iaspectgs_idrgs_inq_imagescaleS$2$gs_inq_imagescalegs_com_maskpixels gs_com_lutgs_com_pixellimitsgs_inq_maskcolourS$2$gs_inq_maskcolourgs_inq_messageS$2$gs_inq_messagegs_messagestylegs_messageposition gs_inq_lutS$2$gs_inq_lutgs_inq_lutchoiceS$2$gs_inq_lutchoicegs_inq_pixellimitsS$2$gs_inq_pixellimitsgs_inq_postscriptS$2$gs_inq_postscript gs_postscript gs_psfilegs_inq_vaxesstyleS$2$gs_inq_vaxesstylegs_inq_windowformatS$2$gs_inq_windowformatgs_int_xyegraphS$2$gs_int_xyegraphgs_set_axesloglings_line S$2$gs_line gs_linestyleS$2$gs_linestyle lg_linestyle lg_linewidth lg_linecolourgs_mark S$2$gs_mark gs_markersS$2$gs_markers gs_ellipsegs_kitegs_markerstyleS$2$gs_markerstyle lg_markertypelg_markerscalelg_markercolourgs_menu S$2$gs_menu S$2DD$gs_menugs_inq_menustyle gs_messageS$2$gs_message_24_gs_message_29_gs_message_30_gs_message_59_gs_message_63_gs_messagegs_draw_messagegs_inp_scrollbargs_mplot S$2$gs_mplot gs_mplotsubgs_mset_publicationS$2$gs_mset_publication gs_keystyle gs_key_output gs_key_textgs_arrowstylesgs_arrowcoordinates gs_off_printS$2$gs_off_print lg_updatelg_deactivate_wklg_activate_wk gs_on_printS$2$gs_on_print gs_open_psgs_open_graphicsS$2$gs_open_graphicsgs_open_notermlg_set_colourindices lg_open_wkgs_def_lutchoicegs_def_colourslg_inq_textwidthgs_plot S$2$gs_plot gs_plotsub gs_ppromptS$2$gs_pprompt gs_prompt S$2$gs_promptS$2DD$gs_prompt gs_button gs_rectangleS$2$gs_rectangle gs_rellipseS$2$gs_rellipseS$2DD$gs_rellipse gs_set_3daxesS$2$gs_set_3daxesgs_set_3dsimageS$2$gs_set_3dsimagegs_set_3dstyleS$2$gs_set_3dstyle gs_set_3dviewS$2$gs_set_3dviewgs_set_autoddrS$2$gs_set_autoddrgs_set_backgroundS$2$gs_set_backgroundgs_set_char_scalingS$2$gs_set_char_scalinggs_character_scalingdbgs_set_curvemarkersS$2$gs_set_curvemarkersgs_set_curvestyleS$2$gs_set_curvestylegs_set_dataloglinS$2$gs_set_dataloglin gs_set_dddrS$2$gs_set_dddr gs_set_ddrS$2$gs_set_ddr gs_set_dgppS$2$gs_set_dgppgs_set_errorbarsS$2$gs_set_errorbars gs_set_gppS$2$gs_set_gpp gs_set_gridS$2$gs_set_gridgs_set_iaspectS$2$gs_set_iaspect gs_set_idrS$2$gs_set_idr_18_gs_set_idr_19_gs_set_idr_20_gs_set_idr_21_gs_set_idr_22_gs_set_idr_25_gs_set_idr_26_gs_set_idr_27_gs_set_idr_28_gs_set_idr_29_gs_set_idrgs_set_imagescaleS$2$gs_set_imagescalegs_set_maskcolourS$2$gs_set_maskcolourgs_set_menulayoutS$2$gs_set_menulayoutgs_set_messageS$2$gs_set_message gs_set_lutS$2$gs_set_lutgs_set_lutchoiceS$2$gs_set_lutchoicegs_set_pixellimitsS$2$gs_set_pixellimitslg_set_resolutiongs_set_postscriptS$2$gs_set_postscriptgs_set_vaxesstyleS$2$gs_set_vaxesstylegs_text S$2$gs_text lg_textheightlg_textalignment gs_textstyleS$2$gs_textstyle_18_gs_textstyle lg_textcolour lg_textangle gs_triangleS$2$gs_triangle gs_update S$2$gs_update gs_warningS$2$gs_warning_26_gs_warning_27_gs_warning_32_gs_warning_33_gs_warning_34_gs_warninggs_draw_warning gs_xyclickS$2$gs_xyclick gs_xycurvesS$2$gs_xycurvesS$2DD$gs_xycurves gs_xycurve gs_xyegraphS$2$gs_xyegraphS$3$gs_subxyegraphgs_subxyegraph gs_cal_ddrgs_set_framestylegs_key gs_xygraphS$2$gs_xygraph gs_xysgraphS$2$gs_xysgraphgs_2dcontlinesS$2$gs_2dcontlinesS$2DD$gs_2dcontlinesgs_2dmcellarrayS$2$gs_2dmcellarray gs_inq_idrlg_rmaskcellarraygs_3dhidelinesS$2$gs_3dhidelinesma_pointvector ma_intersect gs_3dyaxisS$2$gs_3dyaxisS$2DD$gs_3dyaxisma_dmultipliergs_cal_enumfieldio_vtoc gs_3surfaceS$2$gs_3surfaceS$2DD$gs_3surface S$3$gs_3dsubS$3DD$gs_3dsublg_set_rastermode gs_3fillareags_3drmcellarraygs_3linegs_3dsub gs_3linaxislg_db_textattslg_db_prastermodelg_db_brastermodelg_db_rastermodelg_db_resolution lg_db_colourslg_db_transform lg_db_openwk lg_db_system gs_3polyline gs_3dsub1 gs_alabelsS$2$gs_alabels gs_arrows S$2$gs_arrowsgs_atext S$2$gs_atext gs_inq_atextgs_inq_atextstyle gs_axisframeS$2$gs_axisframegs_inq_framestyle gs_linaxis gs_alogaxis gs_button S$2$gs_buttongs_cal_colourtableS$2$gs_cal_colourtable gs_cal_ddrS$2$gs_cal_ddrgs_cal_menuchoiceS$2$gs_cal_menuchoice gs_cal_ticksS$2$gs_cal_ticksgs_def_coloursS$2$gs_def_coloursgs_def_lutchoiceS$2$gs_def_lutchoicegs_draw_selectionS$2$gs_draw_selectionS$2DD$gs_draw_selectionS$6$gs_draw_slistS$9$gs_draw_list gs_draw_slist gs_scrollbar gs_draw_formS$2$gs_draw_formgs_draw_messageS$2$gs_draw_messageS$2DD$gs_draw_messagegs_inq_messagestylegs_draw_warningS$2$gs_draw_warningS$2DD$gs_draw_warning gs_ellipseS$2$gs_ellipseS$2DD$gs_ellipsegs_give_colourS$2$gs_give_colourgs_give_colournameS$2$gs_give_colournamegs_grid S$2$gs_grid gs_lingrid gs_aloggrid gs_gui_colourS$2$gs_gui_colourgs_helpfileselect gs_helpformgs_inp_datatypeS$2$gs_inp_datatypegs_inp_formmenuS$2$gs_inp_formmenugs_inp_scantypeS$2$gs_inp_scantypegs_inp_scrollbarS$2$gs_inp_scrollbargs_drawn_scrollbargs_cal_scrollbargs_inp_twoclickS$2$gs_inp_twoclickS$2DD$gs_inp_twoclickgs_2dcellarray gs_inq_3dviewS$2$gs_inq_3dview gs_inq_alabelS$2$gs_inq_alabelgs_com_alabelstylesgs_com_alabels gs_alabelscgs_inq_alabelstyleS$2$gs_inq_alabelstyle gs_inq_arrowS$2$gs_inq_arrowgs_inq_arrowstyleS$2$gs_inq_arrowstylegs_inq_axesstyleS$2$gs_inq_axesstylegs_inq_char_scalingS$2$gs_inq_char_scalinggs_inq_curveerrorsS$2$gs_inq_curveerrorsgs_inq_curvelineS$2$gs_inq_curvelinegs_inq_curvesoftmarkersS$2$gs_inq_curvesoftmarkersgs_inq_graphlayoutS$2$gs_inq_graphlayoutgs_graphlayoutgs_inq_haxesstyleS$2$gs_inq_haxesstylegs_inq_hcoarsegridS$2$gs_inq_hcoarsegridgs_inq_hfinegridS$2$gs_inq_hfinegridgs_inq_maxcurvesS$2$gs_inq_maxcurvesgs_inq_menulayoutS$2$gs_inq_menulayoutgs_inq_menustyleS$2$gs_inq_menustyle gs_inq_psfileS$2$gs_inq_psfilegs_inq_titlestyleS$2$gs_inq_titlestylegs_ylabelstylegs_ylabelorientationgs_xlabelstyle gs_titlestyle gs_ptextstylegs_inq_vcoarsegridS$2$gs_inq_vcoarsegridgs_inq_vfinegridS$2$gs_inq_vfinegridgs_inq_xaxisenumS$2$gs_inq_xaxisenumgs_inq_xlabelstyleS$2$gs_inq_xlabelstylegs_inq_xlticksS$2$gs_inq_xlticks gs_ylticks gs_xlticksgs_inq_yaxisenumS$2$gs_inq_yaxisenumgs_inq_ylabelorientationS$2$gs_inq_ylabelorientationgs_inq_ylabelstyleS$2$gs_inq_ylabelstylegs_inq_ylticksS$2$gs_inq_ylticksgs_key S$2$gs_key S$2DD$gs_key gs_inq_keygs_inq_keystylegs_inq_keylabelgs_kite S$2$gs_kite gs_lutscaleS$2$gs_lutscale_18_gs_lutscale lg_cellarray gs_set_dlutpcgs_mset_coloursS$2$gs_mset_colours gs_atextc gs_atext_num gs_atextstyle gs_mset_fontS$2$gs_mset_fontgs_open_notermS$2$gs_open_notermgs_def_graphicsgs_mset_optionslg_open gs_open_psS$2$gs_open_ps_24_gs_open_ps gs_set_alabelS$2$gs_set_alabelgs_set_alabelstyleS$2$gs_set_alabelstyle gs_set_arrowS$2$gs_set_arrowgs_set_arrowstyleS$2$gs_set_arrowstylegs_set_axesloglinS$2$gs_set_axesloglings_set_axesstyleS$2$gs_set_axesstylegs_set_curveerrorsS$2$gs_set_curveerrorsgs_set_curvelineS$2$gs_set_curvelinegs_set_curvesoftmarkersS$2$gs_set_curvesoftmarkersgs_set_framestyleS$2$gs_set_framestyle gs_dat_framegs_set_graphlayoutS$2$gs_set_graphlayoutgs_set_guiregionS$2$gs_set_guiregiongs_set_haxesstyleS$2$gs_set_haxesstylegs_set_hcoarsegridS$2$gs_set_hcoarsegridgs_set_hfinegridS$2$gs_set_hfinegrid gs_set_psfileS$2$gs_set_psfilegs_set_titlestyleS$2$gs_set_titlestylegs_set_vcoarsegridS$2$gs_set_vcoarsegridgs_set_vfinegridS$2$gs_set_vfinegridgs_set_xaxisenumS$2$gs_set_xaxisenumgs_set_xlabelstyleS$2$gs_set_xlabelstylegs_set_xlticksS$2$gs_set_xlticksgs_set_yaxisenumS$2$gs_set_yaxisenumgs_set_ylabelorientationS$2$gs_set_ylabelorientationgs_set_ylabelstyleS$2$gs_set_ylabelstylegs_set_ylticksS$2$gs_set_ylticks gs_spromptS$2$gs_sprompt gs_spyglassS$2$gs_spyglass lg_spyglassgs_stringbuttonS$2$gs_stringbuttonS$2DD$gs_stringbuttongs_title S$2$gs_titleS$2DD$gs_title _19_gs_title gs_xlabel S$2$gs_xlabelS$2DD$gs_xlabel _19_gs_xlabel gs_xycurveS$2$gs_xycurve gs_csline gs_pmlinegs_xyerrorbars gs_ylabel S$2$gs_ylabelS$2DD$gs_ylabel _19_gs_ylabelgs_2dcellarrayS$2$gs_2dcellarrayS$2DD$gs_2dcellarraylg_realcellarraygs_3drmcellarrayS$2$gs_3drmcellarray lg_3dmimage gs_3linaxisS$2$gs_3linaxis gs_3linticks gs_3linaxenumgs_3line S$2$gs_3line gs_3fillareaS$2$gs_3fillarea gs_3polylineS$2$gs_3polyline gs_alogaxisS$2$gs_alogaxis gs_alogticks gs_alogaxenum gs_aloggridS$2$gs_aloggridgs_cal_enumfieldS$2$gs_cal_enumfieldgs_cal_scrollbarS$2$gs_cal_scrollbar gs_csline S$2$gs_csline ma_differma_grad gs_splinegs_def_graphicsS$2$gs_def_graphicsgs_def_attributesgs_def_windowformatgs_def_guiregiongs_def_messagegs_def_messagestylegs_def_menustylegs_def_menulayout gs_def_psfilegs_def_postscriptgs_def_imagescalegs_def_pixellimitsgs_def_maskcolour gs_def_3dviewgs_set_progress gs_inq_atextS$2$gs_inq_atextgs_inq_atextstyleS$2$gs_inq_atextstylegs_inq_framestyleS$2$gs_inq_framestyle gs_inq_idrS$2$gs_inq_idr gs_inq_keyS$2$gs_inq_keygs_inq_keylabelS$2$gs_inq_keylabelgs_inq_keystyleS$2$gs_inq_keystylegs_inq_messagestyleS$2$gs_inq_messagestyle gs_linaxisS$2$gs_linaxis gs_linticks gs_linaxenum gs_lingridS$2$gs_lingridgs_mset_optionsS$2$gs_mset_optionsgs_mset_landscape gs_pmline S$2$gs_pmline gs_scrollbarS$2$gs_scrollbarS$2DD$gs_scrollbar gs_set_dlutpcS$2$gs_set_dlutpcgs_xyerrorbarsS$2$gs_xyerrorbars gs_3linaxenumS$2$gs_3linaxenumgs_3text gs_3linticksS$2$gs_3linticks gs_alogaxenumS$2$gs_alogaxenum gs_expont gs_alogticksS$2$gs_alogticks gs_def_3dviewS$2$gs_def_3dviewgs_def_attributesS$2$gs_def_attributesgs_set_atextstyle gs_def_atextgs_def_keylabels gs_set_keygs_set_keystylegs_def_alabelsgs_def_alabelstyles gs_def_arrowsgs_def_arrowstyles gs_def_gppgs_def_curvestylesgs_def_curvemarkersgs_def_curvesoftmarkersgs_def_curvelinesgs_def_curveerrorsgs_def_guiregionS$2$gs_def_guiregiongs_def_imagescaleS$2$gs_def_imagescalegs_def_maskcolourS$2$gs_def_maskcolourgs_def_menulayoutS$2$gs_def_menulayoutgs_def_menustyleS$2$gs_def_menustylegs_def_messageS$2$gs_def_messagegs_def_messagestyleS$2$gs_def_messagestylegs_def_pixellimitsS$2$gs_def_pixellimitsgs_def_postscriptS$2$gs_def_postscript gs_def_psfileS$2$gs_def_psfilegs_def_windowformatS$2$gs_def_windowformat gs_linaxenumS$2$gs_linaxenum_23_gs_linaxenum gs_linticksS$2$gs_linticksgs_mset_landscapeS$2$gs_mset_landscapegs_set_windowformat gs_progressS$2$gs_progressS$2DD$gs_progressS$6$gs_set_progressS$8$gs_inq_progress gs_progress_21_gs_progressgs_inq_progressgs_db_progress gs_spline S$2$gs_spline ma_cubsplinema_cubicgs_3text S$2$gs_3textgs_def_alabelsS$2$gs_def_alabelsgs_def_alabelstylesS$2$gs_def_alabelstyles gs_def_arrowsS$2$gs_def_arrowsgs_def_arrowstylesS$2$gs_def_arrowstyles gs_def_atextS$2$gs_def_atextgs_def_curveerrorsS$2$gs_def_curveerrorsS$2DD$gs_def_curveerrorsgs_def_curvelinesS$2$gs_def_curvelinesgs_def_curvemarkersS$2$gs_def_curvemarkersS$2DD$gs_def_curvemarkersgs_def_curvesoftmarkersS$2$gs_def_curvesoftmarkersgs_def_curvestylesS$2$gs_def_curvestyles gs_def_gppS$2$gs_def_gppgs_def_keylabelsS$2$gs_def_keylabels_22_gs_def_keylabels gs_expont S$2$gs_expontgs_set_atextstyleS$2$gs_set_atextstyle gs_set_keyS$2$gs_set_keygs_set_keystyleS$2$gs_set_keystylegs_set_windowformatS$2$gs_set_windowformat lg_3dmimageS$2$lg_3dmimagelg_ras_3dmimagelg_activate_wkS$2$lg_activate_wk lg_bestcolourS$2$lg_bestcolour lg_cellarrayS$2$lg_cellarray lg_x11_calg_ps_calg_clear S$2$lg_clear lg_x11_clear lg_ps_clearlg_clip S$2$lg_clip lg_x11_clip lg_ps_clip lg_clipwindowS$2$lg_clipwindowlg_close S$2$lg_close lg_close_wkS$2$lg_close_wk lg_x11_close lg_coloursS$2$lg_colourslg_x11_colourmap lg_datawindowS$2$lg_datawindow_19_lg_datawindow_20_lg_datawindowlg_x11_transformlg_ps_transformlg_deactivate_wkS$2$lg_deactivate_wk lg_fillareaS$2$lg_fillarea lg_ras_fa lg_x11_falg_ps_fa lg_fillcolourS$2$lg_fillcolour_19_lg_fillcolourlg_x11_fillcolourlg_ps_fillcolourlg_inp_coordinateS$2$lg_inp_coordinatelg_x11_coordinate lg_inp_eventS$2$lg_inp_event lg_x11_event lg_inp_resizeS$2$lg_inp_resizelg_inq_colourmappingS$2$lg_inq_colourmappinglg_x11_inq_colourmappinglg_inq_imagerangeS$2$lg_inq_imagerangelg_inq_logzscalingS$2$lg_inq_logzscaling lg_inq_maxpcS$2$lg_inq_maxpclg_inq_scalingS$2$lg_inq_scaling_22_lg_inq_scaling_23_lg_inq_scaling_24_lg_inq_scaling_27_lg_inq_scaling_28_lg_inq_scaling_29_lg_inq_scalinglg_inq_textfontS$2$lg_inq_textfontlg_inq_textwidthS$2$lg_inq_textwidthlg_x11_textwidth lg_linecolourS$2$lg_linecolourlg_x11_linecolourlg_ps_linecolour lg_linestyleS$2$lg_linestylelg_x11_linestylelg_ps_linestyle lg_linewidthS$2$lg_linewidthlg_x11_linewidthlg_ps_linewidthlg_markercolourS$2$lg_markercolourlg_x11_markercolourlg_ps_markercolourlg_markerscaleS$2$lg_markerscalelg_x11_markerscalelg_ps_markerscale lg_markertypeS$2$lg_markertypelg_x11_markertypelg_ps_markertypelg_markerwidthS$2$lg_markerwidthlg_x11_markerwidthlg_ps_markerwidthlg_open S$2$lg_openlg_def_colours lg_open_wkS$2$lg_open_wk lg_x11_openlg_x11_colourrange lg_ps_open lg_polylineS$2$lg_polyline lg_ras_pl lg_x11_pllg_ps_pl lg_polymarkerS$2$lg_polymarker lg_x11_pmlg_ps_pmlg_pc2wc S$2$lg_pc2wclg_ras_triangleS$2$lg_ras_triangleS$14$lg_ras_trixlimitslg_ras_trianglelg_ras_trilinelg_realcellarrayS$2$lg_realcellarraylg_rmaskcellarrayS$2$lg_rmaskcellarraylg_x11_zscaling lg_x11_rmca lg_ps_rmca lg_rotatelutS$2$lg_rotatelutlg_set_colourindicesS$2$lg_set_colourindiceslg_set_imagerangeS$2$lg_set_imagerangelg_set_logzscalingS$2$lg_set_logzscalinglg_set_rastermodeS$2$lg_set_rastermodelg_x11_inq_sizelg_bmaxsetregion lg_x11_bca lg_ps_bcalg_set_resolutionS$2$lg_set_resolutionlg_set_rubberbandS$2$lg_set_rubberbandlg_x11_rubberband lg_set_updateS$2$lg_set_updatelg_x11_set_update lg_spyglassS$2$lg_spyglasslg_x11_spyglasslg_text S$2$lg_text lg_x11_text lg_ps_textlg_textalignmentS$2$lg_textalignmentlg_x11_textalignmentlg_ps_textalignment lg_textangleS$2$lg_textanglelg_x11_textanglelg_ps_textangle lg_textcolourS$2$lg_textcolour_19_lg_textcolourlg_x11_textcolourlg_ps_textcolour lg_textfontS$2$lg_textfont_19_lg_textfontlg_x11_textfontlg_ps_textfont lg_textheightS$2$lg_textheightlg_x11_textheightlg_ps_textheightlg_unitytransformS$2$lg_unitytransformlg_inq_datawindowlg_inq_viewport lg_update S$2$lg_update lg_x11_update lg_ps_update lg_viewportS$2$lg_viewportlg_wc2pc S$2$lg_wc2pclg_window_titleS$2$lg_window_title lg_x11_titlelg_bmaxsetregionS$2$lg_bmaxsetregionlg_def_coloursS$2$lg_def_colourslg_inq_datawindowS$2$lg_inq_datawindowlg_inq_viewportS$2$lg_inq_viewport lg_ps_bca S$2$lg_ps_bcalg_ps_functionslg_ps_io lg_ps_region lg_ps_format _27_lg_ps_bca _30_lg_ps_bca _32_lg_ps_bca _33_lg_ps_bca _43_lg_ps_bca _45_lg_ps_bca lg_ps_wca FTN_DO_L1IOlg_ps_ca S$2$lg_ps_caS$2DD$lg_ps_ca _27_lg_ps_ca _32_lg_ps_ca _34_lg_ps_ca _35_lg_ps_ca _55_lg_ps_ca _57_lg_ps_ca lg_ps_clearS$2$lg_ps_clear lg_ps_clipS$2$lg_ps_cliplg_ps_fa S$2$lg_ps_falg_ps_fillcolourS$2$lg_ps_fillcolourlg_ps_linecolourS$2$lg_ps_linecolourlg_ps_linestyleS$2$lg_ps_linestylelg_ps_linewidthS$2$lg_ps_linewidthlg_ps_markercolourS$2$lg_ps_markercolourlg_ps_markerscaleS$2$lg_ps_markerscalelg_ps_markertypeS$2$lg_ps_markertypelg_ps_markerwidthS$2$lg_ps_markerwidth lg_ps_openS$2$lg_ps_openS$2DD$lg_ps_open_19_lg_ps_open_21_lg_ps_open_23_lg_ps_open_25_lg_ps_open_26_lg_ps_open_49_lg_ps_open_51_lg_ps_openlg_ps_pl S$2$lg_ps_pllg_ps_pm S$2$lg_ps_pm lg_ps_rmcaS$2$lg_ps_rmcaS$2DD$lg_ps_rmca_29_lg_ps_rmca_34_lg_ps_rmca_36_lg_ps_rmca_37_lg_ps_rmca_62_lg_ps_rmca_101_lg_ps_rmca lg_ps_textS$2$lg_ps_textlg_ps_textalignmentS$2$lg_ps_textalignmentlg_ps_textangleS$2$lg_ps_textanglelg_ps_textcolourS$2$lg_ps_textcolourlg_ps_textfontS$2$lg_ps_textfontlg_ps_textheightS$2$lg_ps_textheightlg_ps_transformS$2$lg_ps_transform lg_ps_updateS$2$lg_ps_update_19_lg_ps_updatelg_ras_3dmimageS$2$lg_ras_3dmimageS$2DD$lg_ras_3dmimage $00000062S$12$lg_ras_xinter lg_ras_xinter lg_ras_fa S$2$lg_ras_fa lg_ras_pl S$2$lg_ras_pl lg_x11_textS$2$lg_x11_text lg_x11_textclg_x11c ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaS$98$Lg_x11_indextotrueS$99$lg_x11_openS$106$lg_x11_pmS$108$lg_x11_textcS$109$lg_x11_caS$113$lg_x11_colourmapS$117DD$Lg_x11_draw_promptS$125$lg_x11_textheightS$129$lg_x11_linewidthS$137$lg_x11_markerwidthS$141$Lg_x11_resizeS$143$Lg_x11_draw_spyglassS$144$Lg_x11_maxmin x11_format x11_x_pixels x11_y_pixelsx11_max_pixelsx11_pixmap_depth x11_min_index x11_max_indexx11_base_indexx11_rgb_reversex11_image_byteswap X11_ColoursX11_RED X11_GREENX11_BLUE x11_min_image x11_max_image x11_x_min_wc x11_y_min_wc x11_x_max_wc x11_y_max_wc x11_x_min_uc x11_y_min_uc x11_x_max_uc x11_y_max_uc x11_x_offset x11_y_offset x11_x_scale x11_y_scale x11_load_font x11_font_okx11_font_indexx11_marker_typex11_marker_colourx11_marker_scalex11_line_widthx11_marker_widthx11_font_heightx11_horizontal_alignmentx11_vertical_alignmentx11_text_anglex11_text_indexx11_text_colourx11_fill_colourx11_line_colourx11_line_style COORDINATESx11_first_font_warningreportx11_rubberband_modex11_rubberband_xx11_rubberband_yx11_rubberband_drawnx11_crosshair_drawnx11_spyglass_modeX11_DATA_ARRAY x11_xmaxdat x11_ymaxdat x11_xstrelm x11_ystrelm x11_xendelm x11_yendelmx11_xmin_imagex11_ymin_imagex11_xmax_imagex11_ymax_imagex11_xmin_spyglassx11_ymin_spyglassx11_xmax_spyglassx11_ymax_spyglassx11_width_spyglassx11_height_spyglass Colour_mapdisplay screen_numwindefault_visualdisplay_visual gc_crosshair gc_cursor gc_polyline gc_fillareagc_text gc_marker font_infohistoryhistory_pointerx11_true_colourx11_log_zscaling num_history lg_x11_error XGetErrorText__iobfprintfLg_x11_indextotrueXSetErrorHandler XOpenDisplayXVisualIDFromVisualXGetVisualInfoXAllocColorCellsXCreateColormapio_big_endianc XCreateWindowXCreateBitmapFromDataXStringListToTextPropertyexitXSetWMProperties XSelectInput XMapWindow Lg_x11_gc XNextEvent Lg_x11_resizeXFree XFreeColormap XFreeFontXFreeGC XCloseDisplayXSync XClearWindow XDrawLines XDrawPoints XDrawSegmentsXDrawArc XFillPolygonLg_x11_loadfontXSetFontfabs XTextWidth XDrawStringcossin XCreatePixmapXDrawImageString XGetImage XFreePixmap XPutImage XCreateImage XStoreColorsXCheckWindowEventXPending XDrawLineLg_x11_draw_spyglass lg_x11_stringLg_x11_draw_prompt XLookupStringXBellXLoadQueryFont XCreateGCXSetForegroundXSetLineAttributes XSetFunctionXSetBackground XSetFillStyle XChangeGC XSetDashesLg_x11_settransformXSetClipRectangles XSetClipMask XResizeWindow Lg_x11_maxminXFillRectangleXDrawRectanglesprintf XSendEvent XSetWMNamelg_x11_rmca ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -AaS$28$lg_x11_rmcalog10pow lg_ps_wca S$2$lg_ps_wcama_1dchebyshevS$2$ma_1dchebyshev ma_1dexpdecayS$2$ma_1dexpdecay ma_1dgaussianS$2$ma_1dgaussianma_1dintercorrS$2$ma_1dintercorrma_1dlorentzianS$2$ma_1dlorentzianma_1dsinusoidalS$2$ma_1dsinusoidal ma_1dvoigtianS$2$ma_1dvoigtianma_2dchebyshevS$2$ma_2dchebyshevS$3$ma_2dsubcheby ma_2dsubcheby ma_2dfrfftS$2$ma_2dfrfftS$2DD$ma_2dfrfft ma_frclfft ma_frowfft ma_2dgaussianS$2$ma_2dgaussian ma_2dpoissonS$2$ma_2dpoisson ma_poisson ma_2dpolargauS$2$ma_2dpolargau S$3$ma_2gpgclS$3DD$ma_2gpgcl FTN_AMOD$ ma_2gpgclma_2dtransformS$2$ma_2dtransformma_2dtranslate ma_2drotate90 ma_2drotate ma_2gaussianS$2$ma_2gaussian ma_arcsliceS$2$ma_arcsliceS$2DD$ma_arcslicema_autocorrelationS$2$ma_autocorrelation ma_2dihfft ma_bestcentreS$2$ma_bestcentreS$2DD$ma_bestcentrema_cal_2dchebyshevS$2$ma_cal_2dchebyshevma_cal_2dncubsplineS$2$ma_cal_2dncubspline_36_ma_cal_2dncubspline_38_ma_cal_2dncubspline_41_ma_cal_2dncubspline_44_ma_cal_2dncubsplinema_cal_2dtransformationS$2$ma_cal_2dtransformationS$2DD$ma_cal_2dtransformationma_cal_circentreS$2$ma_cal_circentreS$2DD$ma_cal_circentrema_cal_angvectorsma_cal_nbcubsplineS$2$ma_cal_nbcubsplinefpbsplma_cal_polynomialS$2$ma_cal_polynomial_23_ma_cal_polynomial ma_centre S$2$ma_centre ma_clockwiseS$2$ma_clockwisema_cubic S$2$ma_cubic ma_cubsplineS$2$ma_cubspline ma_dc2pixcS$2$ma_dc2pixc ma_differ S$2$ma_differ ma_difzscaleS$2$ma_difzscaleS$2DD$ma_difzscalema_dmultiplierS$2$ma_dmultiplier ma_exdigitS$2$ma_exdigitS$2DD$ma_exdigitFTN_ITOIma_expnt S$2$ma_expntma_ffa8 S$2$ma_ffa8 S$2DD$ma_ffa8ma_r4trma_r2trma_frr8ma_ord1ma_ord2ma_ffs8 S$2$ma_ffs8 S$2DD$ma_ffs8ma_ihr8ma_r4synma_ga05a $0000004E $00000099 $000000A2 S$2$ma_ga05aS$2DD$ma_ga05a S$9$nb01ama_ga05c _68_ma_ga05a _70_ma_ga05a _71_ma_ga05a _72_ma_ga05a _73_ma_ga05akb01anb01a ma_gaussianS$2$ma_gaussianS$2DD$ma_gaussianma_grad S$2$ma_grad ma_intersectS$2$ma_intersect ma_l1valueS$2$ma_l1value ma_linecircleS$2$ma_linecircleS$2DD$ma_linecircle ma_logarithmS$2$ma_logarithm ma_medfilterS$2$ma_medfilterS$2DD$ma_medfilter ma_modelfitS$2$ma_modelfit ma_modelminma_pc2dc S$2$ma_pc2dcma_perintersectS$2$ma_perintersectma_pointvectorS$2$ma_pointvector ma_polynomialS$2$ma_polynomialma_power S$2$ma_power ma_projectionS$2$ma_projectionS$2DD$ma_projection_79_ma_projectionma_radd S$2$ma_radd ma_radial S$2$ma_radialS$2DD$ma_radialma_rcadd S$2$ma_rcaddma_rcopy S$2$ma_rcopy ma_rcmult S$2$ma_rcmult ma_rdivideS$2$ma_rdivide ma_rebinmaxS$2$ma_rebinmaxS$2DD$ma_rebinmax ma_rebinminS$2$ma_rebinminS$2DD$ma_rebinminma_rebinminmaxS$2$ma_rebinminmaxS$2DD$ma_rebinminmaxma_rflip S$2$ma_rflipma_rmax S$2$ma_rmaxma_rmean S$2$ma_rmeanma_rmin S$2$ma_rmin ma_rminmaxS$2$ma_rminmaxma_rmove S$2$ma_rmove ma_rmultiplyS$2$ma_rmultiply ma_rrebin S$2$ma_rrebinS$2DD$ma_rrebin ma_rreflectS$2$ma_rreflect ma_reflect ma_rrotateS$2$ma_rrotate ma_transform ma_rscale S$2$ma_rscale ma_rsubtractS$2$ma_rsubtract ma_rtransformS$2$ma_rtransform_41_ma_rtransform_43_ma_rtransform ma_rtransposeS$2$ma_rtranspose ma_rvalue S$2$ma_rvalue _23_ma_rvalue _25_ma_rvalue ma_rvarmultS$2$ma_rvarmult ma_saturatedS$2$ma_saturatedma_sconvolutionS$2$ma_sconvolutionS$2DD$ma_sconvolutionma_sinterpolateS$2$ma_sinterpolate_50_ma_sinterpolatema_slice S$2$ma_sliceS$2DD$ma_slicema_slope S$2$ma_slopema_sort S$2$ma_sortio_dswap ma_statisticsS$2$ma_statistics ma_symfun S$2$ma_symfun ma_thresholdS$2$ma_threshold ma_tophatconS$2$ma_tophatconS$3$ma_tophat2conS$3DD$ma_tophat2con ma_tophat2con ma_trirebinS$2$ma_trirebin_51_ma_trirebin_52_ma_trirebin_53_ma_trirebin_69_ma_trirebin_70_ma_trirebin_71_ma_trirebin_84_ma_trirebin_85_ma_trirebin_86_ma_trirebin_105_ma_trirebin_106_ma_trirebin_107_ma_trirebin_124_ma_trirebin_125_ma_trirebin_140_ma_trirebin_141_ma_trirebin_155_ma_trirebin_156_ma_trirebin_172_ma_trirebin_173_ma_trirebin_187_ma_trirebin_188_ma_trirebin_202_ma_trirebin_203_ma_trirebin_216_ma_trirebin_217_ma_trirebin_231_ma_trirebin_232_ma_trirebin_245_ma_trirebin_246_ma_trirebin_272_ma_trirebin_273_ma_trirebin_274_ma_trirebin_287_ma_trirebin_288_ma_trirebin_289_ma_trirebinma_cal_trilines ma_waverageS$2$ma_waverageS$2DD$ma_waveragema_werf S$2$ma_werf FTN_DTOI$$$exp ma_2dihfftS$2$ma_2dihfftS$2DD$ma_2dihfft ma_irowfft ma_ihclfft ma_2drotateS$2$ma_2drotate ma_2drotate90S$2$ma_2drotate90S$3$ma_sub2drot90 ma_sub2drot90ma_2dtranslateS$2$ma_2dtranslatema_cal_angvectorsS$2$ma_cal_angvectorsma_cal_trilinesS$2$ma_cal_trilines_30_ma_cal_trilines_31_ma_cal_trilines_46_ma_cal_trilines_47_ma_cal_trilines_61_ma_cal_trilines_62_ma_cal_trilines_78_ma_cal_trilines_79_ma_cal_trilines_93_ma_cal_trilines_94_ma_cal_trilines_108_ma_cal_trilines_109_ma_cal_trilines_122_ma_cal_trilines_123_ma_cal_trilines_137_ma_cal_trilines_138_ma_cal_trilines_151_ma_cal_trilines_152_ma_cal_trilines ma_frclfftS$2$ma_frclfftS$2DD$ma_frclfft ma_frowfftS$2$ma_frowfftS$2DD$ma_frowfftma_frr8 S$2$ma_frr8 S$2DD$ma_frr8ma_ihr8 S$2$ma_ihr8 S$2DD$ma_ihr8 ma_modelminS$2$ma_modelminS$2DD$ma_modelmin_147_ma_modelmin_149_ma_modelmin_161_ma_modelmin ma_modelresidma_euclideannorm ma_jacobianma_qrma_lmparma_ord1ma_ord2 ma_poissonS$2$ma_poissonma_rand1ma_r2trma_r4synma_r4tr ma_reflectS$2$ma_reflect ma_transformS$2$ma_transformma_euclideannormS$2$ma_euclideannorm ma_ihclfftS$2$ma_ihclfftS$2DD$ma_ihclfft ma_irowfftS$2$ma_irowfftS$2DD$ma_irowfft ma_jacobianS$2$ma_jacobianma_lmpar S$2$ma_lmpar ma_matsolve ma_modelresidS$2$ma_modelresid_137_ma_modelresidma_qr S$2$ma_qrma_rand1 S$2$ma_rand1S$2DD$ma_rand1 ma_matsolveS$2$ma_matsolve io_basenameS$2$io_basename io_big_endian io_changedirS$2$io_changedirio_lastoccurenceio_close_logfileS$2$io_close_logfileio_close_outmacroS$2$io_close_outmacro_18_io_close_outmacro io_commandS$2$io_commandio_cswap S$2$io_cswap io_directoryS$2$io_directory io_directoryc io_dirpathS$2$io_dirpathio_dswap S$2$io_dswap io_extensionS$2$io_extension io_fileexistS$2$io_fileexist io_fileexistcio_fileextensionS$2$io_fileextension io_filenameS$2$io_filename $$lr_na_19io_filesequenceS$2$io_filesequence io_filesizeS$2$io_filesize io_filesizec io_filesmatchS$2$io_filesmatchio_stringmatch io_filesorderS$2$io_filesorderio_free S$2$io_freeio_freecio_fwrite_carrayS$2$io_fwrite_carrayS$2DD$io_fwrite_carray io_itohexio_fwrite_iarrayS$2$io_fwrite_iarrayS$2DD$io_fwrite_iarrayio_fwrite_integerS$2$io_fwrite_integerio_encode_integerio_fwrite_l1arrayS$2$io_fwrite_l1arrayS$2DD$io_fwrite_l1arrayio_pack_integerio_fwrite_rarrayS$2$io_fwrite_rarrayS$2DD$io_fwrite_rarrayio_fwrite_realS$2$io_fwrite_realio_encode_realio_fwrite_stringS$2$io_fwrite_stringio_encode_stringtmpS$2$io_getargsIARGCGETARG io_getcwd S$2$io_getcwd io_getcwdc io_hextoi io_hextor io_inp_2dbyteS$2$io_inp_2dbyteS$2DD$io_inp_2dbyte io_inp_2di2S$2$io_inp_2di2S$2DD$io_inp_2di2 io_inp_2di4S$2$io_inp_2di4S$2DD$io_inp_2di4io_inpcio_inpd S$2$io_inpd _23_io_inpd _25_io_inpd _27_io_inpd _29_io_inpdio_dtoc io_outpromptio_input_tokenio_toktdio_inpi S$2$io_inpi _23_io_inpi _25_io_inpi _27_io_inpi _29_io_inpiio_inpl S$2$io_inpl _24_io_inpl _26_io_inpl _28_io_inplio_toktlio_inpr S$2$io_inpr _23_io_inpr _25_io_inpr _27_io_inpr _29_io_inprio_inps S$2$io_inps S$2DD$io_inps _27_io_inps _30_io_inps io_input_line io_inptokenS$2$io_inptokenS$2DD$io_inptoken_27_io_inptoken_30_io_inptokenio_inq_ikeyvalueS$2$io_inq_ikeyvalueio_access_databaseio_inq_keyvalueS$2$io_inq_keyvalueio_inq_lkeyvalueS$2$io_inq_lkeyvalueio_inq_inmacroS$2$io_inq_inmacroio_inq_rkeyvalueS$2$io_inq_rkeyvalue io_inq_varnumS$2$io_inq_varnum io_cstrings io_vstrings io_cvariables io_vvariables io_isdigitS$2$io_isdigitio_iswap S$2$io_iswapio_itoc _17_io_itoc _20_io_itoc _22_io_itoc _24_io_itoc _26_io_itoc _28_io_itoc _30_io_itoc _32_io_itoc _34_io_itoc _35_io_itoc _38_io_itoc _41_io_itoc _43_io_itoc _45_io_itoc _47_io_itoc _49_io_itoc _51_io_itoc _53_io_itoc _55_io_itoc _56_io_itoc io_listfilesS$2$io_listfiles io_filestypeio_load_databaseS$2$io_load_database_20_io_load_database_22_io_load_database_26_io_load_database_28_io_load_databaseio_lower S$2$io_lowerio_lswap S$2$io_lswapio_ltoc S$2$io_ltoc io_malloc S$2$io_malloc io_malloccio_menu S$2$io_menu _38_io_menu io_systemio_mset_optionsS$2$io_mset_options io_occurencesio_quotedstringio_newfilenameS$2$io_newfilename io_nodirpathS$2$io_nodirpathio_noextensionS$2$io_noextensionio_open_asciifileS$2$io_open_asciifileio_open_inmacroS$2$io_open_inmacroio_open_logfileS$2$io_open_logfileio_open_outmacroS$2$io_open_outmacro_23_io_open_outmacro_25_io_open_outmacro_26_io_open_outmacro_27_io_open_outmacro_28_io_open_outmacro io_outfileS$2$io_outfile io_read_fileS$2$io_read_file_18_io_read_fileio_recl S$2$io_recl io_rminmaxS$2$io_rminmaxio_rset S$2$io_rsetio_rswap S$2$io_rswapio_rtoc S$2$io_rtoc _17_io_rtoc _20_io_rtoc _22_io_rtoc _24_io_rtoc _26_io_rtoc _28_io_rtoc _30_io_rtoc _31_io_rtoc _34_io_rtoc _37_io_rtoc _39_io_rtoc _41_io_rtoc _43_io_rtoc _45_io_rtoc _47_io_rtoc _48_io_rtocio_save_databaseS$2$io_save_database_19_io_save_database_21_io_save_database_23_io_save_database_28_io_save_database_30_io_save_databaseio_set_ikeyvalueS$2$io_set_ikeyvalueio_set_keyvalueS$2$io_set_keyvalueio_set_lkeyvalueS$2$io_set_lkeyvalueio_set_rkeyvalueS$2$io_set_rkeyvalueio_set_variableS$2$io_set_variableS$17$io_varkillstr io_set_varstr io_varkillstrio_set_varcompactio_sleep S$2$io_sleep io_sleepcio_start S$2$io_startio_system_nameS$2$io_system_nameio_system_namecio_text S$2$io_text _29_io_text io_input_keyio_search_tokenio_times S$2$io_times io_timesc io_tokens S$2$io_tokensio_cseparators io_separatorsio_tokti S$2$io_tokti _20_io_tokti _22_io_toktiio_toktr S$2$io_toktr _20_io_toktr _22_io_toktr _59_io_toktr _61_io_toktr io_trans_pathS$2$io_trans_path io_userpath io_translateS$2$io_translateS$5$io_statementS$8$io_tr_parse io_statement io_tr_parseio_eval_string io_evaluateio_inq_variableio_unpack_integerio_unset_variableS$2$io_unset_variableio_up_directoryS$2$io_up_directoryio_upper S$2$io_upperio_uwrite_rarrayS$2$io_uwrite_rarrayS$2DD$io_uwrite_rarray_25_io_uwrite_rarray_29_io_uwrite_rarray_35_io_uwrite_rarray_36_io_uwrite_rarray_101_io_uwrite_rarray_141_io_uwrite_rarray io_var_numberS$2$io_var_number io_variableS$2$io_variableio_vtoc S$2$io_vtoc _31_io_vtoc _50_io_vtocio_write S$2$io_write _18_io_write _20_io_write _22_io_write _24_io_write io_write_fileS$2$io_write_file_19_io_write_file_22_io_write_file_24_io_write_file io_writenaS$2$io_writena_18_io_writenaio_writena_file st_def_systemS$2$st_def_system st_dbposition io_def_system st_errorcodeS$2DD$st_errorcodest_goodst_out S$2$st_out S$2DD$st_out _101_st_out $$fill_27 $$fill_30 $$fill_26 $$fill_29 $$fill_25 $$fill_22 $$fill_21st_saveslenS$2$slenio_big_endianc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaio_access_databaseS$2$io_access_database io_def_systemS$2$io_def_systemio_def_separatorsio_dtoc S$2$io_dtoc _17_io_dtoc _20_io_dtoc _22_io_dtoc _24_io_dtoc _26_io_dtoc _27_io_dtoc _30_io_dtoc _33_io_dtoc _35_io_dtoc _37_io_dtoc _39_io_dtoc _40_io_dtocio_encode_integerS$2$io_encode_integerio_encode_realS$2$io_encode_real io_rtohexio_encode_stringS$2$io_encode_string io_evaluateS$2$io_evaluateS$4$io_eval_stringS$5$io_eval_syntaxS$6$io_eval_tokensS$7$io_eval_tokenS$8$io_eval_evalS$9$io_eval_multifS$10$io_eval_opshrinkS$11$io_eval_numopS$12$io_eval_integerS$13$io_eval_logicalS$14$io_eval_realS$15$io_eval_intrealS$16$io_eval_errorS$21$io_eval_mfunS$22$io_eval_2funS$22DD$io_eval_2funS$23$io_eval_1funS$24$io_eval_arithmeticS$24DD$io_eval_arithmeticS$25$io_eval_relationalS$26$io_eval_logop $00000298S$27$io_evalexpio_eval_syntaxio_eval_tokens io_eval_eval io_evalexp io_eval_tokenio_eval_multif io_eval_numop io_eval_errorio_eval_integerio_eval_opshrinkio_eval_compact io_eval_mfun io_eval_1fun io_eval_2funio_eval_arithmeticio_eval_intrealio_eval_relationalio_eval_logical io_eval_logop io_eval_real_346_io_eval_error_352_io_eval_error io_eval_rfunLGELGTLLELLT FTN_ISIGN FTN_COSH$ FTN_SINH$ FTN_TANH$ FTN_AINT$ANINT$ io_filestypeS$2$io_filestype io_filetype io_input_keyS$2$io_input_key io_input_keyc io_input_lineS$2$io_input_lineio_readio_input_tokenS$2$io_input_tokenio_tokenio_inq_variableS$2$io_inq_variable io_itohexio_lastoccurence io_occurences io_outpromptS$2$io_outpromptio_pack_integerio_quotedstringS$2$io_quotedstringio_search_tokenS$2$io_search_tokenio_stringmatchS$2$io_stringmatch io_system S$2$io_system io_systemcio_toktd S$2$io_toktd _19_io_toktd _21_io_toktd _54_io_toktd _56_io_toktdio_toktl S$2$io_toktl io_userpathS$2$io_userpath io_loginname io_homedirio_writena_fileS$2$io_writena_file_18_io_writena_fileio_directoryc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaopendirgetcwdclosedirchdirreaddirstatstrcmpio_fileexistc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaio_filesizec ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaio_freec ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aafreeio_getcwdc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaio_mallocc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaio_sleepc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aa S$4$io_sleepcsleepio_system_namec ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aaio_timesc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aasysconftimesio_def_separatorsS$2$io_def_separators io_filetypeS$2$io_filetype io_homedirS$2$io_homedir io_homedirc io_loginnameS$2$io_loginname io_loginnamecio_read S$2$io_read _40_io_read _42_io_read _45_io_read _47_io_read io_read_macroio_close_inmacroio_readc io_rtohexio_token S$2$io_tokenio_input_keyc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aafflush tcgetattr tcsetattrio_systemc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aasystemio_close_inmacroS$2$io_close_inmacro_19_io_close_inmacro io_read_macroS$2$io_read_macro_32_io_read_macro_35_io_read_macro_39_io_read_macro_41_io_read_macro_43_io_read_macroio_homedirc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aagetpwnamio_loginnamec ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aagetuidgetpwuidio_readc ccom options = -DAportable -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! -Aareadline add_historyfpbspl S$2$fpbsplsurfit S$2$surfit _34_surfit _36_surfit _38_surfit _40_surfit _42_surfit _44_surfit _46_surfit _49_surfit _51_surfit _53_surfit _55_surfit _61_surfit _63_surfit _65_surfit _68_surfit _75_surfit _82_surfitfpsurffpsurf S$2$fpsurf S$2DD$fpsurffpordefpgivsfprotafpbackfprankfpdiscfpratifpbackfpdiscfpgivs S$2$fpgivsfpordefprank S$2$fprankfprati $00000012 S$2$fpratifprotacd_fabsfabs_nan __fabs_errcd_log10 __math_dlog10 __log10_errcd_pow __pow_slow __math_dpow __pow_err cd_sincossin_badcos_badsindcosd __math_dsin __math_dcos__math_dsin_deg__math_dcos_deg __sin_err __cos_err __cossin_err~cd_error ccom options = -DA1.1b -DS1.1b -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -AaA.10.31.$SD$#CLO#Components#LIBMATH#Src#poolm local_matherrS$26$__exp_errM$25S$27$__hypot_errS$34$__acosh_errS$35$__atanh_errS$36$__log_errS$37$__log10_errS$38$__log2_errS$39$__sqrt_errS$40$__pow_errS$41$__trig_errorS$47$__atan2_errS$48$__atan2_deg_errS$51$__sinh_errS$52$__cosh_errS$55$__fmod_errS$56$__lgamma_errS$57$__ldexp_err S$58$__j0_err S$59$__y0_err S$60$__j1_err S$61$__y1_err S$62$__jn_err S$63$__yn_errquotientmissing_error_handlerSQNAN_matherrmatherr __exp_errisnan__ux_silence_nan __hypot_err __floor_err __ceil_err __rint_err __erf_err __erfc_err __asinh_err __acosh_errDQNAN __atanh_err __log_err __log2_err __sqrt_errdrem remainder DINFINITY __trig_error __tan_err __atan_err __atan2_err__atan2_deg_err __asin_err __acos_err __sinh_err __cosh_err __tanh_err __fmod_errfinite __lgamma_err __ldexp_err__j0_err__y0_err__j1_err__y1_err__jn_err__yn_err mathd_cossin dsc_startpic0const0dsc_highzerotestdsc_rr0dsc_rrds15ds35ds25constp4constc1conste4dsc_hi27range_6constp6constpaconsts1conste6dsc_hi54range_cconstpcrloopcconstec dsc_infnanconstpqsc_qnandtn_okno_tandt15dt35dtcommondt25 sc_pid180here2here3here5 __math_dtan__math_dtan_deg mathd_log lg_constsdpowagndpowzneg dpowinfnandpowdendpowzpowdpowipow dpowquick dpownzpowhere0powokehere1 pw_constsdpowbigdpwcc xp_const5dexpedpowhugedexpnegdexpinf znanretpropdpowzerd dpwminfnandpowbzerdpowbnidpowbnegdpowpnandpowbzpfdpowbzpidpowbzzzeroargznanretlg_ponedpowminfdpowbnanhere4lg_2_52dpowinfdpowbok znanretprop1zminfretdpowbpowhere6lg_pinfzinfretddpowqndpowq1dpowq2dpowqm1here7here18 xp_constsdexpbigdsinh0dexccdexuudexphugedexuuhypdexpdnrmdexpnanhere19here20ex_2m52here21lg_qnanznanretpropmergedlog0dlogzneg dloginfnandlogdenhere8logokedlogerrhere9dlg2p54here10 dlglg2p54dlog010 dlog10zneg dlog10denhere11logok10here12here13 dlglg2p5410dlog02 dlog2znegdlog2denhere14logok2here15here16 dlglg2p542 sinhsmallhere22dsinhbighere23 sh_consts dsinhhugedsinhuhere24here25here26 ch_constsdcshhfdcsh1dcoshbighere27here28here29here30 th_constsdtnhsdtnh9here31 th2_constsdtnh1dtnh8dtnhi __math_dlog __math_dexp __math_dlog2 __math_dsinh __math_dcosh __math_dtanh~_matherr ccom options = -DA1.1b -DS1.1b -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -Aa|c_ieee ccom options = -DA1.1b -DS1.1b -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -Aa S$21$_scalb S$24$_logbS$27$_remainder S$29$_fmod S$33$_isinf S$34$_isinff_scalbscalb _copysigncopysign _copysignf copysignf_logblogb_finite_finiteffinitef _remainder_drem_fmodfmod_fmodffmodf_isnan_isnanfisnanf_isinfisinf_isinffisinff__ux_silence_nanf}fpconst ccom options = -DA1.1b -DS1.1b -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -AaDSNAN SINFINITYSSNAN}matherr ccom options = -DA1.1b -DS1.1b -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -Aareadline ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae SB$readlinereadline_internalreadline_internal_charloopreadline_initialize_everythingstart_using_historyreadline_default_bindingsbind_arrow_keysbind_arrow_keys_internal rl_digit_loopS$161DD$rl_refresh_line$PIC$29rl_change_case_rl_char_search rl_promptrl_pointrl_endrl_markrl_donerl_dispatchingrl_executing_keymapreadline_top_level _rl_in_stream_rl_out_stream_rl_comment_beginrl_library_versionrl_line_bufferrl_pending_inputrl_terminal_name rl_instream rl_outstreamrl_startup_hookrl_pre_input_hookrl_erase_empty_line_rl_horizontal_scroll_mode _rl_keymaprl_editing_mode_rl_last_command_was_killrl_numeric_argrl_explicit_arg rl_arg_sign rl_last_funcreadline_echoing_prl_visible_prompt_lengthrl_key_sequence_length _rl_eof_char_rl_mark_modified_lines_rl_bell_preferencerl_line_buffer_len_rl_parsing_conditionalized_out_rl_convert_meta_chars_to_ascii_rl_output_meta_chars _rl_meta_flagemacs_standard_keymaprl_expand_prompt rl_initializerl_prep_term_functionrl_set_signalsrl_deprep_term_functionrl_clear_signalsreadline_internal_setuprl_on_new_linerl_redisplay_functionrl_vi_insertion_modereadline_internal_teardowncurrent_history rl_undo_listxmallocrl_revert_line where_historyreplace_history_entry_rl_free_history_entryfree_undo_listreadline_internal_char sigsetjmp_rl_init_argument rl_read_key _rl_dispatchvi_movement_keymap rl_vi_check rl_newline$$sh_func_adrs_rl_erase_entire_line_rl_init_line_state_rl_set_the_line_rl_defining_kbd_macro_rl_add_macro_chardingrl_do_lowercase_versionisuppertolowerrl_digit_argument_rl_abort_internal_rl_with_macro_input_rl_vi_textmod_command_rl_vi_set_lastrl_reset_line_state_rl_vi_initialize_line get_env_value_rl_init_terminal_iorl_initialize_funmap_rl_init_eightbitrl_read_init_file_rl_term_autowrap screenwidth screenchars screenheightrl_set_keymap_from_edit_mode_rl_enable_meta_rl_enable_meta_key"rl_completer_word_break_charactersrl_basic_word_break_charactersrltty_set_default_bindingsrl_function_of_keyseqrl_get_previous_history_rl_bind_if_unboundrl_get_next_history rl_forward rl_backwardrl_save_promptrl_restore_promptrl_clear_message rl_messagerl_universal_argumentisdigitrl_discard_argumentrl_insert_textrl_extend_line_bufferstrncpy_rl_doing_an_undo rl_add_undorl_delete_text rl_copy_text _rl_fix_point_rl_replace_textrl_begin_undo_grouprl_end_undo_grouprl_beg_of_linerl_end_of_linerl_forward_wordrl_backward_word alphabeticrl_refresh_linerl_display_prompt_rl_last_c_pos _rl_move_vert_rl_move_cursor_relative_rl_clear_to_eolrl_forced_update_displayrl_display_fixedrl_clear_screen_rl_clear_screen rl_arrow_keysislowertoupper rl_insert_rl_any_typein_rl_insert_typeinrl_quoted_insert rl_tab_insert_rl_vi_done_inserting_rl_vi_reset_last_rl_update_final rl_rubout rl_delete rl_kill_textisprintrl_character_len_rl_erase_at_end_of_linerl_rubout_or_deleterl_delete_horizontal_spacerl_delete_or_show_completionsrl_possible_completionsrl_insert_commentrl_upcase_wordrl_downcase_wordrl_capitalize_word rl_modifyingrl_transpose_wordsrl_transpose_chars_rl_char_search_internalrl_char_searchrl_backward_char_searchsaved_line_for_history using_historymaybe_replace_linemaybe_unsave_linemaybe_save_linerl_beginning_of_historyrl_end_of_history next_historyprevious_history_rl_set_mark_at_pos rl_set_markrl_exchange_point_and_markrl_vi_editing_moderl_emacs_editing_modehistory ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae SD$history SB$historyhistory_lengthmax_input_historyhistory_offset history_basehistory_get_history_statehistory_set_history_statehistory_total_byteshistory_set_pos history_list history_getxreallocremove_historystifle_historyunstifle_historyhistory_is_stifled clear_historyvi_mode ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae BS$vi_mode SD$vi_mode SB$vi_mode_rl_vi_stuff_insert_rl_vi_save_insertrl_digit_loop1strchr rl_vi_redo rl_vi_undorl_undo_commandrl_vi_yank_argrl_yank_nth_argrl_vi_fetch_historyrl_vi_search_againrl_noninc_reverse_search_againrl_noninc_forward_search_again rl_vi_searchrl_noninc_forward_searchrl_noninc_reverse_searchrl_vi_completerl_vi_end_wordrl_complete_internal rl_completerl_vi_tilde_expandrl_tilde_expandrl_vi_prev_wordrl_vi_next_word rl_vi_bWord rl_vi_bword rl_vi_fWord rl_vi_fword rl_vi_eWord rl_vi_ewordrl_vi_insert_begrl_vi_append_moderl_vi_append_eolrl_vi_eof_maybevi_insertion_keymap_rl_undo_group_levelrl_vi_movement_moderl_vi_arg_digitrl_vi_change_case rl_vi_putrl_yank rl_vi_column rl_vi_domove rl_stuff_charrl_vi_delete_torl_vi_change_to rl_vi_yank_to rl_do_undo rl_vi_deleterl_vi_back_to_indentrl_vi_first_printrl_vi_char_searchrl_getc rl_vi_matchrl_vi_bracktyperl_vi_change_char rl_vi_subst rl_kill_linerl_vi_overstrikerl_vi_overstrike_delete rl_vi_replacerl_make_bare_keymaprl_vi_set_markrl_vi_goto_markfunmap ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae DS$funmap SB$funmapfunmap#funmap_program_specific_entry_startrl_abortrl_backward_kill_linerl_backward_kill_wordrl_call_last_kbd_macrorl_copy_backward_wordrl_copy_forward_wordrl_copy_region_to_killrl_dump_functionsrl_dump_macrosrl_dump_variablesrl_end_kbd_macrorl_forward_search_historyrl_history_search_backwardrl_history_search_forwardrl_insert_completionsrl_kill_full_linerl_kill_region rl_kill_wordrl_menu_completerl_re_read_init_filerl_reverse_search_historyrl_start_kbd_macro rl_tty_statusrl_unix_line_discardrl_unix_word_ruboutrl_yank_last_arg rl_yank_poprl_add_funmap_entryrl_funmap_names_rl_qsort_string_compareqsortpossible_control_prefixespossible_meta_prefixeskeymaps ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Aeemacs_meta_keymapemacs_ctlx_keymaprl_copy_keymaprl_make_keymaprl_discard_keymaprltty ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeBS$rlttySB$rltty block_sigintrelease_sigint set_winsize rltty_warningM$84get_tty_settingsset_tty_settingsprepare_terminal_settingsrl_prep_terminalrl_deprep_terminal sigemptyset sigaddset sigprocmaskioctlfileno_rl_enable_keypad_rl_control_keypadrl_restart_outputtcflowrl_stop_outputcomplete ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae SD$complete SB$completerl_quote_filename rl_strpbrk get_y_or_n stat_charprintable_partprint_filenamefind_completion_wordgen_completion_matchesremove_duplicate_matchescompute_lcd_of_matchespostprocess_matchesS$105DD$rl_display_match_list$PIC$14display_matchesmake_quoted_replacement insert_matchappend_to_matchinsert_all_matchesfree_match_listS$126DD$rl_menu_complete$PIC$25rl_inhibit_completion"_rl_print_completions_horizontally_rl_completion_case_foldrl_completion_entry_function#rl_ignore_some_completions_function rl_attempted_completion_functionrl_completer_quote_charactersrl_basic_quote_charactersrl_filename_quote_charactersrl_special_prefixesrl_directory_completion_hook"rl_completion_display_matches_hookrl_filename_completion_desiredrl_filename_quoting_desiredrl_filename_quoting_functionrl_filename_dequoting_functionrl_char_is_quoted_prl_attempted_completion_overrl_completion_typerl_completion_append_characterrl_completion_query_itemsrl_ignore_completion_duplicates_rl_complete_show_all_rl_complete_mark_directoriesrl_visible_stats rl_complete_with_tilde_expansionlstataccessstrrchr__flsbuf tilde_expandfilename_completion_functioncompletion_matchesrl_display_match_listcrlf_rl_vis_botlinusername_completion_functionsetpwentgetpwentstrncmpendpwent strncasecmpbind ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeDS$bindBS$bindSD$bindSB$bind $00000027 $00000028 $00000029 $0000002A $0000002B $0000002C $0000002D $0000002E $0000002F $00000030 $00000031 $00000032 $00000033M$119$L18$PIC$10_rl_untranslate_macro_value _rl_read_file_rl_read_init_file_rl_init_file_error parser_if parser_else parser_endifparser_includehandle_parser_directiveglean_key_from_namesubstring_member_of_array_rl_get_keyname_rl_macro_dumper_internalrl_binding_keymap rl_add_defun rl_bind_keyrl_bind_key_in_map rl_unbind_keyrl_unbind_key_in_maprl_unbind_function_in_maprl_unbind_command_in_maprl_named_function rl_set_keyrl_generic_bind rl_macro_bindrl_translate_keyseqrl_untranslate_keyseq strcasecmprl_parse_and_bindrl_readline_namerl_variable_bindatoirl_get_keymap_by_name rl_set_keymap_rl_isearch_terminatorsrl_get_keymap_name rl_get_keymap!rl_get_keymap_name_from_edit_moderl_list_funmap_namesrl_invoking_keyseqs_in_mapstrcatrl_invoking_keyseqsrl_function_dumperrl_macro_dumperrl_variable_dumper _rl_strindexdisplay ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae BS$display SD$display SB$display expand_promptM$136cr update_lineS$137DD$rl_redisplay$PIC$2insert_some_chars delete_chars space_to_eol rl_redisplay_rl_suppress_redisplay_rl_last_v_pos_rl_output_some_charsterm_upterm_cr_rl_output_character_functiontputs _rl_backspaceterminal_can_insertterm_ICterm_dc rl_show_charvsprintf_rl_make_prompt_for_search term_clreol term_clrpagtgototerm_imterm_icterm_eiterm_DC_rl_redisplay_after_sigwinch_rl_clean_up_for_exitsignals ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae BS$signals SB$signalsrl_signal_handlerrl_sigwinch_handlerrl_set_sighandlerrl_maybe_set_sighandlerrl_catch_signalsrl_catch_sigwinchrl_free_line_staterl_cleanup_after_signal sigdelsetgetpidkillrl_reset_after_signalrl_resize_terminal sigaction_rl_kill_kbd_macroutil ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeSD$util#_rl_allow_pathname_alphabetic_chars_rl_executing_macro_rl_pop_executing_macro siglongjmpstrcoll_rl_uppercase_p_rl_lowercase_p_rl_pure_alphabetic _rl_digit_p _rl_to_lower _rl_to_upper_rl_digit_value_rl_savestringkill ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeSD$killSB$kill_rl_copy_to_kill_ringregion_kill_internal_rl_copy_word_as_killrl_yank_nth_arg_internalM$114rl_set_retained_killshistory_arg_extractundo ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae_rl_fix_last_undo_of_typemacro ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeSD$macroSB$macro_rl_push_executing_macro_rl_next_macro_keyrl_push_macro_inputinput ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeBS$inputSD$inputSB$input ibuffer_space rl_get_char rl_unget_char rl_gather_tyi rl_event_hookrl_getc_functionmemsetselectfcntl_rl_input_availablerl_execute_nextterminal ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae DS$terminal SD$terminal SB$terminalget_term_capabilitiesPCUPBC term_gototerm_backspaceterm_pcterm_ip_rl_get_screen_sizetgetnumset_lines_and_columns_rl_set_screen_sizetgetstrtgetenttgetflagrl_get_termcaprl_reset_terminalnls ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae setlocalexmalloc ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Aememory_error_and_abortreallocxfreeshell ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeM$16 single_quoteputenvgetenv get_home_dirsearch ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae SD$search SB$searchnoninc_search_from_posnoninc_dosearch noninc_searchrl_history_search_internalhistory_search_prefixhistory_searchisearch ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae SB$isearchrl_search_historyrl_display_searchM$95histexpand ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Ae SB$histexpandhistory_find_word!hist_string_extract_single_quoted quote_breaks hist_errorget_subst_patternpostproc_subst_rhshistory_expand_internalget_history_word_specifierhistory_tokenize_internal"history_inhibit_expansion_functionhistory_expansion_charhistory_subst_charhistory_comment_charhistory_no_expand_chars history_quotes_inhibit_expansionget_history_eventhistory_search_delimiter_charshistory_expandhistory_tokenizetilde ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -AeDS$tildetilde_find_prefixtilde_find_suffixisolate_tilde_prefixglue_prefix_and_suffix!tilde_expansion_preexpansion_hooktilde_expansion_failure_hooktilde_additional_prefixestilde_additional_suffixestilde_expand_wordhistsearch ccom options = -DA1.1 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx,st,ap,Pg,ug,Lu,dp,Fs,bp,wp! +z -Aehistory_search_internalhistory_search_pos|vsprintf ccom options = -DA1.0 -DS1.0 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -Ac_doprnt|isamstub ccom options = -DA1.0 -DS1.1 -Oq02,al,ag,cn,Lm,sz,Ic,vo,lc,Mf,Po,es,rs,sp,in,vc,Pi,fa,pe,Rr,Fl,pv,pa,nf,cp,lx! -Aeiserrnoisreclen __stub_err__io_ded isaddindexisbuildisclose isdelcurriserase isindexinfoisopenisread isrelease isrewcurr isrewriteisstartiswriteshfadrs div_const$neg3$pos$neg$neg5$neg6 $pos_for_17$neg10 $neg_for_17$neg12$neg15$neg17$neg7$7$pos7$1$2$8 $neg7_shift$3$4$neg9$neg14$$divide_by_constant$$divI_2$$divI_4$$divI_8 $$divI_16$$divI_3$$divU_3$$divI_5$$divU_5$$divI_6$$divU_6 $$divU_10 $$divI_12 $$divU_12 $$divI_15 $$divU_15 $$divI_17 $$divU_17$$divI_7$$divU_7$$divI_9$$divU_9 $$divI_14 $$divU_14mulIl4l3l2l0l1ret_t0e_shifte_t0e_2t0e_t02a0e_4t0e_2t0a0e_t0a0e_4t0a0e_t04a0e_5t0e_8t0e_8t0a0e_3t0e2t04a0e4t08a0e_t0ma0remI neg_denomneg_num regular_seq neg_num_2finish$$remoIdyncallUnoshlibs$$dyncall_externalnewfill $fill_bytes$last$q_loop$out $even_32_mult$fill_30 $big_fill $$fill_wa_unk $$fill_32$$fill_7$$fill_6$$fill_5$$fill_4$$fill_3$$fill_2$$fill_1movelr1$find_alignment$more_na$bigger_but_still_small$b_out$b_loop $wordloop$endloop$bad_alignment $odd_words$non_aligned_entry $lr_na_0_Alt $lr_na_1_Alt $lr_na_2_Alt $lr_na_3_Alt $lr_na_4_Alt $lr_na_5_Alt $lr_na_6_Alt $lr_na_7_Alt $lr_na_8_Alt $lr_na_9_Alt $lr_na_10_Alt $lr_na_11_Alt $lr_na_12_Alt $lr_na_13_Alt $lr_na_14_Alt $lr_na_15_Alt $lr_na_16_Alt $lr_na_17_Alt $lr_na_18_Alt $lr_na_19_Alt $lr_na_20_Alt $lr_na_21_Alt $lr_na_22_Alt $lr_na_23_Alt $lr_na_24_Alt $lr_na_25_Alt $lr_na_26_Alt $lr_na_27_Alt $lr_na_28_Alt $lr_na_29_Alt $lr_na_30_Alt $na_restart$wloop$big_wa1$big_wa2 $$lr_na_31 $$lr_na_30 $$lr_na_29 $$lr_na_28 $$lr_na_27 $$lr_na_26 $$lr_na_25 $$lr_na_24 $$lr_na_23 $$lr_na_22 $$lr_na_21 $$lr_na_20 $$lr_na_18 $$lr_na_6 $$lr_na_5 $$lr_na_4 $$lr_na_3 $$lr_na_2 $$lr_na_1 $$lr_wa_big $$lr_wa_31 $$lr_wa_29 $$lr_wa_28 $$lr_wa_27 $$lr_wa_26 $$lr_wa_25 $$lr_wa_24 $$lr_wa_23 $$lr_wa_22 $$lr_wa_21 $$lr_wa_7 $$lr_wa_6 $$lr_wa_5 $$lr_wa_4 $$lr_wa_3 $$lr_wa_2 $$lr_wa_1 move_byte byteloop_1 wordloop_1 endloop_1finish_1 byteloop0_1 copy_byteall_donebloop copy_fillExitFillit $$fill_byte move_fillscmp_bylab1setitlab2scmp_waloopdo_final_comparefinish_comparethree_bytes_remaintwo_bytes_remainscmp_flwordoffsetshortcomloopbloop0scmp_afllengths_differentleft_is_shorter final_exit mathd_atandatan0 at_constsatn99atn00atn5atnpl atninfnanqnanretnot_eastfareast datan2_nan northsouthfarwestwestupat_mpiat_pi at_just_pi farwestup datn2_zerofarnorthnorth at_mpiov2at_piov2cornerfarsouthat_qnandasin0 dasin_consts dasin_bad dasin_highdasc2dasin_udacosxdacosudacosz$$atan$$atan2$$asin mathd_cossin mathd_log$$pow$$log10 maths_loglog_2_10_enter logn_parmslog_oklog_neg log_0_dnrm log_bad_mergelog_0log_dnrmdlgtbc fill_bytefinish_2byloop_2lab2_2lab1_2etextedataend_etext_edata_end __SYSTEM_ID _fp_status@Lhx6y6y4DX8op6} dLhx52b8;o[;n;enP;a| ;en;a| ;eo";a|t;eo];a|P;ep;a} ;el;a|;em;a|;em;a|;em;a|;em;a|;em;a|;em-;a|;em.;a|;em0;a|;emI;a|0;em;a| ;em;a| ;em;a| ;em;a|!;em;a|!t;em;a|!;em;a|";em;a|";em;a|#;em;a|$;em;a|%;em;a|%(;em;a|%p;en ;a|(;en/;a|(<;enJ;a|(;enK;a|(;enL;a|);enW;a|+;enj;a|,T;env;a|,;en{;a|-;en;a|.x;en;a|.;en;a|/;en;a|0;en;a|0X;en;a|1;en;a|1,;en;a|1<;en;a|1;en;a|1;en;a|1;en;a|3p;eo ;a|3;eo-;a|4;eo/;a|4d;eo0;a|4;eo1;a|4;eoL;a|5$;eoM;a|5;eoW;a|6t;eo`;a|6;eoi;a|7;eo;a|7;eo;a|8;eo;a|8;eo;a|8;eo;a|9\;eo;a|9;eo;a|9;eo;a|:8;eo;a|:l;eo;a|<(;eo;a} ;eo;a}>|;eo;a}>;eo;a}?;eo;a}?;eo;a}@;eo;a}@;ep;a} A;ep;a} B;ep;a} BL;ep;a} Bx;ep;a} B;ep;a} B;ep;a} Cp;ep%;a}C;ep';a}C;el;a|Dx;el;a|H;el;a|HT;el;a|I;em;a|J;em ;a|J;em;a|J;em;a|KD;em;a|Kh;em;a|K|;em;a|M0;em0;a|M;em=;a|N$;emm;a|Q;em~;a|S0;em;a|S;em;a|TD;em;a|T;em;a|U;em;a|U,;em;a|Up;em;a|V(;em;a|V;em;a|W(;em;a|Wx;em;a|W;em;a|X;em;a|X;em;a|Y(;em;a|Z8;em;a|Z;em;a|Z;em;a|[T;en&;a|\\;en-;a|\;en0;a|];en1;a|];enC;a|^;ene;a|^ ;enf;a|^T;enh;a|^;enm;a|^;enn;a|^;enr;a|_;en{;a|_$;en};a|_<;en};a|_;en;a|_;en;a|dD;en;a|dX;en;a|e;en;a|f`;en;a|fx;en;a|f;en;a|g,;en;a|gD;en;a|g;en;a|g;en;a|g;en;a|i;en;a|iP;en;a|i;en;a|i;en;a|j;en;a|jH;en;a|j;eo;a|j;eo;a|k$;eo;a|kP;eo);a|k;eo5;a|l;eo>;a|l;eoC;a|m`;eoC;a|m;eoF;a|n;eoG;a|nL;eoM;a|o;eoR;a|o;eoV;a|p$;eod;a|pX;eod;a|p;eoe;a|p;eoe;a|q4;eol;a|s;eow;a|t0;eoy;a|vh;eoz;a|v;eo;a|x;eo;a}x<;eo;a}xt;eo;a}x;eo;a}yh;eo;a}y;eo;a}zP;eo;a}{x;eo;a}{;eo;a}{;eo;a}|@;ep;a} ~;ep;a} ;ep;a} L;ep;a} ;ep ;a} ;ep#;a}|;ep&;a}4DX::%;el;a|;el;a|;el;a|<;em;a|;em+;a|;em+;a|;em9;a|;em9;a|;em>;a|L;emC;a|;emC;a|;emG;a|D;emH;a|;emm;a|;em};a|;em;a|D;em;a|;em;a|;em;a|;em;a|;em;a|;em;a|;em;a|;em;a|`;em;a|;em;a|;em;a|;en;a|;en;a|;en;a|h;en ;a|;en*;a|0;en+;a|;en,;a|;en-;a|L;enF;a|x;enJ;a|;enN;a|;ens;a|h;en;a|;en;a| ;en;a|4;en;a|;en;a|;en;a|(;en;a|\;en;a|;en;a|;en;a| ;en;a|T;eo;a|;eo;a|;eo;a|D;eo1;a|h;eo4;a|;eo5;a|;eo8;a|;eo<;a|d;eoA;a|;eoD;a|;eoE;a| ;eoa;a|;eo};a|;eo;a| ;eo;a|0;eo;a|;eo;a|\;eo;a|;eo;a|;eo;a|;eo;a};eo;a} ;eo;a}x;eo;a};ep;a}$;ep;a} P;ep;a} ;ep;a} <;ep";a}4DX::(T;el;a|h;el;a|;em;a|;em;a|T;em;a|l;en;a|;en;a|;en;a|X;en ;a|;en ;a|;enE;a|,;enF;a|X;enH;a||;enH;a|;enM;a|;en;a|;en;a|;eo;a|;eo2;a|;eo2;a||;eo8;a|;eo=;a|D;eo|;a|h;eo~;a| ;eo;a|t;eo;a};eo;a} ;enD;a|@;enD;a|t;enG;a|;enI;a|;eo{;a| :=: *L:=: *:>: *0:?: *:@: *:@: *L:A: *:B: *;N;N:Q: *t:S: *;el;a~:?:?::  ;N;N:: *:}:+: :1T4DX;W/;Ve:A: *T:S: *;g ;el<::ѽ;XA];XATD:\: *;el;a;<:^: *;^;^L:`: *T:b: *:d: *:h: *:l: *:l: *4;M;E::78:w: *:|:,:{: *<:|: *;el;a@:~: *:: *:: *X:: *l;el;a;el;a:ɾE:ɾ::: *:: *t;W ;W 4:: *:: *:: *@:: *Ä:: *@:: * ;el;akŸ:: *:: *:: *<:: *x;el;a~;el;a~:B: 0:h: *h;el;a˜:i: *;el;a;M:9q̸:y: *\;el;a ͬ:k:k|:: *Ψ:<}:;;X@;Xp:: *,::9X;el;aτ:: *x:: *4DX;M;Mg4DX;el;aA4DX:9|Y4DX;el;akՈ:: *հ:: *:: *,:: *X4DX:9yD:o:B:o:B@:o:Bؠ:o":_8:o$:_:o4:D4:o4:DX::Ѷڄ:o7:r&:o=:D:o=:Ed:o=:E۸:o>:E(:o>:Et:o?:Eܬ:oI:H;hT;hQ8:o}:r"x::əߜ;n;nI;at;];at;]:o:K:o:KX:o:K:o:Kp:o:K:o:KX:o:K:o:K:o:L$:o:L:o:L:o:L:o:L:o:L :o:M0:o:M$:o:M:o:M:o:r4;n;nK:o:M:o:NL:o:Nx:o:N:o:N:o:N:o:O:o:O;hy;hh0:o:Ol:o:O8:o:O;at;]$:o:Od:o:P:o:P:o:Q4:o:Q:o:_\:o:Q :o:R@:o:Rt:o:R:o:R:o:R:o:R@:o:Rt:o:R:o:S :o:Sh:o:S:o:S:o:TH:o:T:o:T:o:T:o:_,:o:U:o:U:o:U:o:V0:o:WL:o:s:o:X:o:X:o:s}x:o:X:o:Xt:o:X:o:Y<:o:Y;hy;h :o:Y:o:Z:o:Z;h;h(:o:ZT:o:Z:o:[:o:[:o:[:o:[@:o:\l:o:_:o:\:o:\$:o:]X:o:]:o:]:o:]:o:]:o:],:o:^P:o:^t:o:^:o:_:o:_:o:_:o:`(:o:`T:o:_x:o:_:o:_z:o:`,:o:a`:o:b;h;h:o:c8:o:c\:o:c:o:c:o:ch:o:c:o:d:o:d4:o:B|:o:r):o:_$:o$:C:o):X:o1:C|:o5:D:o5:D:o6:D T:o6:D x:o7:_ :o8:D ;ht;hk :o<:D 0:oB:r$ \:oH:G ;h;hH 8:oN:H d:oP:H :oQ:H :oQ:H H:o:J t:o:J :o:J :o:J :o:J (:o:J 8:o:L d:o:L :o:N :o:N :o:N|:o:P:o:P:o:PD:o:Pp:o:P:o:_:o:Q :o:Q@:o:Qt:o:Q:o:S:o:S,:o:S`:o:S:o:T:o:T:o:T0:o:U\:o:U:o:U0:o:Ud:o:V:o:V:o:_:o:VL:o:V:o:V:o:_:o:WX:o:Wt:o:X:o:sz8:o:Xd:o:Y:o:Y:o:[(:o:[\:o:[:o:[:o:\:o:n$:o:\X:o:\:o:]:o:_|:o:^D:o:^x:o:^:o:^:o:^:o:`@:o:`t:o:a:o:a:o:a:o:aD:o:_xp:o:a:o:a:o:a:o:_vH:o:bl:o:b:o:b:o:b4:o:c:o:c:o:d$:o:B:o#:C:o':C:o':C8:o':d:o(:C:o2:C:o3:C :o;:D 4:o<:_ h:o?:E :oE:F"$:o:P"P:o:Q":o:_":o:S":o:S#:o:T#,:o:T#X:o:T#:o:W#:o:W#:o:Y$<:o:Z$`:o:_$:o:]$:o:c$:o&:C%8:o(:C%d:o1:C%:o3:C%:o@:E%:oB:F'x:oE:G':oE:G':oF:G(:oF:G(H:oG:G(|:oG:G(:oG:G(:oH:_):oH:H)D:oI:H)p:oI:H):o:W):o:W* :o:Y*X:o:Z+:o:b+X:o1:C+|:o@:E+:o@:E+:oA:E,:oA:E,<:oA:F,h:oC:F,:oC:F,:oC:F-D:oD:F-:oD:F-:oD:F-:oF:G.(:oR:I.L:o:\.:o:_.:o:_.:o:a/:C:Y/<:C:Z/h:D:Z/:E:Z/:F:Z0(:F:Z0d:F:Z0:G:Z0:G:Z0:G:Z1(;UI;U1:H:Z1:P:28;h;h72;o>;nM2;h;hF38:K:Z3d:L:Z3:L:[3:M:[4(:M:[4T:M:[5:N:[5<:N:[5;h;h5:Q:6<:R:6;h;h46:S:"7L:T: 7:T:!8;h;h84:R:[8:S:[8:S:[90:T:[9T:o:^9:p:_9:p:_:`:q:_::q:_::r:_::r:_;0:r:_;:s:_;:t:_<0:t:`;h;hC>|:a:>:w:`?8:x:`?:x:a?:y:a?:y:a@ :D:Z@@:I:Z@l:L:Z@:O:[@:T:\A:U:\B:V:\B:V:\B::B::C$;h;h:CX;h;h<C;h;h8C;h;h3C;h;h2D;h;h6DL;h;h0D;h;hEH:b:]El:c:]E:d:]FD;g;g8Fh;h;hAF;h;h=F;h;hBF;at;atG(;h;h>G\:j:^G:j:^G:k:^HP:]:Ht:n:^H:y:aH4DX:R:cW4DX:\:aW:j:^W9.X8X$9.X8XP9.X8X|9.X8X9.X8X:a:6Y9.X8Y,9.X8Y9.X8Y9.X8Z 9.X8ZH9.X8Z;VE;V![ 9.Y8[L9.Y8[9.Y8[9.Y8\9.Y8\D9.Y8\9.Y8]H9.Y 8]9.Y 8]9.Y 8^@9.Y8^d9.Y8^9.Y8=a^9m>9^9.Y8_9.Y8=b_(9.Y8_l9.Y8=b_9.Y8_9.Y8`9.Y8`t9.Y8`9.Y+8=ea9.Y88b9.Y98=eb9.Y@8bH9.YG8bl9.YG8b9.YJ8b9.YL8c 9.YO8cT9.Yg8cx9.Yh8c9.Yh8c9.Yi8c9.Yk8d 9.Yl8d|9.Yp8d9.Yq8d9.Ys8d9.Yt8e9.Yt8e<9.Yu8e`9.Yu8e9.Yv8e9.Yv8f 9.Yw8fD9.Yx8f`9.Yx8f9.Yy8f9.Yy8f9.Yz8f9.Yz8g9.Y|8gL9.Y|8g9.Y~8g:b:Vg9.Y8h9.Y8hd9.Y8h9.Y8h9.Y8i9.Y8i,9.Y8it9.Y8i9.Y8i9.Y8j:d:Vj@9mC9Djl9.Y8j9.Y8j9.Y8k,:d:Vn9mE9dn9.Y86o9.X8op9.X8o9.X8o;VG;V"p9.Y8pL9.Y 8rH9.Y8r9.Y8r9.Y$8=er9.Y:8=fs 9.YQ8s9.Yf8=jt9.Yf8=jt9.Yh8tH9.Yo8=ktT9.Yo8=ktd9.Yp8=ktp9.Yw8t9.Y8t9.Y8t9.Y98u09.YA8ul9.YF8u9.YH8=gu9.Y^8v9.Yn8=kv$9.Yr8v\9.YK8=hv;at;asv;W ;VHv:|=9wv:|=9ww0:B:Vw:|BT:|BPw:|=9ww;W :x:|=9wx,:|=9wxP;W :?x|:|=9wx;W :?x;at;asy$:|=9wyP:|=9wy:|=9wy:|=9wy:|=9wz :|=9wz:|=9wz:|=9w{:|=9w{:|=9w{:|>9w|:|>9w|\;o1;o/|:|>9w|:|>9w|:|>9w|:|>9w}(:|>9w}d:|>9w}:|> 9w}:|> 9w~L:|> 9w~:|> 9w:|> 9w`:E:V:|> 9w(:|>9wt;at;^:|>9w:|>9w:|>9w4:|>9w;el;a}:|>9w:|>9w<:|>9w|:F: :|>9wD:|>9wh:|>9w:|>9w:G:V:|>9wH;W ;W t:|>9w:|>9w:|>9w:G:V,:|>9wX:H:V:|>9w<:|>!9w:|>"9w:|>#9w:|>$9w:|>$9w:|>$9w:|>%9w:|>(9w:|>)9w<:|>)9wp:|>*9w:|>+9w(:|>+9w\:|>,9w:|>-9w:|>-9w:|>09wH;W :$:ɴ:0:|>39wT:|>49w:J:VD:|>59w\:|>69w:|>69w:|>79w:|>79w:|>;9w:|>;9w(:|><9wd:|>=9w:|>=9wL:|>>9w:|>>9w:|>?9w:|>?9w$:|>?9w:|>B9w;W :-4DX:|>E9w:|=9w:|=9w:|=9w:C:_$:|=9w`:|=9w;W :ݶ L:|=9w:|>9w:F:V:|>9w<:|>9wh:|>9wx;W :+:|>9w:|>9w:|>9w:|> 9w:|>'9w<;at;ash:=: F:|>19w:|>29w4:|>79w|:|>>9w4DX;o5;o4DX:|>G9wX4DX:|>G9w4DX:|>G9w4DX:|>I9w<4DX:|>J9MJ4DX:|>K9w4DX:|>K9w84DX:|>L9w:|=9w ;at;asD:|>9wx:|>9w:H:VP:|>%9w`:|>09w4DX:|>H9wP4DX:|>L9w:B:VH::ѻ4DX:|>H9w4DX:|>I9wX4DX:|>J9w7a82+ W07a9g2+ Xh7a92+ X7a82+ W7a82+ W7a82+ W 7a82+ W,7a82+ WH7a92+ Wt7a92+ XLhx11Lhx11Lhx11Lhx114D\1F1?"tLhx1F<1F<Lhx1FC1FB`4D\15_.}4D\15B. 4D\1)4D\15].}P4DX7땴6Ҁ4DX75xPԠ4DX7땸5|?ڼ4DX7땼664DX7땽5xH4DX75ZD4DX76O}|4DX76CLt4DX76ykN4DX75[":4DX75|?|4DX75U4DX724DX714DX75@4DX75[,4DX74pkB4DX71#4DX75[U4DX7땿5`Bh4DX76Cn4DX76x4DX75[JPX4DX73ڽ04D\1t14D\39/L 4Lhx0SG0SG @Lhx0SI0SI Lhx0SL0SK Lhx0SY0SY 8Lhx0Sk0Sk pLhx0S0SxLhx0S0S0Lhx0S0SLhx0S0SLhx0S0SLhx0S0SLhx0T0T4Lhx0T0TLhx0T0TLhx0T0T8Lhx16Z1FYPLhx16b1F^dLhx16i1FgLhx16v1Fm$Lhx0S0Sy62 7G2 &i pO T0UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$UV$C)hů+/}(24 qI) qIO:i H:5P!xrXFNL#V W ) g51R'6.L'u8kDVLŻ )/1'P6\T! k'kLί:4l:Ye/v kgЅuV!xTX XD]!\ͧ<:kmTg6'6!xСi/ADPR !x&fQsЅ!xyQ 8X\TkD/g@FŲbЄ/؆D:${Kc܌c cٛChѰ; ::5иh0:7Vf-Ge(;W،:O܌J{O c:NDcR:;)Wz?McotcRcӢ:; A:8WiM#;I^FI/K@%ibIԚLDL,9BehҰIOOR:0:k;aОu:O-ORcJ]OӢvLBIV N{gmԂ P!Lmɇ/|@<]iK b`݅^H_-NXaX{@]&*L+Өs.CUcq5{lFz꧔D]2Ӄǿ^s[EW u4,c^bu, Qf-Lr;8+'cqE a1кd2ӥ.>6/V-Wmkyk rkr2 ƿ 83PmI3缪iǺQg\MIF3^py A/_i3xm4g%MX@99z [|!Cfqw^w|=Og-yx?wwH__|skC֪n4rPѪ͐6 ?HH퐷R] X棧[@ϝ4ڏaQJ$wF9PnQ8|Lb6iᣟNNC"\hzHX$'eOce*?Wƶ ZE#W~CvHھ>tvYW `hRrom*7fD;4<fCQ8|LK-h]hůChť"`=n b8rP.ơ 6)Χɠh'6JLLΠM@PDPH ſ ˿ y 83V83Jcl3k3ghgoڐQaQ}\\MEFM}F\ꜲTTVLvVLqY$Y $ŀ,,##44*&Z&OT.OT)#`#ac 5-.5- ɅsHsH\˭\ŭtOOldo֐_xw@w`&`%-l4^4.rFrF,ǹ,ǥ4b4b/~XŸ}gfKGG ggyy&/'>&>3z^2^vjztkAAd /_/_!ui3i2xmxrm4g)4gtMLX@,X@9?9#zm[{[|!5|!CfCe[qw5qw^^ww=q=OLgydmy`?w?wwHwHE__l?|3 CC֪֪nn2.jPPݪ͐͐6 6Ӑ?x?ǘ퐶퐱RQ] ] [U棧יۑ@ۑ@Ϟϐ44ڗ瀏aQяaQ1OOJ$oJ$__FF99PvPqQQ|L|LbbDq??ᣟN5MNN//Ë#Ë$<hhzHXzHXJ'eO'eOcece*_*Wʶ W ZE#ZE#(WWrJCvCuNھNھ>>tvtuUYYW W 0йm,7m07</VWlkyk‡ rkr2C51LF^h`2"6r0x(  *t.f@v~&zRb4 4 N\d(F$"XP L$l6>,T|2H8,n&jZ \@ b@ e@ h@ p@ y@ @ @U@ U@U(UU@U'LU((hU@U@`U((hU@U _'IU j'KU v'LPU ~'J8U 'JU 'JU 'IU 'KU 'KPU 'JpU 'KU 'KU 'JU 'LU U! @=U PU# @=U 8U% @=U U' @=U PU) @=U * U+ @=U 1U- 1@=U ChU/ C@=U TU1 T@=U dU3 d@=U r0U5 r@=U  %PU7 @=U %U9 @=U %U; @=U & (U= @>U : & U? @>U  %UA @>U %UC @>U %UE @> U &?UG @>(U &@UI @>0U . 6&,XUK 6@>8U J%UM J@>@U T&UO T@>HU m&؈UQ m@>PU v%PUS v@>XU &UU @>`U J &UW @>hU %UY @>pU  &`U[ @>xU %U] @>U &U_ @>U %Ua @>U &Uc @>U !&Ue !@>U 9%Ug 9@>U  I&NXUi I@>U  U&Uk U@>U k&hUm k@>U & Uo @>U %XUq @>U %xUs @>U  %Uu @>U %Uw @>U &Uy @>U &U{ @>U  & U} @?U & U @?U 4&xU 4@?U E&U E@?U W%@U W@? U f& U f@?(U %U @?0U 'U @?8U %pU @?@U V ' U @?HU 'hU @?PU %U @?XU &OxU@?`U &U@?hU .&hU.@?pU ;&`U;@?xU J&`UJ@?U W&uUW@?U h'Uh@?U 'U@?U 'U@?U 'pU@?U &O8U@?U %U@?U &@U@?U %U@?U &'U&@?U <@&`U@@?U O%UO@?U Y& UY@?U e&Ue@?U x%Ux@?U &U@@U &HU@@U &U@@U &U@@U &U@@ U & U@@(U &U@@0U B%hU@@8U &U@@@U &U@@HU +&xU+@@PU ;&U;@@XU G&*UG@@`U X&)UX@@hU j&,Uj@@pU z&9 Uz@@xU &U@@U &<U@@U &!(U@@U &-(U@@U &=pU@@U &5xU@@U &9U@@U &/U@@U  &U @@U &8xU@@U &&4U&@@U 6&U6@@U 0B& PUB@@U U&UU@@U d&*XUd@@U t&%Ut@@U &U@AU &U@AU &9U@AU &U@AU &C(U@A U &)HU@A(U &*U @A0U &;U @A8U &U @A@U &(U@AHU  &.U @APU *&U*@AXU 5&AU5@A`U C&UC@AhU P&UP@ApU c&BUc@AxU Dr&>Ur@AU ~&U~@AU &U!@AU &7xU#@AU p&hU%@AU &pU'@AU 'U)@AU L'HU+L@AU ['HXU-[@AU q&L(U/q@AU &JU1@BU &U3@BU &U5@BU   */9BJQZbiu} $).7@HR\dkq{")1<AHSZ`gr{ &07BFPYcnu "-9DHT`mx (3@KZiv"0:CMVhw -CQags}  * 2 : @ H Q Y    1 C T d r   6 J T m v  ! 9 I U k  4 E W f .;JWh&@OYex+;GXjz &6BUdt *5CPcr~&8L[qfit2d/usr/lib/libxcurses.1/usr/lib/X11R6//libX11.2/usr/lib/pa1.1/libcl.1/usr/lib/libc.1errnoBCPCiserrnoisreclen__dld_locUP_CPU_REVISION_FPU_MODEL$ARGV$UNWIND_END__text_start_SYSTEM_ID$UNWIND_START$RECOVER_END_environ_end$RECOVER_STARTenviron__io_dedstrncpyqsorttcsetattrkilltcgetattrendpwenttoupperfwritesetpwenttolowerstrchrsigprocmaskreaddirfflush__filbufselectsysconfchdirsprintfioctlaccesstcflowrealloctimessetlocalegetpidfopen_doprnt__flsbufstrcollmallocfcntllstatsscanfgetcwdputenvfreeopengetpwnamgetpwuidstrrchrsigsetjmpsigdelsetisdigitstrcatfseeksigactionfreadatoisystemsigemptysetgetpwentgetenvexitfprintfstrcmpisupperstrncmpsleepstrncasecmpreadislowerfgetsfclosestrlenopendirsigaddsetstrcpyclosedirfilenoisprintstrcasecmpstatgetuidsiglongjmpmemsetcloseANINT$FTN_SET_ARFTN_EXP$FTN_CCOSFTN_DIVCFTN_CTOCFTN_DO_L4IOFTN_F_INQU2FTN_CSINFTN_S_RDUEFTN_S_WDUEU_dDgetFTN_DO_C8IOFTN_DO_I2IOAFTN_RTOR$FTN_COSH$FTN_AINT$FTN_CLOGLLTFTN_DO_L1IOAFTN_AMOD$IDNINTFTN_ATAN2$LLEFTN_SIGN$FTN_ITOIFTN_ISIGNFTN_E_RDUEGETARGFTN_E_WDUEFTN_S_RSFIFTN_F_REWFTN_S_WSFIFTN_ATAN$F77_INDEXFTN_S_RSFEU_EXITFTN_S_WSFEFTN_S_RSLEFTN_CABS$FTN_RTOI$FTN_ALOG10$FTN_ASIN$LGTFTN_PARSE_FMTFTN_SINH$FTN_F_OPENFTN_DO_I4IOFTN_F_CLOSLGEFTN_DO_R4IOFTN_DO_D8IOFTN_DO_R4IOAFTN_F_BACKFTN_DO_L1IOU_dDreleaseFTN_DO_CHIOFTN_DO_I4IOAFTN_F_EXITFTN_E_RSFIFTN_E_WSFIIARGCFTN_ACOS$FTN_DTOI$FTN_TANH$FTN_CEXPFTN_CSQRTFTN_E_RSFENINTFTN_E_WSFEFTN_WS_STOPFTN_E_RSLEFTN_300CHARSXTextWidthXDrawRectangleXSetBackgroundXSetClipMaskXNextEventXFreeColormapXLookupStringXSendEventXSetDashesXResizeWindowXSyncXSetFunctionXSetFontXStoreColorsXCreateWindowXSetForegroundXDrawStringXFillRectangleXGetErrorTextXChangeGCXDrawArcXCreateGCXPendingXCheckWindowEventXLoadQueryFontXClearWindowXVisualIDFromVisualXCreatePixmapXSetErrorHandlerXPutImageXAllocColorCellsXMapWindowXGetVisualInfoXDrawLinesXDrawLineXSetWMPropertiesXCloseDisplayXFillPolygonXCreateBitmapFromDataXSetFillStyleXCreateColormapXBellXDrawPointsXFreeFontXOpenDisplayXDrawSegmentsXFreePixmapXSelectInputXDrawImageStringXGetImageXFreeXCreateImageXSetLineAttributesXSetWMNameXSetClipRectanglesXStringListToTextPropertyXFreeGCtgetnumtputstgetstrtgetflagtgetenttgoto__stub_errisindexinfoisstartisbuildisaddindexiserasevsprintfisreleaseisopeniscloseisrewcurrisreadisdelcurriswrite__d_trapf2d_funfit2df2d_funcirclef2d_funellipsef2d_funmfitf2d_funpolarisationf2d_fun1dsymmetryf2d_funcalibrantf2d_fungaussianf2d_funpowderlg_x11_errorrl_newlinerl_do_lowercase_versionrl_digit_argumentrl_get_previous_historyrl_get_next_historyrl_forwardrl_backwardrl_universal_argumentrl_vi_overstrikerl_vi_overstrike_deleterl_vi_movement_moderl_rubout_rl_qsort_string_comparerl_abortrl_arrow_keysrl_backward_kill_linerl_backward_kill_wordrl_backward_wordrl_beginning_of_historyrl_beg_of_linerl_call_last_kbd_macrorl_capitalize_wordrl_char_searchrl_backward_char_searchrl_clear_screenrl_completerl_copy_backward_wordrl_copy_forward_wordrl_copy_region_to_killrl_deleterl_delete_or_show_completionsrl_delete_horizontal_spacerl_downcase_wordrl_dump_functionsrl_dump_macrosrl_dump_variablesrl_emacs_editing_moderl_end_kbd_macrorl_end_of_historyrl_end_of_linerl_exchange_point_and_markrl_rubout_or_deleterl_forward_search_historyrl_forward_wordrl_history_search_backwardrl_history_search_forwardrl_insert_commentrl_insert_completionsrl_kill_full_linerl_kill_linerl_kill_regionrl_kill_wordrl_menu_completerl_noninc_forward_searchrl_noninc_reverse_searchrl_noninc_forward_search_againrl_noninc_reverse_search_againrl_possible_completionsrl_quoted_insertrl_re_read_init_filerl_refresh_linerl_reverse_search_historyrl_revert_linerl_insertrl_set_markrl_start_kbd_macrorl_tab_insertrl_tilde_expandrl_transpose_charsrl_transpose_wordsrl_tty_statusrl_undo_commandrl_unix_line_discardrl_unix_word_ruboutrl_upcase_wordrl_yankrl_yank_last_argrl_yank_nth_argrl_yank_poprl_vi_append_eolrl_vi_append_moderl_vi_arg_digitrl_vi_back_to_indentrl_vi_bWordrl_vi_bracktyperl_vi_bwordrl_vi_change_caserl_vi_change_charrl_vi_change_torl_vi_char_searchrl_vi_columnrl_vi_completerl_vi_deleterl_vi_delete_torl_vi_eWordrl_vi_editing_moderl_vi_end_wordrl_vi_eof_mayberl_vi_ewordrl_vi_fWordrl_vi_fetch_historyrl_vi_first_printrl_vi_fwordrl_vi_goto_markrl_vi_insert_begrl_vi_insertion_moderl_vi_matchrl_vi_next_wordrl_vi_prev_wordrl_vi_putrl_vi_redorl_vi_replacerl_vi_searchrl_vi_search_againrl_vi_set_markrl_vi_substrl_vi_tilde_expandrl_vi_yank_argrl_vi_yank_torl_vi_undofilename_completion_functionparser_ifparser_endifparser_elseparser_include_rl_output_character_functionrl_signal_handlerrl_sigwinch_handlerhistory_searchhistory_search_prefixrl_deprep_terminalrl_prep_terminalrl_quote_filenamerl_redisplayrl_getcBCPCUP__ioberrno7]@ ?_;@XZ]XZ]XZ]XZ]d@"Z]> ZZ]> ZZ]9 Z8 =@Y :Z @Z@ ZZZ] ZZ @"ZY :ZZ@= ZZZ@= Z ZY :Z]ya: =]: =]  : =@4ZBu ZZZZ ZZ]ya: =]: =]  : = @4ZB ZZZM ZZY :}@4Be]yZZ5@*Z@ya AZ@ya AZ]ya A @Z@] Z]: =] y a: =4Y(ZYY8Z@] Z]: =] y a: =4Y(Z YY8Z]Y Z @*Z@YA AZ@YA AZ]YA A @ ZZmZY4 : : :@`898 t:` @A =Z 98@9?Z @? ]@? ]@?m ZA=?U @?- Z= ZA? ] ZA> > @> Z= Z> ] ZA>e z ZA>M  Z>% : ZA AA0 ] Z=!A:== Z=: Z= ] Z=e AAz Z=M  Z=% A: Z AA0 ] Z AA AA ZA<  Z<! ZA A ] ZA ]>!A=> > A=:A>q >Q!=>9 > A=7!?92 p2@` :Z: @Z 9 J4=? "2@` A  @V   @A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A  !A ˡF ! !V @ k? k?я@R! P6b@ _:( :8 :3 0:":"B!;:(@ [:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(0:(@*8 :3;:( _:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(:(=@A @*  XB77"= @ =TH!ca@H@˷!(?!(`! XHӷ 8!3 (:!8H 7( Ǹ@0=tH!ca@70HH!ca@76Hӡ!A@נ [H!(9з!(@@@H!(9HH!(9H!(9H!(9 pH!(9((H!(90H!(98H!(9@PH!(9HH!(9PH!(9XxH!(9`0H!(9hH!(9pH!(9xXH!(9H!(9H!(9H!(98H!(9H!(9H!(9`H!(9H!(9H!(9H!(9@H!(9H!(9H!(9hH!(9 Hk!? Hk!?Hk!?Hk!?!Hk!?)Hk!?1Hk!?9Hk!?AHk!?IHk!?QHk!?YHk!?aHk!?iHk!?qHk!?yHk!?Hk!?Hk!?Hk!?Hk!?Hk!?Hk!?Hk!?Hk!?Hk!?Hk!?Hk!?H!H!H!@!@:`! XH =!3HHo!=A;`r@H_7 H 873OWo7HKW? 7A !נ [!>@6KX?k7? KW?k8?KX?!k7?KW?)k8?!KX?1k7?)KW?9k8?1KX?Ak7?9KW?Ik8?AKX?Qk7?IKW?Yk8?QKX?ak7?YKW?ik8?aKX?qk7?iKW?yk8?qKX?k7?yKW?k8?KX?k7?KW?k8?KX?k7?KW?k8?KX?k7?KW?k8?KX?k7?KW?k8?KX?k7?KW?k8?Ak7?I8Q7Y8@7H@ =73o7OW7!@X@  TH!~a@H@؟!( X!(`! XH7 !3`B66"7?@J Yׄ 2 X ! 8 ?0::2?@70k?@ @B 7T  8k?785 @BK?776 K?7? K?7?70k?@ @B 7T  8k?78E @BK?776 K?7? K?7?o0k? HAjW<@   TH֗~Ht@ @(<c a@4?   t@ 6H( 6 ָc XHu@(4?   @ BB!"7  x@ 4K?O?H(`?H4@ ` (h0ӽ (4 ӽ (4 ӽ (4 o@RA@WZ@ OAcv@4?6 6  `(@OA! !OA cOAv@4?6 6 @ B6B!  B! 4O? `4`4 7 670k?@r W 7 \ 76 K?7?  775  "756  K?7?Ѵ4?.2* 12.֠ 6p.? 6F9p1^.1^N 3 3 n.=.?.+.>3N 9 51]N/0<1_N/0&J_H ^B0.0.3N3101@H=4/ 6@43n 2@0H4?.2+. @P#  0 1Kn # 1`H# 0H֢2 01Kn @X7?@֠ 6.>.?333@֠ 6 .>.?333"1`H!֠ 6 h@.0.ҵ 01jn @X7@֠ 6 .>.?3.3.3@֠ 6 .>.?3.3.3 1@H  0r@2֠ 6 .>.?3֠ 6 p.>.?3 1`H?֠ 6 .(??/b{t?du@s5=*Ŀ ;?3\0B?f>[Sr?>\no ?_@ԓ? VHe?Nu up?PmL?R>[}b?>dTߖ?iζ ?c?<Ay?gp3^?>\qȮ?|>W2s?ٌ>@{?Y:F?ܾcA3?Јel:. ?>q1&{Z?Ȱn>|Ps?ʜ$|׋?̄mbd?j>q݉3Y?Нz 'iѹ?x8H;?J>kaWT8?>(N ?`>r֜?ٌVR ?:K4rrL#7?@ZB:?8<(ݺ?mf>|Ci?lk_? /?&Zo1i?p>su*?nXxXz.s?m&*?9e=e?> 4?(?`ʒ?b>[D;?>up+-?O 9=C?>,ֶ;?-p>GIXG?`V}?x>33A7?>B6?op+#?@?>%q ?`>9K?"U?nj>eY#?U?^>p?BNv,Nt?th| o? \m6?NK?sd? >>q?>q)E?>!P|?1RS@?J=yJ?_>7?pSk6Q?~:>e'?X>?J ?>VnS?3V?!wz\,!>wz\,@ !> F& ! F&@ !TD-UU4?44?4.2*֠ 6. 8BaB1)N.(.72.82.92.&2.'2.:2.;3YN.<ݗ37N.+3N.90N.83fN.:2N2n17N`2 P0.@0.1h3(.0+.0&.080. . @ 1iN2 ]3 N  "1h3(P0.@ 0.33H@֠ 6=1.(0n@V@f@Lc??=YkjmcVeb-NcxQSJUƃmNF(Oͻ?x Rx0j{"|> F&3?!T>! F&3@ !T4@.2*1@ ր 6.?.80$ 0.V t1_N.<3.)3&X33N 6 W .:81I. .;.=1kNV 6 4/!0'3N.>3N.?3N.0./0<ן/06Hv2./!0?[zg/00&\/0=f3./!0'3N.>3N.?3N.0./0<ן/06Hv2./!0?[zg/00&\/0=f2.6 4/0'3N.>3N.?3N.0/!0<ן/106Hv2./0?g/0&\/10=f3./0'3N.>3N.?3N.0/!0<ן/106Hv2./0?g/0&\/10=f2.;U.:6`.>3N.71^. 1K..)3.1w _I1w3. 3 6?q1].3. tJ1_N R0.336`&X3.<3N .>6W.71^. 3N1K.3.3..=1w Z1w3..71] R1]3..=1w Z1w3.1] 1j. 6?!1]. ]1`H dv pjZ1_N R0.336&X3.<3N .>6W.71^. 3N1K.3.3..=1w Z1w3..71] Rׯ1]3..=1w Z1w3.1] 1j. 6>a1]. 1`H `r" 0*66?0H }0H 6/ 7m47M4"*V6Z3Z2.3 .333}.3.2. 0. 0.3Z2.3 .333}.3.3. 0.0.6Z3.Z2.3 33.3}.33. 0.X0.3.Z2.3 33.3}.32. 0.0.1 n08X0 8[0.2.33xN2.3zN3N 3N3.3.3.22n0@) Vn "?e >'nֈ (z{?),vu|:hsy?8񀽱^{kX(^h?z5=< `;S:99+8|7$}?FR9UUUUUUA 7 }1@" `1 7 ]1@" `1 71@" `1 ?Ge+?{&/e{0g?H+\a ?0Ǵ O`k?m]q? \F?H҅$%y?I<͡A@? ?? >|y??|?_|>a` ??1g?3 vr>=??t?>>`S0? ?`vۿ9gQ4?B?AA?=AA>Q\is}??V ^Ի>NXC??qq?=?R?쎕3ٿKW~a7X??Yp˼?̐?H]< X~k:B?(?XT8:U?Ϻ?kJ7b c?Ф?aa?8aaj>??h?_K?*?_A}?_A}? W\#??LxȿVlߢ>ZQzq?Ӧ?Et]F?WEt]FxO`?b?\ p?G\ p?9??ll?6ll)k??hh?6hh? b؈?ֆ?BY !d?FBY !d?:?`X?V`X?pUl??Ɉ+WYQg>`-Z?ؚ?0X2q-ϾAQm?H?UUUUUU?UUUUUUU h ??G?W? SA 1?ڜ?/9?W?yQ?D?֠R[֠R[LK??zG{TzG{p˼?ܐ?Feb?[ᕋg?z0q(/??,?Ae%H>u?t?;;?3;;?ݖl??88?388$?߰?R+x?@[ KE',?&?#J+?OQX7>.o',?r?/h?Z/? J??M,XM-åf8? ?A);a?z^52?T?sP'5?J 9\?֌-ٌ??I$I$[mm?ל4{??!x!x(?2?}p?\}=ܢ?z?/*Ka?=w/??a{?^iXGfXw%???1>Npv?N?[_u' S+c,V-wI ??.2*uc4%ʀ&R4 ..2+&u4F:.3?. 9֠ 6. /9.07.0(1YN.0?2.0>3N.0=.0;3N.08G/73[91V.337.F36N6?_9&^W֠ 6H1N2/9.0:[/(.0?1V_.082.0>3\3j 32N3Nj.06@ R0.3.0?_^3&X33N.0?.0:י:E V֠ 6R.:3.63 6@ 4?u4F& 2@0  Z.2+Җu  J Ҁ"".2+Җu Ҁ 2Ҁ *N0HNR֠ 6`.( ֠ 6(.(1h.3.3K 0$ U0 . 7=@ 0.4?!rҀ!Zb J0 .2+Җu *Ҁ R0 C09@֠ 6.(4 Ҁ W@2֠ 6.(1N0H@ P "@ b z1@@ 1@H4`J֠ 6x.?3n4 ` 1JNw.2*֠ 6 6AB.(.? R0.1HN.>2.83A&_33N.:xU.61X. .=VҖ.8Z&] 83N 1ZN.1Z.;.83zN33[@*3N6@b4?.+8u`4`b.u4@R " 2@֠ 6.( z 2@ZphB.֠ 6.?3N0H֠ 6.(.2* 6 2V"_..2+4?.2*ua4'j!4 . 22.1_. 9֠ 6# /9.0(1YN.0?.0>3N.0=3N.0;3N.08G/73[933H6X9&3.063^N/<1N.0:/(YE33:3H% 2@7֠ 6p.3N ֠ 6P.1..2*ua4$!4 . 22.1_. 9֠ 6 /9.0(1YN.0?.0>3N.0=3N.0;3N.08G/73[933H6X9&3.063^N/<1N.0:/(.072N2N2NYE33:3H# 2@7֠ 6 .?3N ֠ 6 .?1..2*ua4"R!4 . 22.1_. 9֠ 6 /9.0(1YN.0?.0>3N.0=3N.0;3N.08G/73[933H6X9&33^N/<1N37./(3x.072N2N2NYG3:3H z 2@b7֠ 6 H.?3N ֠ 6 H.?1. 2@1@H.2*. u P77֠ 6 X6@-. ֠ 6.0<3N3z.0*2n3\3hV0. 1HN6@. 4?u4 z 2@Z?9 4`2.V0. ֠ 6V. ֠ 6P.:1JN.?1N.61N.=.7.;.> X3^3vN3N2.2*֠ 6AR8@776@z]. ֠ 6.83N.63N.*3n33[ 1HN5.77. ֠ 6.83N.63N.*3v.Ⱦ2n1[2.3w. 1HN77. ֠ 6X.83N.63N.*3x.3[2n2.3w.2 1HN.2*. ֠ 6AA*.=P. 3N . 77֠ 6@@@@.=3N.83N.*3}..>33W3[2n1HN3V0. u4 " 2@.V0. .>1JN.:.;.83N.?3N.73N.6Ǜ3_33w_3N2N3n1H+\a ?0?@@B?@WGe+?.B9UUUUUU?C8CP@B# @0ApL@K<???@??@P@?@>e*{y1a@WrK)A,/ ؿVnI@َe)@waqS[]?Yt%]/nۍA?kUy<1?蟙Zӭ<4]́?3Ob^0?v^GuXO~T;?K<=z-?݅R<ePH?g.WK*@j@-gq& 7֠ 6h647699@4@Z j;""6"6&"62@V94 9&* 2U6&~29^6^ &*;"/1@ 3[N.>.:1^N .<3{N1[ 3[N3.;/33N1] 3zN3J .; 1@ ?& 3hF?& ;hF?.B9U+F|?~+,'@NN$>[?;?{&CP@B# @0ApL@?? ?x3?|?tX2?1g? 0b??Aז?`v?ҊkL?AA?m:Jc?V ?'n*?qq?~|ЎY??•R#??M+l}?NO?0p?򆼡(?ǫ ?`jc?RZV?AA?N?쎕3?̏ǚ"??'n*?H?Ϲm^>+??У$s?k?g\?aa?)Ayf??1?_A}?ӦLUiE?Lx?a^?Et]F?--?\ p?ѽX ?ll?ֆ?hh?9?BY !d?;?`X?ؚ3B[?Ɉ+W?G!?0X?#쿘L?UUUUUU?ڜ욚J??D{̏c?/9?M|?֠R[?܏ǚ"?zG{?2~?Feb?jġ??tBaև?,?_?;;?߯Xx?88?%R?R+x?r>\@?#J+?r%*?/h? -L?M,?T?A)?go?sP'5?_^p@?I$I$?10׾C?!x?y^?}p?D??3O?a{?N(??V*?[_u' ?jqV?55?Fr??a^?k朐?]>?qO;?[? h?*-&[ū?!B?kճ?bM?@L5-?AA?$u? @?.B9?7@b77@:;`:(9:& !:3 :"7?crt0: errno: ERROR couldn't open ERROR reading ERROR bad magic number/system id for ERROR bad hpux aux header for (text) (bss) (data)~/.fit2d.defWARNING: Problem inputting internal databaseV10.132V10.132FIT2D GRAPHICS WINDOW= >O? ?k>NOTE: "User escape" issued on start-up Exit from FIT2D: Bye !------------------------------------------------------------------------------V10.132V10.132~/.fit2d.defWARNING: Problem saving default valuesV10.132Subroutine F2D_GUI V0.21Subroutine F2D_GUI V0.21EXIT MENUEXIT MENU: Return to keyboard menu WELCOME TO FIT2D GUI SELECT SCIENTIFIC INTERFACE FROM GIVEN CHOICES (OR CLICK ON "HELP" FOR INFORMATION) @FIT2D: SCIENTIFIC INTERFACESnullnullEXIT FIT2DEXIT MENU!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! REQUEST TO EXIT FIT2D !!!!!! ARE YOU REALLY SURE !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! CONFIRM EXITEnter "YES" to finish FIT2D sessionClick on "YES" or "NO" CONTROL RETURNED TO KEYBOARD MENU ?HELP2-D FITTINGFILE SERIESIMAGE PROCESSING (GENERAL)KEYBOARD INTERFACE NOTE: WITHIN THE KEYBOARD MENU MANYOPERATIONS PRODUCE OUTPUT IN THE MEMORYAND "EXCHANGE" MUST BE USED TO RECOVERTHE RESULT. (THIS IS DONE AUTOMATICALLYWITHIN THE "GRAPHICAL USER INTERFACE")."EXCHANGE" IS USUALLY THE DEFAULTCOMMAND AFTER SUCH OPERATIONS. HOWEVER"SIMPLE" COMMANDS PRODUCE OUTPUT IN THECURRENT DATA ARRAY. "PLOT" OR "IMAGE"IS OFTEN THE DEFAULT COMMAND. THETABLES AT THE END OF THE REFERENCE MANUALDESCRIBE THE OUTPUT OF ALL COMMANDS ANDSHOULD BE USED WHEN THIS NOT CLEAR. CONTROL TRANSFERRED TO TERMINAL WINDOWMACROS / LOG FILEMFIT (MULTIPLE 1-D FITTING)ON-LINE CRYSTALLOGRAPHYPOWDER DIFFRACTION (2-D)SAXS / GISAXSTESTBad "status": RESET "status" ?YES: to reset "status" value, other exit programEnter YES or NO?Subroutine F2D_INP_DATASTORE V0.8 ?COLOUR_TABLEZ_SCALING_MODEZ_SCALING_MINIMUMZ_SCALING_MAXIMUMZ_SCALING_LOGCURVE_STYLE_1X_PIXEL_SIZEY_PIXEL_SIZESubroutine F2D_KEYBOARD V1.6 Subroutine F2D_KEYBOARD V1.6 bannerINPUT DATAPlease enter one of the available menu choicesEnter ? for list of menu choicesnullMain menu: ENTER COMMANDSEQUENCERESET "status"YES: to reset "status" value, other exit programEnter YES or NOWARNING: No data exists at the moment, you must "INPUT DATA" or "CREATE DATA"INPUT DATAWARNING: No data is stored in the memory at present, you must use "STORE" or use "EXCHANGE" to put data into the memorySTOREWARNING: Memory is not defined throughout active data region (ADR) you can use "REGION" or "ROI" to re-define the ADRREGIONWARNING: Memory arrays do not exist you must create them with "DIMENSIONS" (but this will destroy any stored data)DIMENSIONSWARNING: Graphics system is turned off. You must "EXIT" and restart FIT2DEXITWARNING: No variance arrays exist at the moment, you must "EXIT" and restart with error arrays definedEXITWARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGERROR: Bad "WARNING: occured during a macro. Macro automatically terminated.WARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGWARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGERROR: Bad "WARNING" occured during a sequence. Sequence terminated.WARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGINFO: Control transferred to graphics windowEXIT?HELPADDFITIANNOTATION LABELASPECT RATIOAUTOCORRELATIONEXCHANGEAXES SCALESBANNERMESSAGEBLURSMOOTHEXCHANGEBRAGGS' EQUATIONGEOMETRY (EXPERIMENT)CADDCMULTIPLYCALCULATORCALIBRATIONCALIBRATIONEXCHANGECDIVIDECHANGESCLEAR DATASYMMETRIC FUNCTIONCLOSE LOGEXITWARNING: Log file is not openOPEN LOGCMULTIPLYCADDCOLOUR TABLECOLOUR_TABLECONCATENATIONDEFINE VARIABLECONTOUR PLOTcontourx/y graphPRINT GRAPHICS8CREATE DATAGAUSSIANCURVE STYLESSET CURVE STYLESDEFINE VARIABLESYMBOLVARIABLEMACRODEDUCE FILE SEQUENCECONCATENATIONDIFFRACTION PATTERNPRINT GRAPHICSDIFFERENTIATEWARNING: Not yet implementedDIMENSIONSARRAY X DIMENSIONEnter X dimension for internal data arraysMust be within specified bounds`ARRAY Y DIMENSIONEnter Y dimension for internal data arraysMust be within specified boundsCREATE MEMORYYES is required for many operations, NO saves memoryMust enter YES or NOCREATE VARIANCE ARRAYSYES if error analysis is required, NO saves memoryMust enter YES or NOINPUT DATADISPLAY LIMITSDIVIDEpFITEND GRAPHICS FILEPRINT GRAPHICSENTROPY*INPUT DATAEXCHANGEEXITQUITCONFIRM EXITYES: to exit program, NO: to continuexEnter YES or NOINPUT DATAEXTENDLFAST IMAGEWARNING: The command "FAST IMAGE" has been removed as the normal PostScript printing is now much faster. You should not use this command and remove it from any macros.FILTERWARNING: Not yet implementedFITEXCHANGEFLIPFONTSET FONTFUJI LINEARISATIONFULL REGIONOUTPUT DATAGAUSSIANGEOMETRY (EXPERIMENT)DIFFRACTION PATTERNGRIDGUIEXITHELPHISTOGRAMEXCHANGEIMAGEEXITIMAGEI2CCONCATENATIONINFORMATIONDIMENSIONSINPUT DATAINTERNAL MEMORYLINEARISE FILMLIST VARIABLESDEFINE VARIABLELOGARITHMMACRORUN MACROMEDIAN FILTEREXCHANGEMESSAGESLEEPMOVE/ROTATEEXCHANGEMULTIPLYFITNORMALISEOUTPUT DATAOFFSET/SCALECMULTIPLYOPEN LOGWARNING: Log file is already openfit2d.logINPUT DATAOUTPUT DATAINPUT DATAPAGE POSITIONPAUSEWAITWAIT: Enter to continue: PEEPPIXEL REGIONROIPLOT DATAimageZ-SCALEPLOT DATAPOISSONIAN NOISEPOLARISATION EFFECTPOSTSCRIPT OPTIONSPRINT GRAPHICSPOWER SPECTRUMEXCHANGEPREDICTOREXCHANGEPRINT GRAPHICSEXITPUBLICATION QUALITYQUESTIONRAISE TO A POWERREBINRE-BINEXCHANGERECALLFITREFLECTEXCHANGEREGIONINPUT DATARING (ADD POWDER RING)ROTATE LUTSELECT PIXEL OPERATIONSEQUENCEEXITSET ANNOTATION STYLESET ARROW STYLESET AXES STYLESET BACKGROUND STYLESET ENUMERATION STYLESET COLOURSSET GRID STYLESET LAYOUT STYLESET TICK POSITIONSSET TITLE STYLESET X-LABEL STYLESET Y-LABEL STYLESLEEPMESSAGESPATIAL FILTERINGEXCHANGESTART MACROINPUT DATASTATISTICSCLOSE LOGSTOP MACROSEQUENCESTOREINPUT DATASUBTRACTSURFACE INTERPOLATIONINTERPOLATED SURFACEEXCHANGESYMMETRIC FUNCTIONTHRESHOLDTITLENEW TITLEEnter new titleEnter valid charactersTRANSPOSEEXCHANGEROIUN-DEFINE VARIABLEMACROUNIT CELL PARAMETERSVARIANCES DEFINITIONOUTPUT DATAV2CWEIGHTED AVERAGEOUTPUT DATAX-AXIS LABELLABEL TEXTEnter X-axis label text for graphicsEnter text or returnY-AXIS LABELLABEL TEXTEnter Y-axis label text for graphicsEnter text or returnZ-AXIS LABELLABEL TEXTEnter Z-axis (intensity) label text for graphicsEnter text or returnZ-SCALE1-D INTERPOLATIONWARNING: This option has been added as a quick fix. In the future it will be thought out more properly and the user questions and the action will change.3-D SURFACE PLOTPRINT GRAPHICSnullWARNING: Illegal command, please re-enterINPUT DATASubroutine IO_MSET_OPTIONS V0.15-dim+dim-DIM+DIMWARNING: Command line option to set program array sizes could not be decoded successfully-var+var-VAR+VAR-nogr+nogr-NOGR+NOGR-keyboard+keyboard-KEYBOARD+KEYBOARD-key+key-KEY+KEY-42WARNING: There was a problem opening the graphics output window. This may be a problem of the X-terminal not accepting graphics output from the host running FIT2D. If this is the case it can be cured by using the xhost program e.g. if FIT2D is running on system 'esrf01', then enter: xhost +esrf01 on the local machine which is being used as an X-terminal. If the problem does not seem to be linked to 'xhost' then check that the "DISPLAY" variable is properly defined. You can enter: printenv DISPLAY (for users of the "C"-shell or "T"-shell) to check the current output destination. e.g. If the X-terminal is called 'esrft1' then the "DISPLAY" variable should be set to 'esrft1:0'. To achieve this enter: setenv DISPLAY esrft1:0 GRAPHICS OUTPUT and the "GRAPHICS USER INTERFACE" are UNAVAILABLE.INFO: The graphics system has been turned off by a command line optionDIM1_DATADIM2_DATAHere you are asked to define the size of the program arrays. These willbe used to store data "inside" FIT2D. Normally you will want the arraysto be at least as large as the image data to be input. If the dimensionsare larger this does little harm, but is wasteful of system resources.If the arrays are smaller then not all of an image can be input at fullresolution. Some input options allow an image to be re-binned on inputor for a sub-region of the image to be input.X DIMENSION FOR ARRAYSMust be an integer in the defined rangeY DIMENSION FOR ARRAYSMust be an integer in the defined rangeArrays to hold estimates of data value variances may be created or not.If error propagation is to be carried out these will be needed, but theydouble the program array requirements and will make many operationsslower. Unless you are going to need error progation e.g. for weightedfitting, it is best to reply "NO".CREATE VARIANCE ARRAYSYou must enter "YES" or "NO"DIM1_DATADIM2_DATASubroutine F2D_TRAILER V0.7 ------------------------------------------------------------------------------INFO: BYE: FIT2D exited by user commandINFO: (No commercial software is used within FIT2D.) Spline surface fitting uses FITPACK, written by Paul Dierckx------------------------------------------------------------------------------Subroutine F2D_1DINTERPOLATE V0.2 Subroutine F2D_1DINTERPOLATE V0.2 Enter the relative scaling to apply at the entered scaling coordinate.This is relative to 1.0 at the reference coordinate.e.g. If you wantto increase values linearly between coordinates x=1 and x = 100, suchthat at x=100 the value is multiplied by 1.1, (and 1.0 at x=1, by alinearly proportional value inbetween) You should enter: 1, 100, 1.1to the three prompts.Enter real numberREFERENCE X-COORDINATESCALING POINT X-COORDINATERELATIVE SCALING VALUE AT SCALING COORDINATESubroutine F2D_3DSURFACE V0.8 Subroutine F2D_3DSURFACE V0.8 LINEARLINEAR: Linear (or logarithmic) image intensity scalingLOGLOG: Logarithmic (or linear) image intensity scalingFASTFAST: Fast mode updating, low resolution, few coloursNORMALNORMAL: Normal updating, resolution, and number of colours@??=A3-d surfaceINTERACTIVE 3-D VIEWERnullnullEXIT?PRINT360>2@3-d surfaceDEFAULT? ? +ROT.-ROT.2+ELEV.?-ELEV.+ZOOM?-ZOOMLEFT>LRIGHTUPDOWNSTEEPER?FLATTERANGLEC4@IôCVIEW ROTATION ANGLEEnter view rotation angle, around imageEnter valid real´BVIEW ELEVATION ANGLEEnter view elevation angleEnter valid realLOGLINEARLINEAR: Linear (or logarithmic) intensity scalingLINEARLOGLOG: Logarithmic (or linear) intensity scalingFASTNORMALNORMAL: Normal updating, resolution, and number of coloursNORMALFASTFAST: Fast mode updating, low resolution, few coloursSTYLE??Subroutine F2D_ASPECTRATIO V0.1 Enter "YES" if you want image display with automatic correct aspectratios i.e. the pixels are square. Enter "NO" to use all the availabledisplay region. This may result in non-square pixels, but may bepreferable for very non-square images.AUTOMATIC CORRECT ASPECT RATIO IMAGE DISPLAYEnter "YES" on "NO"Subroutine F2D_AUTOCORRELATION V0.1 Subroutine F2D_AUTOCORRELATION V0.1 NOTE: At present only circular autocorrelation is offered, and this is restricted to numbers of elements which are powers of two in length. This restriction may be removed in a future version.WARNING: The array sizes must be powers of two in size.CENTRE OUTPUT"YES" to move zero point to centre of outputEnter "YES" or "NO"Autocorrelation FunctionX-directionY-directionAutocorrelationSubroutine F2D_AXESSCALES V0.2 Subroutine F2D_AXESSCALES V0.2 ?Enter the axis value for the first element of the X-axis. This valuecorresponds to the axis value for the MIDDLE of the first pixel. Allaxis element values refer to the middle of the pixels. The normaldefault value is 0.5 for axes which are number 1, 2, 3, etc.1ST X-AXIS ELEMENT VALUEEnter valid real value1ST X-AXIS ELEMENT VALUEEnter valid real valueEnter the increment between axis values for the X-axis.Negative increments may be enetered, BUT they may cuaseproblems with some options which have not been designedwith negative axes in mind ! A value of 1.0 correspondsto a normal 1, 2, 3, scaling per pixel.X-AXIS ELEMENT INCREMENTEnter valid real valueX-AXIS ELEMENT INCREMENTEnter valid real valueEnter the axis value for the first element of the Y-axis. This valuecorresponds to the axis value for the MIDDLE of the first pixel. Allaxis element values refer to the middle of the pixels. The normaldefault value is 0.5 for axes which are number 1, 2, 3, etc.1ST Y-AXIS ELEMENT VALUEEnter valid real value1ST Y-AXIS ELEMENT VALUEEnter valid real valueEnter the increment between axis values for the Y-axis.Negative increments may be enetered, BUT they may cuaseproblems with some options which have not been designedwith negative axes in mind ! A value of 1.0 correspondsto a normal 1, 2, 3, scaling per pixel.Y-AXIS ELEMENT INCREMENTEnter valid real valueY-AXIS ELEMENT INCREMENTEnter valid real valueSubroutine F2D_BANNER V0.8 nullnullCONDITIONSI ACCEPTHELPDON'T ACCEPTWARNING: Problem in banner widget, bad internal error statusSubroutine F2D_BLUR V0.3 Subroutine F2D_BLUR V0.3 X BLUR SIZENumber of pixels in "top-hat" in X-directionNumber of pixels must be postiveY BLUR SIZENumber of pixels in "top-hat" in Y-directionNumber of pixels must be postiveX BLUR SIZENumber of pixels in "top-hat" in X-directionNumber of pixels must be postiveY BLUR SIZENumber of pixels in "top-hat" in Y-directionNumber of pixels must be postive?Subroutine F2D_BRAGG V0.4 D-SPACINGBragg equation sub-menu: ENTER COMMANDEnter one of the available commandsD-SPACINGC4@ITWO THETA ANGLE (Degrees)Enter two theta angle in degreesMust be valid real number@PTWO THETA ANGLEEXITQUITTWO THETA ANGLE:oIt$D-SPACING (Angstroms)Enter d-spacing in Anstroms (1 Angstrom = 0.1nm)Must be valid real numberD-SPACINGWAVELENGTH/ENERGYD-SPACING (Angstroms)Enter d-spacing in Anstroms (1 Angstrom = 0.1nm)Must be valid real numberTWO THETA ANGLE (Degrees)Enter two theta angle in degreesMust be valid real numberAF`WD-SPACINGWARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programEnter YES or NO?Subroutine F2D_CADD V0.1 Subroutine F2D_CADD V0.1 ?ADDITION CONSTANTEnter real value to add to active data regionEnter real numberSubroutine F2D_CALCULATOR V0.14Enter a value to put it onto the stack or enter an operator to performan operation on existing values on the stack. Enter ? for list ofavailable operators and commands.ENTER VALUE OR OPERATOREnter valid text+ADDITION-SUBTRACTION*MULTIPLICATION/DIVISIONNULLNULLNULLNULLWARNING: Entered text does not correspond to any of the available choices.Please enter a command from the menu.NULLWARNING: Entered command is ambiguous. Please enter more letters.NULLNULLNULL?HELPABSOLUTENot enough operands for operatorARCCOSINEACOSINEWARNING: Imaginary part of number will be ignored for this operationC4@INot enough operands for operatorARCSINEASINEWARNING: Imaginary part of number will be ignored for this operationNot enough operands for operatorARCTANGENTATANGENTWARNING: Imaginary part of number will be ignored for this operationNot enough operands for operatorADDITIONNot enough operands for operatorCLEARCOSINENot enough operands for operatorDIVISIONNot enough operands for operatorDUPLICATENot enough operands for operatorENERGYAF`WWARNING: Wavelength cannot be 0.0Not enough operands for operatorEXCHANGENot enough operands for operatorEXITQUITEXPONENTIALNot enough operands for operatorINTEGERNot enough operands for operatorLNNot enough operands for operatorLOGARITHMWARNING: Imaginary part of number will be ignored for this operationNot enough operands for operatorMAXIMUMNot enough operands for operatorMEMORYMINIMUMNot enough operands for operatorMODULUSNot enough operands for operatorMULTIPLICATIONNot enough operands for operatorNEGATIONNot enough operands for operatorPIPOPThe stack is empty !POWERNot enough operands for operatorPUSHR1R2R3R4RECALLRECIPROCAL1/X?Not enough operands for operatorREGISTERSS1Not enough operands for operatorS2Not enough operands for operatorS3Not enough operands for operatorS4Not enough operands for operatorSINENot enough operands for operatorSQRTSQUARE ROOTNot enough operands for operatorSTACKSTORENot enough operands for operatorSUBTRACTIONNot enough operands for operatorVARIABLESYMBOL#VALUEENTER VARIABLE NAMEEnter name of internal variable to defineEnter string7'ŬirWARNING: No value is definedTANGENTWARNING: Imaginary part of number will be ignored for this operationNot enough operands for operatorWAVELENGTHWARNING: Energy cannot be 0.0Not enough operands for operatorWARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programEnter YES or NO?Subroutine F2D_CALIBRATION V2.29Subroutine F2D_CALIBRATION V2.29#INPUT_FORMATNoneIMAGEQUANTHAMAMATSU PHOTONICSEzE@FAST CORRECTIONSPATIAL CORRECTIONFIND PEAKSCalibration sub-menu: ENTER COMMANDEnter one of available commands ("HELP" for help)?HELPAPPLY FLAT-FIELD COR. TO LUTNOTE: The current data array must contain a normalised "flat-field" response image.STORE LOOK-UP TABLEWARNING: The flat-field array and the distotion correction look-up table are of different sizes. Operation has NOT BEEN PERFORMED.EXITWARNING: The "flat-fielding" operation lead to values which were too large to be stored in the elements of the distortion correction look-up table.WARNING: No spatial distortion look-up table is defined, you must use "LOOK-UP TABLE(SPATIAL DISTORTION)"LOOK-UP TABLE (SPATIAL DISTORTION)CALCULATE FITTED DISTORTIONEXITWARNING: Memory arrays do not exist you must create them with "DIMENSIONS"EXITWARNING: No spatial calibration function exists present, you must "FIT GRID PEAKS"WARNING: to create a function.FIT GRID PEAKSDECAY CORRECTIONEXITDESTROY GRID PEAKSDISPLAY DISTORTIONWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSDISPLAY DISTORTIONEXITWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSEXITQUITFALSE PEAKFAST CORRECTIONEXITWARNING: Memory arrays do not exist you must create them with "DIMENSIONS"EXITWARNING: No spatial distortion look-up table is defined, you must use "LOOK-UP TABLE (SPATIAL DISTORTION)" or "LOAD LOOK-UP TABLE"LOOK-UP TABLE (SPATIAL DISTORTION)FIND PEAKSDISPLAY DISTORTIONFIT GRID PEAKSEnter required maximum AVERAGE discrepancy between the calculated peakdistortions and the values of the spline function at the correspondingpositions. Note this is the AVERAGE value and does not mean the thefunction is better fitted for some peaks and worse for others. A valuearound the estimated error in calculated peak distortion should beabout right.7'ŬDzAVERAGE FIT DISCREPANCY (PIXELS)Value must be within given range?OUTPUT SPATIAL FUNCTIONWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSFLAT-FIELD CORRECTIONEXITHELP?INVERSE DISTORTED/IDEALINFO: Distortion now defined from distorted grid to ideal gridINFO: Distortion now defined from ideal grid to distorted gridFIT GRID PEAKSWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSINPUT SPATIAL FUNCTIONSPATIAL CORRECTIONWARNING: Interpolation function coefficients have not been inputLINEARISE INTENSITIESEXITLEARN HOLE PROFILEEXITWARNING: Memory arrays do not exist you must create them with "DIMENSIONS"EXITWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSLOAD LOOK-UP TABLEFAST CORRECTIONEXITLOOK-UP TABLE (SPATIAL DISTORTION)'ŬWARNING: No spatial calibration function exists present, you must "FIT GRID"WARNING: to create a function.FIT GRID PEAKSEXITOUTPUT SPATIAL FUNCTIONWARNING: No spatial calibration function exists present, you must "FIT GRID"WARNING: to create a function.FIT GRID PEAKSEXITPLATYPUS CORRECTION FILEWARNING: This option has been temporarily removed. Please request that it be re-instated if you need it (e-mail to hammersley@esrf.fr)RE-CALCULATE DISTORTION?It$GRID SPACING (CENTRE TO CENTRE IN microns)Enter distance between adjacent peaks in micronsValue must be within given rangeEXITWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSRESIDUALS OF FITEXITWARNING: Memory arrays do not exist you must create them with "DIMENSIONS"EXITWARNING: No spatial calibration function exists present, you must "FIT GRID"WARNING: to create a function.FIT GRID PEAKSSAVE PEAKSEXITWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSSIZE (IMAGE DISPLAY)NUMBER OF PIXELSEnter number of pixels to be displayed in "FIND PEAKS" (each dimension)Enter integer with given rangeFIND PEAKSSPATIAL CORRECTIONEXITWARNING: Memory arrays do not exist you must create them with "DIMENSIONS"EXITWARNING: No spatial calibration function exists present, you must "FIT GRID"WARNING: to create a function.FIT GRID PEAKSSTORE LOOK-UP TABLEEXITWARNING: No spatial distortion look-up table is defined, you must use "LOOK-UP TABLE(SPATIAL DISTORTION)"LOOK-UP TABLE (SPATIAL DISTORTION)TRANSFER DISTORTIONEXITWARNING: Memory arrays do not exist you must create them with "DIMENSIONS"EXITWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSVIEW PEAKSEXITWARNING: No peak centres have been found you must "FIND PEAKS"FIND PEAKSXRII FLAT-FIELDEXITnullWARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programEnter YES or NO"YES" to destroy peak position and fit function arrays, and recuperateprogram memory. "NO" to save peak position and fit function arrays forlater re-use.DESTROY DYNAMIC ARRAYSEnter YES or NOSubroutine F2D_CDIV V0.1 Subroutine F2D_CDIV V0.1 DIVISION CONSTANTEnter real value to divide the active data regionEnter real numberWARNING: Not possible to divide by zero?Subroutine F2D_CMULT V0.2 Subroutine F2D_CMULT V0.2 MULTIPLICATION CONSTANTEnter real value to multiply the active data regionEnter real number?Subroutine F2D_CONCATENATION V0.4 ENTER FIRST STRINGEnter charactersEnter textENTER SECOND STRINGEnter charactersEnter text INFO: Concatenation: ENTER NAME OF VARIABLEEnter name of variable to defineEnter stringWARNING: Problem defining variable: Subroutine F2D_CREATEDATA V0.1 Subroutine F2D_CREATEDATA V0.1 X DATA SIZEEnter number of elements for data region in X-dimensionMust be within specified boundsY DATA SIZEEnter number of elements for data region in Y-dimensionMust be within specified boundsSimulated DataColumnsRowsIntensitySubroutine F2D_DIFPATTERN V0.13NOTE: The reciprocal cell angles are not defined in a standard alpha star, beta star, gamma star fashion.The diffraction pattern is that of a unit cell randomly orientatedabout a single axis i.e. a fibre pattern. The unit cell must beentered as the reciprocal space unit cell. The command "UNIT CELLPARAMETERS" may be used to convert between real space and reciprocalspace cell parameters. The orientation of the unit cell axes wrt tothe rotation (fibre) axis are defined according to a system givenin R D B Fraser and T P MacRae, "Unit cell and Molecular Connectivityin Tendon Collagen", Int. J. Biol. Macromol., Vol 3, pp 193-200, 1981. Size of A star axis in reciprocal space.BA* (INVERSE ANGSTROMS)Value must be within given rangeSize of B star axis in reciprocal space.B* (INVERSE ANGSTROMS)Value must be within given rangeSize of C star axis in reciprocal space.?C* (INVERSE ANGSTROMS)Value must be within given rangeAngle from Z-axis (fibre) to A*C4THETA A* (degrees)Value must be within given rangeAngle from Z-axis (fibre) to B*THETA B* (degrees)Value must be within given rangeAngle from Z-axis (fibre) to C*THETA C* (degrees)Value must be within given rangeAngle from X-axis (beam) to A*ôCPHI A* (degrees)Value must be within given rangeAngle from X-axis (beam) to B*PHI B* (degrees)Value must be within given rangeAngle from X-axis (beam) to C*PHI C* (degrees)Value must be within given range@IMINIMUM h indexLowest index in range of h indices to calculateValue must be within given rangeMAXIMUM h indexHighest index in range of h indices to calculateValue must be within given rangeMINIMUM k indexLowest index in range of k indices to calculateValue must be within given rangeMAXIMUM k indexHighest index in range of k indices to calculateValue must be within given rangeMINIMUM l indexLowest index in range of l indices to calculateValue must be within given rangeMAXIMUM l indexHighest index in range of l indices to calculateValue must be within given rangeOVERLAY PLOTYES for overlay, NO for basic X/Y plotValue must be within given rangePredicted Diffraction PatternX-filmY-filmHARDCOPY OUTPUTYES for saving to file, NO for no outputAnswer "YES" or "NO"Predicted Diffraction PatternX-filmY-filmINFO: Finished writing graphics fileSubroutine F2D_DISPLAYLIMITS V0.4 Enter the Maximum number of pixels to display in an image (or contourplot) in one direction. If there are more than this number of pixelsto display in either the X or the Y-direction then the image will bedisplayed with automatic rebinning of the necessary number of pixels(in each direction). The rebinning includes dividing by the number ofpixels, so the displayed range should be about the same.IMAGE: MAXIMUM PIXEL DIMENSIONEnter integer in given rangeEnter the Maximum number of pixels to display in a 3-D surfaceplot in one direction. If there are more than this number of pixelsto display in either the X or the Y-direction then the image will bedisplayed with automatic re-binning of the necessary number of pixels(in each direction). The re-binning includes dividing by the number ofpixels, so the displayed range should be about the same.3-D PLOT: MAXIMUM PIXEL DIMENSIONEnter integer in given rangeSubroutine F2D_DIVIDE V0.1 Subroutine F2D_DIVIDE V0.1 Subroutine F2D_ENTROPY V0.4 Subroutine F2D_ENTROPY V0.4 INFO: Number of pixel differences which are too large to enter@@0NOTE: This assumes 16 bit integer data values@Y 0101NOTE: This assumes 16 bit integer data valuesSubroutine F2D_EXCHANGE V0.1 Subroutine F2D_EXCHANGE V0.1 Subroutine F2D_EXTEND V0.1 Subroutine F2D_EXTEND V0.1 X-NUMBER OF PIXELSEnter size of extended data region horizontallyEnter a valid integer within given rangeY-NUMBER OF PIXELSEnter size of extended data region verticallyEnter a valid integer within given rangeX-NUMBER OF PIXELSEnter size of extended data region horizontallyEnter a valid integer within given rangeY-NUMBER OF PIXELSEnter size of extended data region verticallyEnter a valid integer within given rangeSubroutine F2D_FILESEQUENCE V0.3 ENTER NAME OF STARTING FILEEnter file nameEnter textENTER NAME OF END FILEEnter file nameEnter textERROR: Could not deduce required file sequence##PREFIX##START##END##STEP##VARIABLE##NUM_CHARS##POSTFIX##EXTENSIONSubroutine F2D_FIT V0.49Subroutine F2D_FIT V0.49INPUT PARAMETERSEnter one of available commandsFit sub-menu: ENTER COMMAND2-THETA TO RINGSINFO: Control passed to graphics windowEXITCAKEINFO: Control passed to graphics windowEXITCHANGE SCALEOPTIMISEWARNING: No fit parameters have been defined, define using INPUT PARAMETERSINPUT PARAMETERSCLEAR MASKINPUT PARAMETERSCONSTRAINOPTIMISEWARNING: No parameters; parameters must be input using INPUT PARAMETERSINPUT PARAMETERSCOVARIANCEWARNING: Not yet (re-)implementedDEFINE MASKINFO: Control passed to graphics windowOPTIMISEDISPLAY MASKOPTIMISEEXITQUITINPUT PARAMETERSResidualsOPTIMISEMASK STATISTICSDISPLAY MASKMINIMISEOPTIMISE('INFO: Elapse time = ', g14.1, ' seconds (', g12.3, ' minutes)')BpFIT MODELEXITPARAMETERS MUST BE DEFINED USING "INPUT PARAMETERS"INPUT PARAMETERSMODELFIT MODELEXITWARNING: No model parameters, they must be defined using "INPUT PARAMETERS"INPUT PARAMETERSNORMALISATIONEXITOUTPUT PARAMETERSOPTIMISEWARNING: Parameters must be defined using "INPUT PARAMETERS"INPUT PARAMETERSPOWDER DIFFRACTION?EXITR/THETA RE-BINNINGEXITRADIAL PROFILERadial ProfileEXITRESULTSEXITRESULTS MUST BE DEFINED USING "OPTIMISE"OPTIMISESET MASK COLOURDISPLAY MASKSET UPOPTIMISESILICON CALIBRATIONPOWDER DIFFRACTIONSURFACE POLYNOMIAL2-D Chebyshev Polynomial Fit modelEXITTHRESHOLD MASKINGTILT/BEAM CENTREPOWDER DIFFRACTIONTRANSFER MASK TO MEMORYEXITnullWARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programEnter YES or NOSubroutine F2D_FLIP V0.1 Subroutine F2D_FLIP V0.1 FLIP LEFT TO RIGHT ("NO" = TOP/BOTTOM)"YES" for reflection in vertical plane, "NO" for reflection in horizontal Enter real numberSubroutine F2D_FUJI V0.3 Subroutine F2D_FUJI V0.3 WARNING: User input has changed The linearisation is performed according to the formula:OUT(x, y) = 100 * (4000 / S) * 10**L( IN(x, y) / 2**b - 0.5)where L is the latitude S is the sensitivity b number of bitsThese values are given in the .inf (or .INF) file.SENSITIVITYEnter sensitivity (S in linearisation formula)Enter integer value within given range?ALATITUDEEnter latitude (L in linearisation formula)Enter real value within given rangeNUMBER OF BITSEnter number of bits (b in linearisation formula)Enter integer value within given range@EzBA Subroutine F2D_GAUSSIAN V0.1 Subroutine F2D_GAUSSIAN V0.1 @PEAK CENTRE X-COORDINATE Enter X-coordinate of centre of peakMust be valid real numberPEAK CENTRE Y-COORDINATE Enter Y-coordinate of centre of peakMust be valid real numberPEAK MAXIMUM INTENSITYEnter maximum intensity of peakMust be valid real numberC4@IôCORIENTATION OF FIRST AXISOrientation in degrees, anti-clockwise from the X-axisMust be valid real number~ɞSTANDARD DEVIATION WIDTH FOR FIRST AXISPeak width in first axis (standard deviation size)Must be valid real numberSTANDARD DEVIATION WIDTH FOR SECOND AXISPeak width in second axis (standard deviation size)Must be valid real number@?Subroutine F2D_GEOMETRY V0.8 Subroutine F2D_GEOMETRY V0.8 @>L/#zWAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLEDETECTOR_ROTATIONX_BEAM_CENTREY_BEAM_CENTREC4@IôCROTATION OFFSET ANGLE OF DETECTOR (DEGREES)Rotation angle FROM ideal X-axis (synchrotron plane) TO actual detector X-axisMust be within given range?Subroutine F2D_GUI_2DFIT V0.1 Subroutine F2D_GUI_2DFIT V0.1 2DFIT_ITERATIONSX_BEAM_CENTREY_BEAM_CENTREimageimage WELCOME TO THE 2-D FITTING INTERFACE PRESS "INPUT" TO SELECT A DATA FILE FIT2D: P-D MENUnullnullnullEXIT?CONSTRAINTSWARNING: No parameters; parameters must be input using "INITIALISE"DISPLAYEXCHANGEimageFULLHELPINITIALISEINPUTSELECT FILE TO INPUT (for fitting)(click on "HELP" for list of formats) OPTIONSimageOPTIMISEFIT MODELINFO: The fit model is stored in the "memory", use "EXCHANGE" to view the fit model.NO FIT MODEL: USE "INITIALSE"OUTPUTMASKimagePRINTRESULTSNO RESULTS DEFINE: USE "OPTIMISE"SET-UPZOOM INZ-SCALINGimageSUBTRACTMEMORY DEFINED, BUT NOT IN WHOLE OF ADRMEMORY NOT DEFINEDADDMEMORY DEFINED, BUT NOT IN WHOLE OF ADRMEMORY NOT DEFINEDDATA NEEDED, BUT NONE IS DEFINED2DFIT_ITERATIONSX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_GUI_FS V0.6 Subroutine F2D_GUI_FS V0.6 masked_image WELCOME TO THE FILE SERIES PROCESSING GUI "AVERAGE" a file series or create a "COMPOSITE" imageFIT2D: MAIN MENUnullnullEXIT?EXCHANGEAVERAGECOMPOSITEHELPINPUT (1-D)INTEGRATEOPTIONSOUTPUTDISPLAYPRINTSUMMATIONDATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_IP V0.14Subroutine F2D_GUI_IP V0.14image WELCOME TO THE GENERAL IMAGE PROCESSING GUI PRESS "INPUT" TO SELECT A FILE FIT2D: MAIN MENUnullnullEXIT?EXCHANGEFILTERFULLHELPINPUTSELECT FILE TO INPUT IMAGE DATA(click on "HELP" for list of formats)GEOMETRICMATHSMOVEMENTOPTIONSOUTPUTUN-ZOOMZOOM INDISPLAYPRINTZ-SCALINGDATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_MACROS V0.2 WELCOME TO THE MACRO / LOG FILE GUI Macros can be created with "CREATE MACRO" and "STOP MACRO" and run with "RUN SEQUENCE". A log of the session can be created with "OPEN LOG" and "CLOSE LOG" FIT2D: MACROS / LOG FILE MENUnullRUN SEQUENCEnullEXIT?HELPCLOSE LOG FILECREATE MACROOPEN LOG FILERUN MACRORUN SEQUENCESTOP MACROSubroutine F2D_GUI_MFIT V0.19Subroutine F2D_GUI_MFIT V0.19MFIT_ITERATIONS?fffF@A8MFIT_DIS_FREQUENCYMFIT_MODEL_EVOLUTIONNOTE: This menu is designed to work on data stored in horizontal rows. The "POWDER DIFFRACTION" menu NOW PRODUCES 2-THETA, RADIAL, Q-SPACE DATA IN THE X-DIRECTION. Azimuthal data is now in the Y-direction. If fitting azimuthal data the "TRANSPOSE" command should be used to convert the data to row order.imageoptimiseimage WELCOME TO THE MFIT (MULTIPLE 1-D FITTING) GUI PRESS "INPUT" TO SELECT A DATA FILE FIT2D: P-D MENUnullnullnullEXIT?CONSTRAINTSWARNING: No parameters; parameters must be input using "INITIALISE"DISPLAYEXCHANGEimageFULLHELPINITIALISEChoose row to be used to enter the initial fittingmodel parameters, by clicking on it.CLICK ON ROW TO USE FOR MODEL INITIALISATION?imageINPUTSELECT FILE TO INPUT (for fitting)(click on "HELP" for list of formats) OPTIONSimageOPTIMISEFitted ModelNO FIT MODEL: USE "INITIALSE"OUTPUTMASKimagePRINToptimiseFINISHED WRITING FILEINFO: Finished writing graphics fileRESULTSNO RESULTS DEFINE: USE "OPTIMISE"SET-UPTRANSPOSEVECTORSZOOM INZ-SCALINGimageDATA NEEDED, BUT NONE IS DEFINEDMFIT_ITERATIONSMFIT_DIS_FREQUENCYMFIT_MODEL_EVOLUTIONSubroutine F2D_GUI_PD V0.29Subroutine F2D_GUI_PD V0.29masked_imageimage WELCOME TO THE POWDER DIFFRACTION GUI PRESS "INPUT" TO SELECT A DATA FILE nullnullnullEXIT?BEAM CENTRECAKECALIBRANTCORRECTIONMEMORY DOES NOT EXISTDISPLAYEXCHANGEFULLHELPINPUTSELECT FILE TO INPUT OF IMAGE DATA(click on "HELP" for list of formats)INTEGRATEOPTIONSOUTPUTMASKPRINTTILTUN-ZOOMZOOM INZ-SCALINGDATA NEEDED, BUT NONE IS DEFINEDWAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLESubroutine F2D_GUI_SAXS V0.11Subroutine F2D_GUI_SAXS V0.11REMEMBER_ROIFORGET ROIFORGET ROI: Don't remember region of interest between input imagesREMEMBER ROIREMEMBER ROI: Remember region of interest between input imagesmasked_imageimage WELCOME TO THE POWDER DIFFRACTION GUI PRESS "INPUT" TO SELECT A DATA FILE nullnullnullEXIT?BEAM CENTRECAKEDISPLAYEXCHANGEFORGET ROIREMEMBER ROIREMEMBER ROI: Remember region of interest between input imagesFULLHELPINPUTSELECT FILE TO INPUT OF IMAGE DATA(click on "HELP" for list of formats)INTEGRATEOPTIONSOUTPUTMASKNORMALISENOT YET IMPLEMENTEDPRINTPROJECTIONREMEMBER ROIFORGET ROIFORGET ROI: Don't remember region of interest between input imagesSPHERICAL MOD1-D TRANSFORMSUN-ZOOMZOOM INZ-SCALINGMATHSDATA NEEDED, BUT NONE IS DEFINEDWAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLESubroutine F2D_GUI_SIZES V0.5 DIMENSIONS OF PROGRAM ARRAYS(need to be big enough to storeand work on data)This size form allows you to select the sizes of internalprogram arrays for storing 2-D detector and other data.Normally you will want the arrays to be at least as largeas your data, but it is possible to require arrays whichare bigger, and it is also possible to work with arrayswhich are smaller by only inputting a sub-region of thedata, or by re-binning the data on input. The "X-DIMENSION" and "Y-DIMENSION" buttons allow these number of pixels to be changed. Normally memory arrays should be created as they arenecessary for many operations, however if you need tolimit the computer memory usage, they do not need to becreated for simple display. The "MEMORY" button controls the creation of the memoryarrays, or not. Normally variance (error) propagation is not necessary.If it is required this option should be selected, but therequirements for computer memory for array space will double and mathematical operations will take twice as long.X-DIMENSIONY-DIMENSIONMEMORYVARIANCESFIRST DIMENSION OF ARRAYSSECOND DIMENSION OF ARRAYSCREATE MEMORY ARRAYSCREATE VARIANCE ARRAYSEnter number of pixels "horizontally" for arraysEnter number of pixels "vertically" for arraysEnter "YES" to be able to perform maths, etc.Enter "YES" for error propagation (slower)Subroutine F2D_GUI_TEST V0.3 Subroutine F2D_GUI_TEST V0.3 WELCOME TO THE TEST AND SIMULATION GUI FIT2D: TEST MENUnullnullnullEXIT?GAUSSIAN??Simulated DataColumnsRowsIntensityDz@BBH@DISPLAYPOISSONTRIANGLESimulated DataColumnsRowsIntensityDATA NEEDED, BUT NONE IS DEFINED?Subroutine F2D_GUI_XTALLOGRAPHY V0.28Subroutine F2D_GUI_XTALLOGRAPHY V0.28masked_image WELCOME TO ON-LINE CRYSTALLOGRAPHY GUI PRESS "INPUT" TO SELECT A FILE FIT2D: MAIN MENUnullTIME-OUT ALARM: NEW FILE DOESN'T EXIST YETAUTO INPUTAUTO INPUT: Automatically input files from a sequence?NEXT FILEnullnullnullnullEXIT?AUTO INPUTSTOP INPUTSTOP INPUT: Cancel automatic input of files from a file sequenceYou may choose to set a time-out alarm, so that if there is not anew file after a set number of seconds the alarm will notify you.This is to help spot failures in data collection. Enter "YES" to set the alarm, and the number of seconds will berequested.SET TIME-OUT ALARMEnter "YES" or "NO"Enter number of seconds between data input, prior toissuing a warning alarm.ALARM TIME-OUT (SECONDS)Enter number of secondsThe peak search algorithm may be applied automatically to eachimage on input. Enter "YES" to have automatic peak searching.Normal peaks are displayed as red crosses, and saturated peaksare displayed with yellow crosses. Yellow asterisks denoted"bad" saturated peaks.AUTO PEAK SEARCHEnter "YES" or "NO"NO FILES DEFINED: USE "INPUT" TO SELECT A FILESTOP INPUTAUTO INPUTAUTO INPUT: Automatically input files from a sequenceEXCHANGEFULLHELPINPUTSELECT FILE TO INPUT IMAGE DATA(click on "HELP" for list of formats)MASKMOVEMENTNEXT FILESET GEOMETRYPEAK SEARCHPREV FILEOPTIONSOUTPUTSORRY, NOT YET IMPLEMENTEDUN-ZOOMSPY-GLASSMove the cursor into the displayed image.The "spy-glass" will show a zoomed inregion of the image centred around thecoursor position. As the cursor moves soshould the spy-glass image.CLICK HERE TO ENDZOOM INDISPLAYPRINTZ-SCALINGDATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_HISTOGRAM V0.1 Subroutine F2D_HISTOGRAM V0.1 HISTOGRAM MINIMUM VALUEEnter minimum pixel value for calculating histogramEnter real numberHISTOGRAM MAXIMUM VALUEEnter maximum pixel value for calculating histogramEnter real numberHISTOGRAM MINIMUM VALUEEnter minimum pixel value for calculating histogramEnter real numberHISTOGRAM MAXIMUM VALUEEnter maximum pixel value for calculating histogramEnter real numberNUMBER OF HISTOGRAM BINSEnter required number of histogram binsEnter real numberNUMBER OF HISTOGRAM BINSEnter required number of histogram binsEnter real number?: Frequency HistogramPixel Values FrequencySubroutine F2D_I2C V0.4 ENTER INTEGEREnter integer value to convertEnter a valid integerVARIABLE LENGTH OUTPUTEnter whether the output should be of variable lengthEnter a valid integerENTER NUMBER OF OUTPUT CHARACTERSEnter number of characters for outputEnter a valid integerENTER VARIABLE NAMEEnter name of variable to defineEnter string0 Subroutine F2D_IMAGE V0.20Subroutine F2D_IMAGE V0.20imageFIT2D: IMAGE MENUnullnullEXIT?FAR-LEFTUN-ZOOMFULLL-TOPL-UPLEFTL-DOWNL-BOTTOMTOPUPCENTREDOWNBOTTOMR-TOPR-UPRIGHTR-DOWNR-BOTTOMOPTIONSZOOM INFAR-RIGHTDISPLAYPRINTimageFIT2D: IMAGE MENUCONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_INFORMATION V0.3 INFO: Variance arrays exist, error propagation will be performed.INFO: No variance arrays exist, (no error propagation).INFO: Current data is definedINFO: No current dataINFO: Memory definedINFO: Memory is not definedSubroutine F2D_INTERNALMEMORY V0.2 Subroutine F2D_INTERNALMEMORY V0.2 You are given the choice of saving the current active data region (ADR)or recovering a previously saved region (if one exists). Enter "YES" tosave the current ADR within internal program memory, or "NO" to recovera previously saved ADR. Note: Each time an ADR is saved the programneeds to allocate more dynamic memory, so this command should be usedwith care, and may fail if the computer system cannot allocate morememory.SAVE ACTIVE DATA REGION ("NO": TO RECOVER)Enter "YES" or "NO"WARNING: No data exists in the program array at presentEnter number of internal memory to use to store active data region.By default a new memory will be used, unless they are all being used,however each time a new memory is used more virtual memory is necessary.INTERNAL STORE NUMBEREnter integer within given rangeEnter number of internal memory to recover a previously stored activedata region.INTERNAL STORE NUMBEREnter integer within given rangeWARNING: No active data regions are presently stored internallySubroutine F2D_LINEARISE V0.2 Subroutine F2D_LINEARISE V0.2 :oIt$VALUE FOR UNIT OPTICAL DENSITYEnter data value corresponding to optical density of one (usually 128 for Daresbury scanner)Enter value within given rangeEnter the Selwyn granularity for the film being used:e.g. MOSFLM uses 3.7 for Daresbury scanned CEA film and suggests 2.5for other CEA film (old MOSFLM documentation suggests 2.3). Othervalues from Morimoto and Uyeda (Acta Cryst 16, pp. 1107, 1963):Kodirex 3.2, Kodak No Screen 2.7=A SELWYN GRANULARITYEnter value within given rangeEnter fog level in optical density units of the film being used:e.g. 0.16 for fresh CEA film, 0.30 for Kodirex, 0.20 for Kodak No Screen @FILM FOG LEVEL (OD UNITS)Enter value within given rangeEnter saturation value for data:e.g. highest reliable value, 254.0 for 0-255 microdensitometersNnk(DATA SATURATION VALUEEnter value within given rangeEnter exponent for power law of Selwyn granularity as a functionof optical density:Theoretically it should be 0.5, but empirically 0.6 is found.(0.61, for Ilford Industrial G film)GRANULARITY POWER EXPONENTEnter value within given rangeEnter area of digitilisation aperature in square micronse.g. enter 2500 for a 50*50 micron aperature?APERATURE AREAEnter value within given rangeFILM CORRECTION CONSTANTEnter correction constant (0.06 Kodak no-screen C, 0.055 Kodirex, 0.07 CEA)Enter value within given rangePSubroutine F2D_LISTVARIABLES V0.6 INFO: No program variables are presently definedINFO: Variable Names / Data Types / Variable Valuesilrs s(0) = s() = = Subroutine F2D_LOGARITHM V0.2 Subroutine F2D_LOGARITHM V0.2 B LOWER THRESHOLDLog(0) or Log(-) has been encountered. Enter value for lower thresholdEnter real valueLOWER THRESHOLDLog(0) or Log(-) has been encountered. Enter value for lower thresholdEnter real value>\Subroutine F2D_MEDIANFILTER V0.3 Subroutine F2D_MEDIANFILTER V0.3 MEDIAN FILTER X-SIZESize of filter window in X-directionEnter integer within given rangeMEDIAN FILTER Y-SIZESize of filter window in Y-directionEnter integer within given rangeMEDIAN FILTER X-SIZESize of filter window in X-directionEnter integer within given rangeMEDIAN FILTER Y-SIZESize of filter window in Y-directionEnter integer within given rangeSubroutine F2D_MESSAGE V0.1 INFO: Enter message text or user escape (\\) to exitEnter user help textEnter valid character stringSubroutine F2D_MOVE V0.11Subroutine F2D_MOVE V0.11Either the centre and angle of rotation, and the translation vectormay be specified, OR the coordinates of two input points and twooutput points may be entered. If the indirect method is chosenthe distance between the points should be equal for this to makesense. However, the distances are different this cannot be doneexactly. In this case the rotation angle will bring the twolines together, with the two lines sharing the same mid-point. "YES" to specify rotation and translation, "NO" to specify two inputcoordinates and two output coordinatesDIRECT DEFINITION TRANSLATION/ROTATIONEnter "YES" or "NO"INFO: First the data is rotated about a fixed coordinate, THEN aINFO: translation is applied. (Output in the memory)C4@IôCROTATION ANGLE (DEGREES)Angle of rotation in degrees (positive angle is anti-clockwise rotation)Enter angle within given range@X CENTRE ROTATIONX-coordinate of centre of rotationEnter real numberY CENTRE ROTATIONY-coordinate of centre of rotationEnter real numberX TRANSLATIONX-component of translation vector (data coordinates)Enter real numberY TRANSLATIONY-component of translation vector (data coordinates)Enter real numberINFO: Enter two input coordinates followed by their correspondingINFO: output coordinates from which a rotation and/or INFO: translation will be automatically calculated.INFO: If the distances between the input and output coordinatesINFO: are different the operation cannot be exact,INFO: but the vectors will be aligned with their mid-points equal.FIRST INPUT X-COORDINATEEnter X-component of first input coordinateEnter real numberFIRST INPUT Y-COORDINATEEnter Y-component of first input coordinateEnter real numberSECOND INPUT X-COORDINATEEnter X-component of second input coordinateEnter real numberSECOND INPUT Y-COORDINATEEnter Y-component of second input coordinateEnter real numberFIRST OUTPUT X-COORDINATEEnter X-component of first output coordinateEnter real numberFIRST OUTPUT Y-COORDINATEEnter Y-component of first output coordinateEnter real numberSECOND OUTPUT X-COORDINATEEnter X-component of second output coordinateEnter real numberSECOND OUTPUT Y-COORDINATEEnter Y-component of second output coordinateEnter real numberTwo different re-binning methods are available. The fastest just putsthe whole contents of each input pixel into one output pixel,depending on where the centre of the input pixel is transformed to inthe output array. For this option enter: 1. Alternatively exact area overlap calculations are applied andintensity is distributed amongst the overlapped output pixels inproportion to covered area. Previously, there was the option to sub-divide input pixels into a defined number of sub-pixels. Since the exact area re-binning takesthe same time as 2*2 sub-pixel re-binning, exact area is now used instead.SUB-PIXELS (0 = TRIANGLE RE-BINNING)Enter integer within give rangeX-MINIMUM PIXELPixel in X-direction for start of output regionEnter integer within give rangeY-MINIMUM PIXELPixel in Y-direction for start of output regionEnter integer within give rangeX-MAXIMUM PIXELPixel in X-direction for end of output regionEnter integer within give rangeY-MAXIMUM PIXELPixel in Y-direction for end of output regionEnter integer within give range?Subroutine F2D_NORMALISE V0.2 Subroutine F2D_NORMALISE V0.2 J?WARNING: The maximum value in ADR is too small (<1.0e-19) or negative to be used for normalisationSubroutine F2D_OFFSET V0.5 Subroutine F2D_OFFSET V0.5 SCALING KNOWN"YES" if the scaling between the two images is knownEnter "YES" or "NO"?SCALE FACTOREnter scale factor (current data divided by memory)Enter real numberSEPARATION LIMIT VALUEValue below which lower mean is defined, above upper meanEnter real number~ɞFIRST LOWER LIMITValue below which values are not reliable for first imageEnter real numberFIRST SATURATION VALUEValue above which values are not reliable for first imageEnter real numberSECOND LOWER LIMITValue below which values are not reliable for second imageEnter real numberSECOND SATURATION VALUEValue above which values are not reliable for second imageEnter real numberWARNING: Range contains no valuesWARNING: Not possible, try different separation valueSubroutine F2D_PEEP V0.8 Subroutine F2D_PEEP V0.8 ?5=CLICK ON IMAGE PIXELClick on pixel of interest?@P@@Subroutine F2D_PIXELREGION V0.2 Subroutine F2D_PIXELREGION V0.2 X-LOWER LIMITEnter integer to define lower X-limit of active data regionEnter integer within given rangeY-LOWER LIMITEnter integer to define lower Y-limit of active data regionEnter integer within given rangeX-UPPER LIMITEnter integer to define upper X-limit of active data regionEnter integer within given rangeY-UPPER LIMITEnter integer to define upper Y-limit of active data regionEnter integer within given rangeSubroutine F2D_POLARISATION V0.2 Subroutine F2D_POLARISATION V0.2 @>GCONTROL OF POLARISATION EFFECTPARAMETERSPOLARISATIONX PIXEL SIZEX PIXEL SIZEDISTANCEX-BEAM CENTREY-BEAM CENTREPOLARISATION FACTORSIZE OF PIXEL IN X-DIRECTION (MICRONS)SIZE OF PIXEL IN Y-DIRECTION (MICRONS)SAMPLE TO "DETECTOR" DISTANCE (MM)X-PIXEL COORDINATE OF DIRECT BEAMY-PIXEL COORDINATE OF DIRECT BEAMEnter ratio of horizontal to vertical polarisationEnter horizontal size of pixelsin micronsEnter vertical size of pixelsin micronsEnter sample to detector distance (mm)Enter X-pixel coordinate of centre of the direct beamEnter Y-pixel coordinate of centre of the direct beam?8ѷIt$=F@DzWORKING: CALCULATING POLARISATIONEFFECT ON INTENSITY VALUES??Subroutine F2D_POSTSCRIPT V0.2 WARNING: The user input may change for this optionINFO: Colour PostScript output will be producedINFO: Black and white PostScript output will be producedSubroutine F2D_POWDERRING V0.7 Subroutine F2D_POWDERRING V0.7 @C4@IBOPENING ANGLE OF DIFFRACTION RING (DEGREES)Enter 2 theta angle of diffraction ring (degrees)Must be valid real numberPEAK MAXIMUM INTENSITYEnter maximum intensity of powder diffraction ringMust be valid real number~ɞSTANDARD DEVIATION WIDTH (X-PIXELS) OF RADIAL PROFILERadial peak width of diffraction ring in pixel unitsMust be valid real number?Subroutine F2D_POWER V0.2 Subroutine F2D_POWER V0.2 ENTER POWEREnter power by which data elements are to be exponentedEnter real numberENTER POWEREnter power by which data elements are to be exponentedEnter real numberATTEMPT TO TAKE SQUARE ROOT ON ONE OR MORENEGATIVE NUMBERS. VALUES SET TO 0.0WARNING: Attempt to take square root on one or more negative numbers. values set to 0.0ATTEMPT TO DIVIDE BY ZERO.VALUES SET TO 1.7*10**38WARNING: Attempt to divide by zero. Values set to 1.7e38Subroutine F2D_POWERSPEC V0.1 Subroutine F2D_POWERSPEC V0.1 WARNING: The number of elements in the ADR in the X-direction is not a power of two, which is a requirement of the Radix-2 FFTWARNING: The number of elements in the ADR in the Y-direction is not a power of two, which is a requirement of the Radix-2 FFTPower SpectrumFrequencies (X)Frequencies (Y)PowerSubroutine F2D_PREDICTOR V0.3 Subroutine F2D_PREDICTOR V0.3 Enter choice of predictor algorithm: If x is the current pixel, and a, b,c, d are the "previous"pixels as shown: a x c b d 1: predictor = x - a 2: predictor = x - Int ( (a + b) / 2) 3: predictor = x - Int ( (a + b + c) / 3) 4: predictor = x - Int ( (a + b + c + d) / 4) 5: predictor = x - ( (a + b - c) 6: predictor = x - Int ( (3a + 3b - 2c) / 4) 7: predictor = x - Int ( (2a + 2b - c) / 3) 8: For pairs of values a and b, replace with a' = Int((a+b)/2) and b' = a - b (this is reversable) This is applied alternately horizontallly and vertically to a specified level, then the series of a' values are stored as a simple previous value differential 9: predictor = x - Int ( (a + b + 1) / 2) 10: predictor = x - Int ( (a + b + c + 1) / 3) 11: predictor = x - Int ( (a + b + c + d + 1) / 4) (All in integer arithmetic)PREDICTOR ALGORITHM TO APPLYEnter integer value within given rangePREDICTOR ALGORITHM TO APPLYEnter integer value within given rangeEnter number of times pairs of pixels should be replace with roundedmean and differencesNUMBER OF AVERAGING ITERATIONSEnter integer value within given rangeNUMBER OF AVERAGING ITERATIONSEnter integer value within given range?UUUUU\Subroutine F2D_PRINT V0.9 Subroutine F2D_PRINT V0.9 3-d lines3-d surfacebannerV*.**imagemasked_imagecontourx/y graphWARNING: Unknown type of graphics to outputFINISHED WRITING FILEINFO: Finished writing graphics filePROBLEM WRITING FILE: (SEE TERMINAL WINDOW)Subroutine F2D_QUESTION V0.9 INTEGER VALUETYPE OF DATA VALUE TO DEFINEEnter one of available data typesENTER USER PROMPT FOR VALUE INPUTEnter text to be presented to the userEnter valid character stringGRAPHICAL COORDINATEUSE GRAPHICAL USER INTERFACE"YES": to present requests through GUIEnter "YES" or "NO"GIVE USER DEFAULT VALUE"YES": to output a default value to the userEnter "YES" or "NO"INTEGER VALUEENTER DEFAULT VALUE FOR INTEGEREnter the default value to be presented to the userEnter valid integer valueREAL VALUE?@ENTER DEFAULT VALUE FOR REALEnter the default value to be presented to the userEnter valid real valueLOGICAL VALUEENTER DEFAULT VALUE FOR LOGICAL VALUEEnter the default value to be presented to the userEnter "YES" or "NO"ENTER CHARACTER STRING OR FILE NAMEEnter default character string for string or file nameEnter valid character stringINTEGER VALUEREAL VALUERESTRICT INPUT VALUE RANGE"YES": to only allow values within a defined rangeEnter "YES" or "NO"INTEGER VALUELOWER LIMIT OF RANGE FOR INTEGEREnter the lower bound for accepted inputEnter valid integer valueUPPER LIMIT OF RANGE FOR INTEGEREnter the upper bound for accepted inputEnter valid integer valueREAL VALUEENTER LOWER LIMIT OF INPUT RANGE FOR REALEnter the lower bound for accepted inputEnter valid real value~ɞENTER UPPER LIMIT OF INPUT RANGE FOR REALEnter the upper bound for accepted inputEnter valid real valueINFO: Enter help text or user escape (\\) to exitEnter user help textEnter valid character stringGRAPHICAL COORDINATEX-COORDINATE VARIABLE NAMEEnter name of variable to defineEnter stringY-COORDINATE VARIABLE NAMEEnter name of variable to defineEnter stringENTER VARIABLE NAMEEnter name of variable to defineEnter stringNOTE: !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! INTERACTIVE INPUT REQUIRED FOR THE MACRO !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!INTEGER VALUEiEnter valid integer valueEnter valid integer valueREAL VALUErEnter valid real valueEnter valid real valueLOGICAL VALUElEnter "YES" or "NO"Enter "YES" or "NO"GRAPHICAL COORDINATErINPUT FILEsOUTPUT FILEssEnter valid character stringEnter valid character stringNOTE: Macro terminated by user request.NOTE: Sequence terminated by user request.MACRO ABORTEDCONTINUING MACROGRAPHICAL COORDINATESubroutine F2D_REBIN V0.3 Subroutine F2D_REBIN V0.3 Enter number of input pixels (in the X-direction) to be rebinned(scaled) into 1 output pixel. (If whole numbers are specified for boththe X and the Y-directions the operation will be much faster.Values smaller than one make one input pixel expand to cover more thanone output pixel.=X REBIN NUMBER (NUMBER INPUT TO 1 OUTPUT)Enter value within given rangeEnter number of input pixels (in the X-direction) to be rebinnedY REBIN NUMBER (NUMBER INPUT TO 1 OUTPUT)Enter value within given rangeX REBIN NUMBER (NUMBER INPUT TO 1 OUTPUT)Enter value within given rangeEnter number of input pixels (in the X-direction) to be rebinnedY REBIN NUMBER (NUMBER INPUT TO 1 OUTPUT)Enter value within given range7'ŬX START OUTPUTX Starting pixel for outputMust be postiveY START OUTPUTY Starting pixel for outputMust be postiveX START OUTPUTX Starting pixel for outputMust be postiveY START OUTPUTY Starting pixel for outputMust be postiveX-REFERENCE POSITION FOR SCALINGEnter X-data coordinate for reference origin of scalingMust be postiveY-REFERENCE POSITION FOR SCALINGEnter Y-data coordinate for reference origin of scalingMust be postiveX-REFERENCE POSITION FOR SCALINGEnter X-data coordinate for reference origin of scalingMust be postiveY-REFERENCE POSITION FOR SCALINGEnter Y-data coordinate for reference origin of scalingMust be postiveLOWER X-LIMIT FOR OUTPUTX lower pixel limit for outputMust be postiveLOWER Y-LIMIT FOR OUTPUTY lower pixel limit for outputMust be postiveUPPER X-LIMIT FOR OUTPUTX upper pixel limit for outputMust be postiveUPPER Y-LIMIT FOR OUTPUTY upper pixel limit for outputMust be postiveLOWER X-LIMIT FOR OUTPUTX lower pixel limit for outputMust be postiveLOWER Y-LIMIT FOR OUTPUTY lower pixel limit for outputMust be postiveUPPER X-LIMIT FOR OUTPUTX upper pixel limit for outputMust be postiveUPPER Y-LIMIT FOR OUTPUTY upper pixel limit for outputMust be postive?Subroutine F2D_RECIPROCAL V0.3 "YES" to convert from real unit cell parameters to reciprocal spacecell parameters, "NO" to convert from reciprocal space cell paramtersto real space unit cell parametersREAL TO RECIPROCALEnter "YES" or "NO"A.A axis length (ANGSTROMS)Length of A axis of unit cellValue must be within given rangeB axis length (ANGSTROMS)Length of B axis of unit cellValue must be within given rangeC axis length (ANGSTROMS)Length of C axis of unit cellValue must be within given range@fALPHA (degrees)Alpha AngleValue must be within given rangeBETA (degrees)Beta AngleValue must be within given rangeGAMMA (degrees)Gamma AngleValue must be within given range@ !TD-A star axis length (Inverse ANGSTROMS)Length of A star axis of reciprocal unit cellValue must be within given rangeB star axis length (Inverse ANGSTROMS)Length of B star axis of reciprocal unit cellValue must be within given rangeC star axis length (Inverse ANGSTROMS)Length of C star axis of reciprocal unit cellValue must be within given rangeALPHA STAR (degrees)Alpha Star AngleValue must be within given rangeBETA STAR (degrees)Beta Star AngleValue must be within given rangeGAMMA STAR (degrees)Gamma Star AngleValue must be within given rangeSubroutine F2D_REFLECT V0.5 Subroutine F2D_REFLECT V0.5 REFLECTION LINEClick on two points of line of reflectionOUTPUT REGIONCONTROL FORMX-START OUTY-START OUTX-END OUTY-END OUTSTARTING PIXEL OF OUTPUT REGION (X)STARTING PIXEL OF OUTPUT REGION (Y)END PIXEL OF OUTPUT REGION (X)END PIXEL OF OUTPUT REGION (Y)Minimum pixel of output region (horizontally)Minimum pixel of output region (vertically)Maximum pixel of output region (horizontally)Maximum pixel of output region (vertically)Enter pixel limits of theoutput regionREFLECTING: Please waitX COMPONENT POINT 1X-component of first coordinate on line of reflectionEnter real numberY COMPONENT POINT 1Y-component of first coordinate on line of reflectionEnter real numberX COMPONENT POINT 2X-component of second coordinate on line of reflectionEnter real numberY COMPONENT POINT 2Y-component of second coordinate on line of reflectionEnter real numberSUB-PIXELSNumber of sub-pixels in each direction (0 = area re-binning)Enter number in rangeSubroutine F2D_ROTATELUT V0.1 Subroutine F2D_ROTATELUT V0.1 NUMBER OF LEVELS TO ROTATEEXIT-100- 50- 10- 1DEFAULT+ 1+ 10+ 50+100Subroutine F2D_SELECTPIXEL V0.4 Subroutine F2D_SELECTPIXEL V0.4 #OVERLOAD_VALUE"YES" if pixels are to be selected by a greater than comparison (exclusive),"NO" if pixels are to be selected by a lesser than comparison (exclusive).GREATER THAN COMPARISONEnter "YES" or "NO"DECISION PIXEL VALUEInput pixel value for comparisonEnter real number"YES" if the pixel values are to be multiplied by a constant, "NO" if aconstant is to be added to the selected pixels.MULTIPLICATION ("NO" = ADDITION)Enter "YES" or "NO"OPERAND VALUEInput value to multiply or add to pixel valuesEnter real numberSubroutine F2D_SEQUENCE V0.10WARNING: The "SEQUENCE" command cannot be used within a macro. (It is used to repeately run a defined macro.)The sequence is defined by an integer "loop" variable. This variable isset with an initial value, an end limit value, and a increment step for eachloop. This works in the same fashion as a Fortran "DO" loop. e.g. To simplyloop 10 times, the initial value can be set to 1, the maximum value to 10and the increment step to 1. The value of the counter at each loop through the sequence may be usedto define varying definitions of variables values e.g. file names, and thevalue of the counter can be used within the called macro. The variable ##COUNTis set to contain the current loop count value. Thus, it may be useful todefine loops starting from values other than 1, and with non-unity ornegative increment steps.LOOP COUNT START VALUEEnter a valid integerLOOP COUNT END LIMIT VALUE (INCLUSIVE)Enter a valid integerLOOP COUNT INCREMENT STEPEnter a valid integerWARNING: The entered values do not define a valid finite loop, please re-enter valid parameter values (You can enter user escape (\\) to exit this command.)INPUT MACRO FILE NAMEEnter Name of a file containing a macroUnacceptable input%!*\ BEGINNING OF EXPG_IO MACRO FILE%!*\ BEGINNING OF IO MACRO FILEWARNING: The entered file is not a valid macro file (You can enter user escape (\\) to exit this command.)WARNING: The entered file could not be opened (probably it doesn't exist) (You can enter user escape (\\) to exit this command.)Enter the total number of programs variables, whose values you want to bere-defined automatically each iteration of the sequence. (Non-changingprogram variable values can be defined before the "SEQUENCE" command usingthe "DEFINE VARIABLE" command, or may be defined here as additionalre-definable variables, but not using the dynamic capabilities.)NUMBER OF VARIABLES TO DEFINEEnter a valid integer within the given rangeENTER VARIABLE NAMEEnter name of variable to be definedUnacceptable inputsVARIABLE VALUE BASEEnter characters defining the unchanging base part of the variable valuesUnacceptable input##BLANK Enter "YES" if any variable part of the variable values is to be of afixed number of characters. Enter "NO" if minimum number of charactersis to be automatically defined.VARIABLE PART FIXED LENGTHEnter "YES" or "NO"NUMBER OF CHARACTERS IN VARIABLE PARTEnter an integer within given rangeThe loop count value can be used directly to form part of the programvariable value e.g. a file name, or some simply arithmetic may be definedto produce another integer value based on the loop count value. Enter "NO" to use the loop count value directly. Enter "YES" to allow a real valued multiplier to be multiplied with theloop count value, and a real constant added. The result is thenconverted to the nearest integer and used as part of the variable value.i.e. variable_value = loop * multiplier + constantARITHMETIC ON LOOP COUNT VALUEEnter "YES" or "NO"The loop count value is multiplied by a real multiplier and then a realconstant is added. The result is converted to the nearest integer beforebeing used to form part of the variable value. i.e. variable_integer_value = loop_value * multiplier + constant You can enter the value of the multiplier and the constant. e.g. For a loop which goes from 1 to 20, you can make a variable whichcounts down from 20 to 1 with: MULTIPLIER = -1.0, and CONSTANT = 21.0 MULTIPLIER FOR LOOP COUNT VALUEEnter a valid real valueCONSTANT TO ADD TO MODIFIED LOOP COUNT VALUEEnter a valid real valuesVARIABLE VALUE EXTENSIONEnter characters defining the unchanging extension part of the variable valuesUnacceptable input##BLANK ##COUNTWARNING: The variable value could not be constructed properlyINFO: *** END OF SEQUENCE ***Subroutine F2D_SLEEP V0.1 DzLENGTH OF PAUSE (seconds)Enter number of seconds to pauseEnter a value within the given rangeSubroutine F2D_SPATIALFILTER V0.2 Subroutine F2D_SPATIALFILTER V0.2 LOW-PASS FILTER"YES" for low-pass filtering, "NO" for high-pass filteringEnter "YES" or "NO"FILTER TYPEType 1 filters the least, type 3 the most: (4 =user defined)Enter integer within given rangeEnter real value>>==>L=9@?@-۾I%I%Subroutine F2D_STATISTICS V0.8 Subroutine F2D_STATISTICS V0.8 INFO: Statistics of Active Data Region (ADR):##MINIMUM##MAXIMUM##MEAN##MINIMUM##RMS##SIGMA##SKEWNESS##TOTALSubroutine F2D_SURFACE V0.5 Subroutine F2D_SURFACE V0.5 NOTE: The surface fitting method has been changed since Version 8.* (Previously polynomials were used, and now bi-cubic splines are used. Please examine results carefully.)INFO: Control passed to graphics windowCLICK ON COORDINATES, DEFINING THE SURFACEClick on X/Y coordinates, defining the surfaceCONTROL RETURNED TO TERMINAL WINDOW~ɞRMS CLOSENESS OF FITEnter required maximum RMS discrepancy between data and fitEnter real numberSubroutine F2D_SYMFUN V0.2 X-COORDINATE OF CIRCULAR SYMMETRYX-centre for radial profileMust be valid realY-COORDINATE OF CIRCULAR SYMMETRYY-centre for radial profileMust be valid realSubroutine F2D_THRESHOLD V0.2 Subroutine F2D_THRESHOLD V0.2 ɞ~ɞMINIMUM THRESHOLD VALUEValues below this value are set to this threshold valueEnter real value?MAXIMUM THRESHOLD VALUEValues above this value are set to this threshold valueMust be greater of equal to the lower thresholdMINIMUM THRESHOLD VALUEValues below this value are set to this threshold valueEnter real valueMAXIMUM THRESHOLD VALUEValues above this value are set to this threshold valueMust be greater of equal to the lower thresholdSubroutine F2D_TRANSPOSE V0.5 Subroutine F2D_TRANSPOSE V0.5 The operation is not possible because thesecond dimension of the work arrays is notlarge enough to contain the transposed dataWARNING: The operation is not possible because the second dimension of the work arrays is not large enough to contain the transposed X-limit of the ADRThe operation is not possible because thefirst dimension of the work arrays is notlarge enough to contain the transposed dataWARNING: The operation is not possible because the first dimension of the work arrays is not large enough to contain the transposed Y-limit of the ADRSubroutine F2D_UNDEFINE V0.3 WARNING: No variables are presently defined so you cannot "UN-DEFINE" anyENTER VARIABLE NAMEEnter name of variable to un-defineEnter stringWARNING: Requested variable is not definedSubroutine F2D_VARIANCES V0.2 Subroutine F2D_VARIANCES V0.2 MAXIMUM NON-SATURATED VALUEEnter maximum value of reliable rangeEnter real numberLOWER "POISSON" LIMIT (FOG)Enter lower limit of reliable "Poisson" rangeEnter real numberA?c7A`x>Subroutine F2D_XYGRAPH V0.4 CONTINUE"YES" for further 1-D graphs, "NO" to exitEnter "YES" or "NO"Subroutine F2D_ZSCALE V0.11Enter scaling mode for Z-axis (intensity) of 2-D data: 0 = Automatic full data range 1 = User set minimum and maximum 2 = User set minimum, but automatic maximum 3 = Automatic minimum, and user set maximum 4 = Automatic "weak diffraction peak" scalingIMAGE Z-SCALING MODEEnter integer in given rangeMINIMUM DISPLAY VALUEEnter lowest data value in display rangeEnter valid realMAXIMUM DISPLAY VALUEEnter lowest data value in display rangeEnter valid realWARNING: The minimum of the range has been set greater than or equal to theWARNING: maximum of the display range. You must reset the values.The false colour image display may use either linear intensity scaling(the default), or logarithmic intensity scaling. Here you can choosewhich to use. Enter "YES" for logarithmic scaling, "NO" for linearscaling.LOGARITHMIC IMAGE SCALINGEnter "YES" or "NO"?Z_SCALING_MODEZ_SCALING_MINIMUMZ_SCALING_MAXIMUMZ_SCALING_LOGSubroutine F2D_1DCONSTRAINTS V0.2 FIT PARAMETERS STATES:constrained (YES) or unconstrained (NO)This size form allows you to constrainor unconstrain fit model parameters. The "buttons" show the number of the parameter, whilst the text box showsthe type of model feature and parameter: GAU = Gaussian, LOR = Lorentzian,VOI = Voigtian peak. POS = Central position, MAX = Maximumpeak intensity, SD = Standard deviationwidth of a Gaussian peak or component, HWHM = Half-Width Half-Maximum ofa Lorentzian peak or component. POL = Chebyshev polynomial coefficient,followed by the order of the coefficient.?UUUUU\Subroutine F2D_1DINITIALISE V0.11Subroutine F2D_1DINITIALISE V0.11The data is only 1 column wide !If the data is a vertical column, use"TRANSPOSE" to create a 1-D rowNOTE: Unlike the program MFIT you need to click on "POLYNOMIAL" for a background polynomial, including a zero order polynomial, to be included in the fit model?ENTER MODEL FEATUREEXIT?HELPUN-ZOOMZOOM INPOLYNOMIALThe polynomial is already definedPOLYNOMIAL ORDEROrder of polynomial functionMust be within specified boundsINITIALISATION POLYNOMIAL ORDEROrder of initialisation polynomial function Must be within specified boundsFailed to fit polynomial coefficientsBH=GAUSSIANLORENTZIANVOIGTIANCLICK ON PEAK TOPPlace cursor on centre and topCLICK ON PEAK AT HALF HEIGHTPlace cursor on edge of peak at half its heightGAUSSIANLORENTZIANVOIGTIAN@GAUSSIANLORENTZIANVOIGTIAN?GAUSSIAN@_LORENTZIANVOIGTIANGAUSSIAN@@@@LORENTZIANVOIGTIAN@EXP. DECAYCLICK ON MAXIMUM AND START OF DECAYPlace cursor on decay start and maximumCLICK ON DECAY SLOPE AT HALF HEIGHTPlace cursor on decay slope at half heightSINUSOIDALCLICK ON MAXIMUM OF SINUSOIDAL FUNCTIONPlace cursor on maximum of sinusoidal functionCLICK ON ADJACENT MINIMUMPlace cursor on adjacent minimumRESIDUALS OF INTITIAL FIT MODEL?Subroutine F2D_1DTRANSFORMS V0.5 Subroutine F2D_1DTRANSFORMS V0.5 THE DATA IS NOT 1-D !CONTROL OF TRANSFORMATION TO INTENSITY VERSUS Q SPACE SCAN, OF THE FORM:[Log] I(q)**a * q**b versus [Log]q**cCoeff. aCoeff. bLOG ICoeff. cLOG Xa: POWER OF INTENSITIESb: POWER OF Q MULTIPLIED BY I(q)TAKE LOG OF I(q)**a * q**bc: POWER OF QTAKE LOG OF q**cInteger power a of I(q)**a for transformationInteger power b of I(q)**a * q**b for q tranformation"YES" to take Log of transformed intensitiesInteger power of q**c for X-axis values "YES" to take Log of transformed q values for the X-axis B`. Subroutine F2D_2DDISTORTION V0.10ɞ>It$A.@f@ !MJ?W ?W@INFO: The grid appears to be hexagonal and distortion values will be calculated on this assumption. (Something is very wrong if the grid is actually cartesian.)INFO: Average rotation (both rows and columns) = Enter required pixel X-size for calculating distortionValue must be within given range8ѷIDEAL X-PIXEL SIZE (MICRONS)57Enter required pixel Y-size for calculating distortionIDEAL Y-PIXEL SIZE (MICRONS)Enter rotation angle of grid on detectorv@vGRID ROTATION ANGLE (DEGREES)Enter number (X-direction) of hole which is considered to have zero distortionX-NUMBER OF IDEAL HOLEEnter number (Y-direction) of hole which is considered to have zero distortionY-NUMBER OF IDEAL HOLEWARNING: Specified grid position is missing from data image, please specify another peakpositionSubroutine F2D_2THETATORINGS V0.4 Subroutine F2D_2THETATORINGS V0.4 WARNING: The 2-theta scan needs to be defined in the X-direction whereas the input data appears to be defined in the Y-direction. Maybe you need to use the "TRANSPOSE" command in the keyboard interface main menu.CONTROL OF POWDER PATTERNSIMULATION FROM A 2-THETA SCANX-START PIXELY-START PIXELX-END PIXELY-END PIXELX-PIXEL SIZEY-PIXEL SIZEPOLARISATIONFACTORDISTANCEX-BEAM CENTREY-BEAM CENTRETILT PLANETILTX-PIXEL FOR START OF OUTPUT REGIONY-PIXEL FOR START OF OUTPUT REGIONX-PIXEL FOR END OF OUTPUT REGIONY-PIXEL FOR END OF OUTPUT REGIONX-PIXEL SIZE (HORIZONTAL) IN MICRONSY-PIXEL SIZE (VERTICAL) IN MICRONSAPPLY POLARISATION EFFECTPOLARISATION FACTORSAMPLE TO "DETECTOR" DISTANCE (MM)X-PIXEL COORDINATE OF DIRECT BEAMY-PIXEL COORDINATE OF DIRECT BEAMROTATION ANGLE OF PLANE OF TILT (DEGREES)TILT ANGLE OF DETECTOR (DEGREES)Enter X-pixel number for start of output regionEnter Y-pixel number for start of output regionEnter X-pixel number for end of output regionEnter Y-pixel number for end of output regionEnter size of pixel in the X-direction (horizontal) in micronsEnter size of pixel in the Y-direction (vertical) in micronsEnter "YES" to apply polarisation effectEnter ratio of horizontal to vertical polarisation ((I_h - I_v) / (I_h + I_v))Enter sample to detector distance (mm)Enter X-pixel coordinate of centre of the direct beamEnter Y-pixel coordinate of centre of the direct beamEnter rotation angle anti-clockwise from the X-axis of the plane of tilt (degrees)Enter angle of tilt of the detector in the tilt plane (degrees):oIt$?=F@DzôCC4@I´BHELP TEXT; NOT YET AVAILABLEWORKING: SIMULATING PATTERNNOTE: ORIGINAL DATA STORED IN THE MEMORY@?BX-directionY-direction?`bMSubroutine F2D_3DSTYLE V0.1 Subroutine F2D_3DSTYLE V0.1 NO LINESNO LINES: No lines drawn around the re-binned pixelsLINESLINES: Draw lines around the re-binned pixelsNO FILLNO FILL: No area filling of coloured polygonsFILLFILL: Fill areas of surface with colour or Z-coloursNO AXESNO AXES: Don't draw enumerated axes around the surfaceAXESAXES: Draw enumerated axis around the surfaceNO TOPNO TOP: Don't display upper 3-D projected imageTOP IMAGETOP IMAGE: Add 3-D projected image above 3-D surfaceNO LOWERNO LOWER: Don't display lower 3-D projected imageLOW IMAGELOW IMAGE: Add 3-D projected image below 3-D surface3-D SURFACE STYLEnullnullEXIT?HELPLIMITSMAXIMUM OUTPUT DIMENSIONEnter maximum number of pixelsEnter valid integerCOLOUR LEVELSEnter number of colour levelsEnter valid integerLINESNO LINESNO LINES: No lines drawn around the re-binned pixelsNO LINESLINESLINES: Draw lines around the re-binned pixelsFILLNO FILLNO FILL: No area filling of coloured polygonsNO FILLFILLFILL: Fill areas of surface with colour or Z-coloursAXESNO AXESNO AXES: Don't draw enumerated axes around the surfaceNO AXESAXESAXES: Draw enumerated axis around the surfaceTOP IMAGENO TOPNO TOP: Don't display lower 3-D projected imageNO TOPTOP IMAGETOP IMAGE: Add 3-D projected image above 3-D surfaceLOW IMAGENO LOWERNO LOWER: Don't display lower 3-D projected imageNO LOWERLOW IMAGELOW IMAGE: Add 3-D projected image below 3-D surfaceSubroutine F2D_ADDPOWDERRING V0.2 Subroutine F2D_ADDPOWDERRING V0.2 @@Subroutine F2D_AVERAGE V0.6 Subroutine F2D_AVERAGE V0.6 AUTOMATIC SEQUENCE INPUT STARTEDINFO: Input WARNING: File not input: ? to Subroutine F2D_AXES V0.1 Subroutine F2D_AXES V0.1 Subroutine F2D_BEAMCENTRE V0.21Subroutine F2D_BEAMCENTRE V0.21BEAM CENTRE MENUnullINPUT METHOD FOR BEAM CENTREEnter one of available choicesnull?HELPFIT 1-D PROJECTION2-D GAUSSIAN FITAVERAGED GRAPHICALELLIPSE COORDINATESGRAPHICAL COORDINATECIRCLE COORDINATESFIT 1-D PROJECTION2-D GAUSSIAN FITClick on or near to direct beam mark.So long as you are not too far from theedge of the mark the algorithm should beable to find the centre.CLICK ON DIRECT BEAM MARKREFINING BEAM CENTRE: PLEASE WAITAVERAGED GRAPHICALClick on pairs of point which are symmetric about acentre of symmetry e.g. centres of peaks. Make surethat the number of coordinates entered is even. Theaverage of the input points will be used for thebeam centre.DEFINE PAIRS OF SYMMETRIC COORDINATESELLIPSE COORDINATESClick on five or more coordinates on an ellipse, orcircle, which is centred about the beam centre. Ifmore than five coordinates are entered, the leastsquares positional error solution will be used, andan error estimate will be output.INPUT COORDINATES ON ELLIPSE (>=5)WARNING: Less than five coordinates inputDzC4@IINFO: The coordinate radial position error is totally undeterminedCIRCLE COORDINATESClick on three or more coordinates on an ellipse, orcircle, which is centred about the beam centre. Ifmore than three coordinates are entered, the leastsquares positional error solution will be used, andan error estimate will be output.INPUT CONCENTRIC COORDINATES (>=3)WARNING: Less than three coordinates inputINFO: The coordinate radial position error is totally undeterminedClick directly on the estimated position of thebeam centre.DEFINE BEAM/SYMMETRY CENTRE@KEYBOARDNO CHANGEBEAM CENTRE MENUCONTROL RETURNED TO TERMINAL WINDOWX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_CAKE V0.16Subroutine F2D_CAKE V0.16! CAKE MENU !nullnullnullEXIT?BEAM CENTREINTEGRATEEND AZIMUTHClick on a coordinate to define the endazimuth of the region to be transformed to2-theta or other scans. If you click in themessage box (yellow, therefore active), thenthe complete 360.0 of data will be used.END AZIMUTH (CLICK HERE FOR START + 360.0)@EXCHANGEFULLHELPINNER RADIUSClick on a coordinate to define the inner radiusof the "CAKE" region to be transformed. By clickingin the prompt box (yellow therefore active) the beamcentre will be used and the output scans will bedefined starting from 0.0 angle or radius in the2-theta / radial direction.INNER LIMIT (CLICK HERE FOR BEAM CENTRE)OUTER RADIUSClick on coordinate to define outer limitof "cake" region to be transformed.CLICK TO DEFINE OUTER LIMITSTART AZIMUTHClick on a coordinate to define the startingazimuth of the region to be transformed to2-theta or other scans. If you click in themessage box (yellow, therefore active), thenthe X-axis (azimuth 0.0) will be used as thestart of the region.STARTING AZIMUTH (CLICK HERE FOR 0.0)UN-ZOOMZOOM INZ-SCALINGMASKASPECT RATIOEnter "YES" if you want image display with automatic correct aspectratios i.e. the pixels are square. Enter "NO" to use all the availabledisplay region. This may result in non-square pixels, but may bepreferable for very non-square images.AUTOMATIC CORRECT ASPECT RATIO IMAGE DISPLAYEnter "YES" on "NO" THERE IS NO DATA IN THE MAIN PROGRAM ARRAY. (USE "EXCHANGE" OR "EXIT") ! CAKE MENU !CONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_CAL_DISTORTION V0.3 Subroutine F2D_CAL_DISTORTION V0.3 CALCULATE X-DISTORTIONEnter "YES" for X-distortion, "NO" for Y-distortion Value must be within given rangeWARNING: Active Data Region (ADR) extends outside valid region ofspline. Pixels outside the valid region will be ignored.INFO: The valid region of the spline correction function is:X-Distortion Spline FunctionY-Distortion Spline FunctionSubroutine F2D_CALIBRANT V0.25Subroutine F2D_CALIBRANT V0.25Select the type of calibrant sample you haveused. The choice includes the commonly usedsamples from the American National Institute ofStandards and Technology. "PARAFFIN WAX" is included since many xtall- use this for distance calibration. Howeverdon't expect high accuracy, and if onlylow angle data is available don't try torefine both wavelength and distance together.SELECT CALIBRATION SAMPLEALUMINA (Al2O3)CERIUM DIOXIDELANTHANUM HEXABORIDEPARAFFIN WAXSILICONSODIUM CHLORIDEUSER DEFINEDCALI_NUMBER_SECTIONSCALI_REJECT_OUTLIERSCALI_REJECT_LIMITCALI_FULL_INFOCALI_REFINE_BEAMCALI_REFINE_DISTANCECALI_REFINE_WAVELENGTHCALI_REFINE_TILTCALI_EXTRA_ITERATIONSCALI_REFINE_POLARISATIONCALIBRANT PATTERN REFINEMENTOF DISTANCE WAVELENGTH ETC.DISTANCEWAVELENGTHX-PIXEL SIZEY-PIXEL SIZEANGULAR SECTIONSREJECT OUTLIERSREJECT LIMITFULL INFOREFINE BEAM X/YREFINE DISTANCEREFINE WAVELENGTHREFINE TILTEXTRA ITERATIONSREFINE POLARISATIONSAMPLE TO DETECTOR DISTANCE (MM) (STARTING)WAVELENGTH (ANGSTROMS) (STARTING)SIZE OF HORIZONTAL PIXELS (MICRONS)SIZE OF VERTICAL PIXELS (MICRONS)NUMBER OF AZIMUTHAL SECTIONSREJECT OUT-LYING POSITIONS AND RE-REFINEREJECT LIMIT FROM IDEAL (STANDARD DEVIATIONS)OUTPUT FULL INFORMATIONREFINE X/Y BEAM CENTREREFINE SAMPLE TO DETECTOR DISTANCEREFINE X-RAY WAVELENGTHREFINE DETECTOR NON-ORTHOGONALITYFIT INTERMEDIATE NUMBER OF RINGSREFINE VALUE OF POLARISATION FACTOREnter approximate sample to detector distance (mm)Enter approximate X-ray wavelength (Angstroms)Enter dimension of pixels horizontally, as displayed (mm)Enter dimension of pixels vertically, as displayed (mm)Enter number of azimuthal divisions to find average ring positionsEnter "YES" to reject badly fittingpositions and re-fit without themEnter number of standard deviations from ideal before rejectionEnter "YES" to output full diagnostics information in terminal windowRefine x/y beam centreRefine sample to detector distanceRefine x-ray wavelengthRefine detector non-orthogonalityEnter "YES" to add extra partialfitting iterations for difficult problemsEnter "YES" to refine valueof the polarisation factor from the data intensitiesF@<# @BDzPIt$CALI_NUMBER_SECTIONSCALI_REJECT_OUTLIERSCALI_REJECT_LIMITCALI_FULL_INFOCALI_REFINE_BEAMCALI_REFINE_DISTANCECALI_REFINE_WAVELENGTHCALI_REFINE_TILTCALI_EXTRA_ITERATIONSCALI_REFINE_POLARISATIONALUMINA (Al2O3Click on three or more coordinates on the 1 0 -2reflection ring (the closest to the centre).LANTHANUM HEXABORIDEClick on three or more coordinates on the 100reflection ring (the closest to the centre).PARAFFIN WAXClick on three or more coordinates on the firstreflection ring (the closest to the centre).SODIUM CHLORIDEClick on three or more coordinates on the 200reflection ring (the second from the centre).Click on three or more coordinates on the 111reflection ring (the closest to the centre).If 3 or 4 coordinates are entered a circlewill fitted, otherwise an ellipse will befitted. If there are more coordinates thanfitted variables, then an estimate of thepositional error will be produced.SODIUM CHLORIDECLICK ON THE 200 (SECOND) SAMPLE RING (>=3)INPUT COORDINATES ON INNER SAMPLE RING (>=3)WARNING: Less than three coordinates inputC4@IAPARAFFIN WAXSODIUM CHLORIDECALCULATING COORDINATES ON INNER RINGINFO: Fitting ellipse to centre of gravity coordinates?L?WARNING: The calculated sample to detector distance (given the initial estimate of the wavelength) is too different from the user estimate of the wavelength. Please check the initial values of both the distance and the wavelength and alter them using the graphical entry form. Also check that you are using the correct ring.WARNING: Too poor initial values for distance and wavelengthAF`W=?CALCULATING INTEGRATED INTENSITES?>Subroutine F2D_CALIBRATE2DGRID V0.15#INPUT_FORMATNoneIMAGEQUANT>L?ff>@(QɞWARNING: The horizontal peak search vector must point to the right and the vertical peak search vector must point upwardsEnter the maximum number of pixels a search for a new peak centre maycontinue from the original predicted centre (based on previously foundpeaks). (This does not affect the searching for the starting threepeaks, but affects all other peaks).MAXIMUM PEAK SEARCH DISTANCE (PIXELS)Value must be within given rangeEnter ratio above which a new "peak" is considered to be found. Thisthe minimum ratio of maximum cross-correlation value for a new "peak"divided by the maximum cross-correlation value of the last found peak.This value is used to discriminate against noise. If this value is toolow, noise may be counted as peaks, if it is too high, then true peaksmay be discarded.?}pPEAK DETECTION RATIOValue must be within given rangeEnter standard deviation width of grid peaks in pixel units. An approximatevalue will work, but will not produce optimum estimates of the peak centresi.e. the average centre will be correct, but the variance will be higher.For the ESRF Berylium tube XRII with the copper grid a value of 2.6 is aboutoptimum. If you do not know a suitable value, then after an initial "FINDPEAKS" you may calculate an averaged peak profile at sub-pixel resolutionusing the "LEARN HOLE PROFILE" command. This will produce the averagedprofile in the memory, which may be fitted with a 2-D Gaussian within the"FIT" sub-menu.GPPEAK STANDARD DEVIATION WIDTH (PIXELS)Value must be within given rangeNUMBER OF SUB-PIXELSMore takes longer, but can give more accurate resultsValue must be within given range@INFO: Starting peaks found O.K.WARNING: Problem finding the starting peaks, please re-enterPROGRESS REPORT FREQUENCY (PEAKS)Number of peaks between progress report messagesValue must be within given rangeINFO: Starting peak search, this takes some time for big gridsIn order to calibrate the absolute pixel sizes and spatialdistortion value the distances between grid holes in thecalibration grid need to be input. At the ESRF the berylliumentrance window X-ray image intensifer / CCD detector systemsare normally calibrated with a grid with a 5000 micron spacing.The image plates are normally calibrated using a grid whichhas a grid spacing of 4000 microns, but another finer grid isavailable with a 2000 micron spacing.?It$GRID SPACING (CENTRE TO CENTRE IN microns)Value must be within given rangeWhen a mask hole is off-axis (non-orthogonal to the beam) the width ofthe mask casts a shadow which changes the apparent size and centre of thehole as recorded on the detector. This option allows this effect to bevery largely corrected, assuming that the mask is orthogonal to the beam,and that the mask hole sizes are perpendicular to the surface of the mask.CORRECT OFF-AXIS MASK VIGNETTINGValue must be within given rangeSubroutine F2D_CHEBYSHEV V0.4 Subroutine F2D_CHEBYSHEV V0.4 POLYNOMIAL X ORDEROrder of polynomial function in X-directionMust be within specified boundsPOLYNOMIAL Y ORDEROrder of polynomial function in Y-directionMust be within specified boundsINFO: 2-D Chebyshev polynomial coefficients calculatedWARNING: The polynomial could not be fitted in the X-direction owing to insufficient number of data pointsWARNING: The polynomial could not be fitted in the X-direction owing to insufficient number of data pointsSubroutine F2D_CLICK V0.10Subroutine F2D_CLICK V0.10?Q># \)\) X = Y = 2-Theta Angle (Degrees)@IC4 d = Subroutine F2D_CLINEARISE V0.8 INFO: To linearise the data it is necessary to give the name of a file which contains values of the raw intensity values together with corresponding values on the required (linearised) scale. The raw intensity values correspond the X-coordinates and the corresponding linearised intensities the Y-coordinates.Enter name of file containing non-linear and linear intensities values.Subroutine F2D_COMPOSITE V0.12Subroutine F2D_COMPOSITE V0.12@?}pCONTROL OF COMPOSITE IMAGEDISPLAY PARAMETERSSUBTRACTROINO. PER ROWRE-BIN NO.SUBTRACT BACKGROUND IMAGE FROM DATASELECT REGION OF INTERESTNUMBER OF IMAGES PER ROWFACTOR BY WHICH TO RE-BINEnter "YES" to input an imagewhich will subtracted from all the input imagesEnter "YES" to be able to zoom inon a region of interest for the composite imageEnter number of images which will be displayed on one line of the composite imageEnter the factor by which input pixels will be re-binned (in both directions)?wSELECT FILE CONTAINING BACKGROUND IMAGE(click on "HELP" for list of formats)BackgroundFILE O.K.Enter "YES" if the file is O.K.Enter "YES" or "NO"AUTOMATIC SEQUENCE INPUT STARTEDThe program arrays need to be bigger, thiswill destroy any existing data in the "memory". Enter "YES" to create new arrays.DESTROY AND CREATE BIGGER PROGRAM ARRAYSEnter "YES" or "NO"INFO: Input WARNING: File not input: to ???Subroutine F2D_CONSTRAIN V0.4 VIEWEXITContraints sub-menu: enter commandEnter one of the available commandsMODIFYLOWEST PARAMETER NUMBER TO MODIFYEnter number of lowest parameter to be modified (0 for no modification)Must be within set limitsHIGHEST PARAMETER NUMBER TO MODIFYEnter number of highest parameter to be modified (0 for no modification)Must be within set limitsCONSTRAINEDUNCONSTRAINUNCONSTRAINEDCONSTRAINCONSTRAINSETUNCONSTRAINCONSTRAIN - Constrain value to a constant valueSET - Set to new valueUNCONSTRAIN - Allow value to be varied ENTER MODIFICATIONEnter one of the avialable choicesCONSTRAINUNCONSTRAINSETENTER NEW PARAMETER VALUEEnter new value for parameterEnter valid numberVIEWLOWEST PARAMETER NUMBER TO VIEWEnter number of lowest parameter to view Must be within set limitsHIGHEST PARAMETER NUMBER TO VIEWEnter number of highest parameter to view Must be within set limitsCONSTRAINEDUNCONSTRAINED('PARAMETER NUMBER ', i3, 1x, a, 1x, a, ' Value = ', g14.5)MODIFYEXITWARNING: Unknown command, please type againSubroutine F2D_CORR_FAST V0.4 Subroutine F2D_CORR_FAST V0.4 It$#OVERLOAD_VALUEIn order to avoid over-loaded pixels being re-binned and their intensityspread out to an undetermined value, you can enter a "over-loaded" pixelvalue. All input pixels which have this value or more, will cause one ormore output pixels to be incremented by the value regardless of the normalproportional are re-binning algorithm. Thus over-loaded pixels in theoutput image can be easily identified and ignored.(This can be turned-off by entering a very large value.)~ɞOVER-LOADED PIXEL VALUEEnter a real value within given range#OVERLOAD_VALUE;NOTE: Corrected data is in the "memory" array. Use "EXCHANGE" in the main menu to transfer to the working current data array.Subroutine F2D_CORR_SPATIAL V0.12Subroutine F2D_CORR_SPATIAL V0.12It$WARNING: Active Data Region (ADR) extends outside valid region ofspline. Pixels outside the valid region will be ignored.INFO: The valid region of the spline correction function is:#OVERLOAD_VALUEIn order to avoid over-loaded pixels being re-binned and their intensityspread out to an undetermined value, you can enter a "over-loaded" pixelvalue. All input pixels which have this value or more, will cause one ormore output pixels to be incremented by the value regardless of the normalproportional are re-binning algorithm. Thus over-loaded pixels in theoutput image can be easily identified and ignored.(This can be turned-off by entering a very large value.)~ɞOVER-LOADED PIXEL VALUEEnter a real value within given range#OVERLOAD_VALUEFor efficiencies sake many rows of the distortion functions can be calculatedin one call to the NAG subroutine which performs the task. However, to storethe results extra memory is required. (The memory is allocated automaticallyfrom the machines virtual memory and is de-allocated after the spatialdistortion correction is finished and the storage is no longer necessary.)Thus, the value entered here choses a compromise between using more memoryand taking longer to calculate all the necessary distortion values. If themachine has plenty of available memory (virtual) a larger number such as 100may be more efficient. However, if the machine is short of virtual memorye.g. you have already received an error message that memory allocated hasfailed, then a smaller value will be appropriate. NOTE: Too big a number may be counter-productive as it may causeexcessive page faulting. The sign determines the type of re-binning algorithm which is applied: positive means the centre of the edges of each distortedpixel are calculated and over-lapped areas are approximated by orthogonally aligned edges. Negative means the corner positions will be calculated andstraight lines are "drawn" between the corners to provide continuousquadrilaterals. The intensity is re-binned according to the over-lappedareas of these polygons.This takes about three times longer !NUMBER OF ROWS OF DISTORTION FUNCTIONS TO CALCULATED IN A BLOCKEnter an integer within given rangeWARNING: At least 2 rows must be calculated together i.e. >= -+2NOTE: Corrected data is in the "memory" array. Use "EXCHANGE" in the main menu to transfer to the working current data array.Subroutine F2D_DECAY V0.4 The default decay correction is set up for Fuji white or blue imagingplates read out by the Molecular Dynamics 400E scanner. The decaymeasurements were taken during the ESRF Experimental Hall summer mode operation. For another scanner, another type of imaging plate, or fordata taken at a different temperature you may want to re-define theconstants used to calculate the decay correction.Enter "YES" if you want to define different decay fit constants orscanner delay and read-out times.FULL USER CONTROLEnter "YES" or "NO"The decay is approximated by the sum of two exponential decays. Thefraction of remaining signal t seconds after exposure F_t is defined by: F_t = P_fast * Exp(-t/T_fast)+ (1.0 - P_fast) * Exp(-t/T_slow)where: P_fast is the proportion of the fast decay component T_fast is the time constant of the fast decay (in seconds) T_slow is the time constant of the slow decay (in seconds)Enter proportion that the fast decay makes to the intensity decay (P_fast)?PROPORTION FAST DECAYMust be a valid real number within the given rangeEnter time constant (in seconds) of the fast decay process (T_fast)PTIME CONSTANT OF FAST DECAY (SECONDS)Must be a valid real number within the given rangeEnter time constant (in seconds) of the slow decay process (T_slow)TIME CONSTANT OF SLOW DECAY (SECONDS)Must be a valid real number within the given rangeThe program calculates for each line in the image the average decay thathas taken place from the longest time from first exposure to the scan,to the shortest time from the end of the exposure to the scan. To knowthis it needs to know how long was the exposure, the time between theexposure and the user start of the scan (both these questions are askedlater), the time from the user start of the scan (click with with the mouse, or similar) to the physical scan of the first line of the image,and the time to scan each line of the image. The time to scan each lineis calculated from the total time of the physical scan divided by thenumber of scanned lines.Enter the number of seconds between the user request for the scan andthe actual start of scanning the first line in the imageDzSTART-UP TIME (SECONDS)Must be valid real number within given rangeEnter the number of seconds it takes to scan the imageEaIMAGE SCAN TIME (SECONDS)Must be valid real number within given rangeEnter the number of lines scanned in the time entered aboveNUMBER OF SCANNED LINESMust be valid integer number within given range176 MICRON SCAN ("NO" FOR 88 MICRON)Enter scan resolution mode: "YES" for 176 micron, "NO" for 88 micronEnter "YES" or "NO"=>xEXPOSURE LENGTH (SECONDS)Enter the length of the exposure in secondsMust be valid real numberEnter the time in seconds between the end of the exposure and the timethat the scan was started (the scan button was pressed on thecomputer). (The program knows the delay time between the button beingpressed and the physical start of the laser scan on the image plateELAPSE TIME (FROM END OF EXPOSURE TO SCAN, SECONDS)Must be valid real numberSubroutine F2D_DESTROYPEAKS V0.1 Subroutine F2D_DESTROYPEAKS V0.1 X-PEAK NUMBER TO DESTROY (0 to exit)Enter X-peak number to see it's positionValue must be within given rangeY-PEAK NUMBER TO DESTROYEnter Y-peak number to see it's positionValue must be within given rangeɞDESTROY PEAKEnter "YES" to destroy the peak, "NO" to leave itValue must be within given rangeINFO: Peak is missingSubroutine F2D_DIFFRACTION V0.8 PSubroutine F2D_DISPLAY2DDISTORTION V0.2 Subroutine F2D_DISPLAY2DDISTORTION V0.2 DISPLAY X-DISTORTIONEnter "YES" for X-distortion, "NO" for Y-distortion Value must be within given range2-D X-DistortionHorizontal PeaksVertical PeaksX-Distortion in pixels (Ideal - Measured)2-D Y-DistortionHorizontal PeaksVertical PeaksY-Distortion in pixels (Ideal - Measured)Subroutine F2D_DISPLAY V0.19Subroutine F2D_DISPLAY V0.19imageimageimageFIT2D: IMAGE: DISPLAY MENUnullnullEXIT?ARC SLICECONTOUR PLOTcontourx/y graphDISTANCEHELPNUMBERSPIXEL (X/Y)PROJECTIONSATURATEDSLICESTATISTICS3-D SURFACE3-D LINES3-d linesPRINTSubroutine F2D_DIST2MEM V0.1 Subroutine F2D_DIST2MEM V0.1 STORE X-DISTORTION IN MEMORYEnter "YES" for X-distortion, "NO" for Y-distortion Enter "YES" or "NO"2-D X-DistortionX-Distortion in pixels (Ideal - Measured)2-D Y-DistortionY-Distortion in pixels (Ideal - Measured)Horizontal Grid HolesVertical Grid HolesSubroutine F2D_DRAW_BANNER V0.13??5>>p>>33BH?=@@@@?ff@ ?A@AA ==?&ff? >ffCopyright 1987-2001 Andy Hammersley / ESRFUse of FIT2D implies acceptance ofthe " Conditions of Use "(Click on "CONDITIONS")(See Reference Manual)@`NO TITLENO TITLE?>Subroutine F2D_DRAW_PEAKS V0.2 Subroutine F2D_DRAW_PEAKS V0.2 ?Subroutine F2D_FALSEPEAK V0.1 Click on peak next to false peak to createClick on centre of peak next to false peak?Click on peak away from false peak positionClick on peak away from false peak positionClick on backgroundClick on background@???Subroutine F2D_FEATURE V0.6 @Subroutine F2D_FEATURE V0.6 @?zGdSubroutine F2D_FIT2DGRID V0.12Subroutine F2D_FIT2DGRID V0.12INFO: Fitting X-Distortion 57WARNING: Spline fit to X-distortion function failed: Too many spline knots required. Required RMS discrepency too small Invalid calling arguments Work space not big enoughINFO: An interpolating spline has been calculated for the X-distortionINFO: A weighted least-squares polynomial has been calculated for the X-distortionINFO: A minimum norm least-squares spline from a (numerically) rank deficient system has been calculated for the X-distortionINFO: X-Distortion SplineINFO: Fitting Y-Distortion WARNING: Spline fit to Y-distortion function failed Too many spline knots required. Required RMS discrepency too small Invalid calling arguments Work space not big enoughINFO: An interpolating spline has been calculated for the Y-distortionINFO: A weighted least-squares polynomial has been calculated for the Y-distortionINFO: A minimum norm least-squares spline from a (numerically) rank deficient system has been calculated for the Y-distortionINFO: Y-Distortion Splineɞ?Subroutine F2D_FLATFIELD V0.13>@ERROR: No enough virtual memory for operationINFO: You are required to input a file which contains a list of angles in degrees and intensity values, for the emission of the flood- field source as a function of angle. This will be used to correct the "flood-field" image to a "flat-field" image. Normally, the angles will vary from slightly above 0.0 to 30 degrees or so. Zero degrees is generally missing because of the beam-stop. You are advised not to input values which were behind the beam-stop, as this is likely to cause a dis-continuity in the data. This dis- continuity would cause problems with the fitting and interpolation of the data. (Previous, various options were available to treat such scan data here. These have been removed, but the same facilities are available in the main menu.)Enter name of file containing 1-D 2-theta scan of sourceFLAT-FIELD CENTRE X-COORDINATE Enter X-coordinate of centre flat-field measurementMust be valid real numberFLAT-FIELD CENTRE Y-COORDINATE Enter Y-coordinate of centre of flat-field measurementMust be valid real numberNOTE: !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!NOTE: UNITS OF SAMPLE DETECTOR DISTANCE HAVE CHANGED TO MILLIMETRESNOTE: !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!Dz:oIt$SAMPLE: DETECTOR DISTANCE (MILLIMETRES)Enter distance from centre of sample to detector (millimetres)Must be valid real numberF@PIXEL X-SIZE (MICRONS)Enter X-size of one pixel in microns Must be valid real number57PIXEL Y-SIZE (MICRONS)Enter Y-size of one pixel in microns Must be valid real numberEnter fractional absorption; to be used to calculate off-axis absorptioncorrection. If no off-axis correction is required enter 0.0. Ifoff-axis correction is required enter the on-axis axis absorption as afraction e.g. If the transmission is 80% enter 0.2 for the absorption.?ON-AXIS ABSORPTION (FOR OFF-AXIS CORRECTION)Must be valid real numberNOTE: Corrected flat-field is in the current data array (don't EXCHANGE)?Subroutine F2D_FSINPUT V0.3 Subroutine F2D_FSINPUT V0.3 ENTER NUMBER OF ROW TO INPUTYou can choose to input one row within the given rangeNumber must be within given rangeINPUTTING FILE:INFO: Input WARNING: File not input: Scan NumberSubroutine F2D_FSINTEGRATE V0.11Subroutine F2D_FSINTEGRATE V0.11#OVERLOAD_VALUEGPFF_CORRECTIONFF_FILEFF_SCALEFF_SCALERSD_CORRECTIONSD_FILEFS_INT_SAVE_1DFS_INT_SAVE_EXTFF_CORRECTIONFF_FILEFF_SCALEFF_SCALERSD_CORRECTIONSD_FILEPROBLEM ALLOCATING MEMORY FOR FLAT-FIELD IMAGEINPUT OF FLAT-FIELD IMAGE?INFO: Input of flat-field imageSELECT FLAT FIELD FILE(click on "HELP" for list of formats)PROBLEM INPUTTING THE FLAT-FIELD IMAGETHE FLAT-FIELD IMAGE IS THE WRONG SIZECALCULATING SCALED INVERSE OF FLAT-FIELDTHE FLAT-FIELD CONTAINED ONE OR MORE ZEROS:oP}QMAXIMUM MULTIPLER FOR FLAT-FIELD CORRECTIONEnter maximum value to increase intensityEnter real number within given rangeINFO: Applying flat-field correctionSPATIAL DISTORTION: MEMORY ALLOCATION FAILEDPROBLEM WITH SPATIAL DISTORTION FILE1ST IMAGE: CORRECTING SPATIAL DISTORTIONINFO: 1st image: Spatial distortion correctionINFO: The "MASK" menu allows you to mask out bad pixels and regions, and to zoom in on a sub-region, if required.THE MASKING MENU WILL NOWAPPEAR. YOU CAN ZOOM IN ON ASUB-REGION AND MASK BAD DATA. CLICK EXIT WHEN FINISHED @SCAN_TYPEMAXIMUM_DSCAN_TYPEMAXIMUM_DSAVE EACH INTEGRATED SCAN TO FILE"YES", to save scans in output filesClick "YES" or "NO"FS_INT_SAVE_1D1-D SCAN OUTPUT FILE EXTENSIONChoose file extension for output files for 1-D scansEnter short character stringFS_INT_SAVE_EXTPROBLEM IN FORM INPUTINTEGRATION WORK ARRAY: MEMORY ALLOCATION FAILEDOUTPUT SCANS WORK ARRAY: MEMORY ALLOCATION FAILEDAUTOMATIC SEQUENCE INPUT STARTEDINPUTTING FILE:INFO: Input INFO: Applying flat-field correctionCORRECTING SPATIAL DISTORTIONINFO: Applying spatial distortion correctionINTEGRATING DATAINFO: Integrating dataCDzRadial Distance (mm)C4@I2-Theta Angle (Degrees)Q (Inverse Nanometres)D-spacing (Angstroms)IntensityIntensityINFO: Saving 1-D scan to fileWARNING: File not input: Scan Number to Subroutine F2D_FULL V0.2 Subroutine F2D_FULL V0.2 Subroutine F2D_GUI_CORRECTION V0.11Subroutine F2D_GUI_CORRECTION V0.11#OVERLOAD_VALUEGPFF_CORRECTIONFF_FILEFF_SCALEFF_SCALERSD_CORRECTIONSD_FILEFF_CORRECTIONFF_FILEFF_SCALEFF_SCALERSD_CORRECTIONSD_FILEINPUT OF FLAT-FIELD FROM FILE: @@SELECT FLAT FIELD FILE(click on "HELP" for list of formats)APPLYING FLAT-FIELDAPPLYING SCALE FACTORDYNAMIC MEMORY ALLOCATION FAILEDINPUTTING SPATIAL DISTORTION FUNCTIONTOO MANY COEFFICIENTSWRONG TYPE OF FILEPROBLEM OPENNING FILECALCULATING CORRECTION TRANSFORMATION(ORIGINAL DATA TRANSFERRED TO THE MEMORY)CORRECTION COMPLETESubroutine F2D_GUI_FILTER V0.1 Subroutine F2D_GUI_FILTER V0.1 FIT2D: MAIN MENUnullnullEXIT?HELP Welcome to the FIT2D Filteral operations menu. The commands here allow you to perform filter operations.EXCHANGEFULLMEDIANSMOOTHZOOM INSubroutine F2D_GUI_GEOMETRIC V0.7 Subroutine F2D_GUI_GEOMETRIC V0.7 WELCOME TO THE GENERAL IMAGE PROCESSING GUI GEOMETRIC SUB-MENU FIT2D: GEOMETRY MENUnullnullEXIT?HELP Welcome to the FIT2D Geometrical operations menu. The commands here allow you to perform geometric operations.EXTENDFLIPFLIP LEFT / RIGHTClick "YES" to reverse the elements horizontally"YES" or "NO"FLIP TOP / BOTTOMClick "YES" to reverse the elements vertically"YES" or "NO"EXCHANGEFULLRE-BINREFLECTTRANSFORMTRANSPOSEZOOM INSubroutine F2D_GUI_GEOMETRY V0.6 EXPERIMENTAL GEOMETRY CONTROL FORMX-PIXEL SIZEY-PIXEL SIZEDISTANCEWAVELENGTHX-BEAM CENTREY-BEAM CENTRETILT ROTATIONANGLE OF TILTSIZE OF HORIZONTAL PIXELS (MICRONS)SIZE OF VERTICAL PIXELS (MICRONS)SAMPLE TO DETECTOR DISTANCE (MM)WAVELENGTH (ANGSTROMS)X-PIXEL COORDINATE OF DIRECT BEAMY-PIXEL COORDINATE OF DIRECT BEAMROTATION ANGLE OF TILTING PLANE (DEGREES)ANGLE OF DETECTOR TILT IN PLANE (DEGREES)Enter dimension of pixels horizontally, as displayed (microns)Enter dimension of pixels vertically, as displayed (microns)Enter sample to detector distance (mm)Enter the wavelength of the radiation in Angstrom unitsEnter X-pixel coordinate of centre of the direct beamEnter Y-pixel coordinate of centre of the direct beamEnter rotation angle of the plane in which the tilt occursEnter angle of detector tilt within the tilt plane:oF@<# 4C4´BIt$DzP@IX_PIXEL_SIZEY_PIXEL_SIZEWAVELENGTHSAMPLE_DISTANCEX_BEAM_CENTREY_BEAM_CENTRETILT_ROTATIONTILT_ANGLESubroutine F2D_GUI_MATHS V0.5 Subroutine F2D_GUI_MATHS V0.5 FIT2D: MAIN MENUnullnullEXIT?HELP Welcome to the FIT2D Mathematical operations menu. The commands here allow you to perform maths operations.SCALAR +ADDITION CONSTANTEnter value to add to active data regionEnter real numberSCALAR /DIVISION CONSTANTEnter value to divide active data regionEnter real numberNOT POSSIBLE TO DIVIDE BY ZERO?SCALAR *MULTIPLICATION CONSTANTEnter value to multiple active data regionEnter real numberSCALED SUBADDDIVIDELOG(10)MULTIPLYNORMALISESTATISTICSSUBTRACTTHRESHOLDX^(n)MEMORY NOT DEFINEDMEMORY DEFINED, BUT NOT IN WHOLE OF ADRSubroutine F2D_GUI_PARAMETERS V0.14Subroutine F2D_GUI_PARAMETERS V0.14NOTE: The definition of model 2-D polynomials has been changed to Chebyshev form. User input has also been changed.INFO: As you input model features the model is built up. The intensity values used to initialise features are based on the data minus the current model value. It is recommended to select the most intense features first, followed by the next intense features, etc. If the background is large and is to fitted with a 2-D polynomial, this should be selected first, but initialised with a low order polynomial so not to fit too much to the other featuresINFO: Control passed to graphics windowCONTROL RETURNED TO TERMINAL WINDOW@>L?@@>2WARNING: Parameter array full, not enough room to store feature parameters@WARNING: Parameter array full, not enough room to store feature parametersWARNING: Parameter array full, not enough room to store feature parameters<+:=?Subroutine F2D_GUI_PEAKSEARCH V0.17Subroutine F2D_GUI_PEAKSEARCH V0.17.peaksdata.peaksPEAK_SEARCH_BLUR_SIZEPEAK_SEARCH_BOX_SIZEPEAK_SEARCH_NUM_MINIMUMPEAK_SEARCH_MIN_SPACINGPEAK_SEARCH_DATA_LIMITPEAK_SEARCH_PEAK_SIGMAPEAK_SEARCH_BAD_SIGMAPEAK_SEARCH_DET_OFFSETPEAK_SEARCH_DET_GAIN#OVERLOAD_VALUEPEAK_SEARCH_DRAW_BADPEAK_SEARCH_OUTPUTCONTROL OF PEAK SEARCH VARIABLES (SAVED BETWEEN FIT2D SESSIONS)This form allows you to control various options controllingthe peak searchBLUR SIZEDATA MINIMUMMIN BACKGROUNDBOX SIZEMIN. SPACINGSATURATIONPEAK SIGMABAD SIGMANUM PIXELSBAD WEAKDATA OFFSETDET. GAINSAVE PEAKSOUTPUT FILENUMBER OF PIXELS IN SMOOTHINGMINIMUM ACCEPTED "GOOD" DATA VALUEMINIMUM NUMBER OF BACKGROUND PIXELSSIZE OF BACKGROUND BOXMINIMUM SPACING BETWEEN PEAKSDETECTOR SATURATION VALUENUMBER OF SIGMA ABOVE MEANNUMBER OF SIGMA BELOW MEANMINIMUM NUMBER OF PIXELS IN A PEAKDRAW BAD BUT NON-SATURATED "PEAKS"DETECTOR OFFSET VALUE (DATA ZERO)DETECTOR GAIN FACTORSAVE PEAK X/Y/I IN ASCII FILENAME OF PEAK SEARCH OUTPUT FILEEnter size of top-hat"smoothing functionEnter lowest accepted value for a pixel value (inclusive)Minimum number of background pixels for statisticsSize of region for calculatingsigmaEnter minimum spacing between peaksEnter value above which pixelswill be considered as saturatedEnter number of standarddeviations above backgroundEnter number of standarddeviations below backgroundEnter minimum number of candidatepixels in a peakEnter "YES" to output bad non-saturated "peaks"Enter detector zero level value: detector offset valueEnter detector gain (multipler on Poisson statisticsEnter "YES" to save peak positions and intensities in an ASCII fileEnter name of ASCII file to store results of peak searchGPB`x@A@<# A PEAK_SEARCH_BLUR_SIZEPEAK_SEARCH_BOX_SIZEPEAK_SEARCH_NUM_MINIMUMPEAK_SEARCH_MIN_SPACINGPEAK_SEARCH_DATA_LIMITPEAK_SEARCH_PEAK_SIGMAPEAK_SEARCH_BAD_SIGMAPEAK_SEARCH_DET_OFFSETPEAK_SEARCH_DET_GAINPEAK_SEARCH_DRAW_BADPEAK_SEARCH_OUTPUTWORKING: PEAK SEARCHINGWRITEWARNING: Problem outputing peak search resultsWARNING: Peak search failed: too many peaks for peak arraysA @@BH@Ap@?ٙ@ ?ff??INFO: Number of peaks with given ranges of estimated I / sigma(I) Lower Upper NumberINFO: Number of peaks within given resolution ranges and average I / sigma(I) Lower Upper Number Dz?Subroutine F2D_GUI_PROJECTION V0.7 Subroutine F2D_GUI_PROJECTION V0.7 SCAN_TYPEMAXIMUM_DSCAN_SUMMATIONGEOMETRICAL_CORRECTIONPROJECTION 1-D SCANCONTROL FORMSCAN TYPESUMMATIONGEOM. CORR.MAX. D-SPACINGSCAN TYPE (D, RADIAL, 2-THETA, Q-SPACE)OUTPUT SUMMATION (NO NORMALISATION)CORRECT FOR GEOMETRICAL 1/Cos**3(o) EFFECTMAXIMUM FOR D-SPACINGS SCANS (ANGSTROMS)Select type of output 1-D scan: "RADIAL", "2-THETA", D, or "Q-SPACE""YES" to output summation (approx), of projected region, "NO" to normalise"YES" to applied intensity correction to flat plate geometryEnter maximum of range for calculation of D-spacing scans (Angstroms)?F@PROJECTION RE-BINNING CONTROL FORM (under development)SCAN_TYPEMAXIMUM_DSCAN_SUMMATIONGEOMETRICAL_CORRECTION?C4@IAINnk(@OUTPUT BIN SIZECONTROL FORMBIN SIZENO. BINSSIZE OF OUTPUT BINS (microns)Enter size of output pixels in millimetres for a radial distance scanIt$SIZE OF OUTPUT BINS (degrees)Enter size of output pixels in degrees for a 2-theta scanSIZE OF OUTPUT BINS (Inverse nanometres)Enter size of output pixels in inverse nanometres for a Q-space scanSIZE OF OUTPUT BINS (Angstroms)Enter size of output pixels in Angstroms for a D-spacings scanNUMBER OF OUTPUT SCAN BINSEnter number of binsin output scan7'ŬOUTPUT BIN SIZE CONTROL FORM (under development): Distance ProjectionDistance (mm): 2-theta Projection2-Theta Angle (Degrees): Q-Space ProjectionQ (Inverse Nanometres): D-Spacings ProjectionD-spacing (Angstroms)?Subroutine F2D_GUI_SEQUENCE V0.4 WARNING: The "SEQUENCE" command cannot be used within a macro. (It is used to repeately run a defined macro.)AT PRESENT ONLY WORKS WITH #IN AND #OUT MACROSSELECT MACRO FILE TO RUNUse the file selection tool to select a directoryand a macro file to run.Normally macro files end with theextension ".mac".SELECT FIRST INPUTFILE IN THE SEQUENCEUse the file selection tool to select a directoryand the first file in the sequence.SELECT LAST INPUTFILE IN THE SEQUENCEUse the file selection tool to selectthe last file in the sequence.COULD NOT DEDUCE REQUIRED FILE SEQUENCEFILE INCREMENTEnter the step between input filesEnter an integer numberOUTPUT FILES EXTENSIONEnter the extension for output filesEnter valid text string##COUNT Input file = Output file = INFO: *** END OF SEQUENCE ***Subroutine F2D_GUI_VECTORS V0.3 Subroutine F2D_GUI_VECTORS V0.3 No vectors have been defined??NUMBER OF VECTOREnter number of vector to view, output, etc.Enter integer within given rangeSamplesValuesx/y graphVECTORS MENUnullnullnullEXIT?FULLHELPINPUTSELECT FILE TO INPUT (1-D vector)(click on "HELP" for list of formats) OPTIONSimageOUTPUTPRINTZOOM INDATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_ZSCALE V0.17LINEAR SCALELINEAR SCALE: Linear (or logarithmic) image intensity scalingLOG SCALELOG SCALE: Logarithmic (or linear) image intensity scalingFIT2D: IMAGE: OPTIONS: Z-SCALINGnull7'ŬF@=Dz<# B:oA 8ѷ?573ֿ.0p_?@nullEXIT?FULLY AUTOMATICWEAK PEAKS+ MAXIMUM=9- MAXIMUM+ MINIMUM- MINIMUMUSER MIN/MAXUSER MINIMUMUSER MAXIMUMLOG SCALELINEAR SCALELINEAR SCALE: Logarithmic or linear image intensity scalingLINEAR SCALELOG SCALELOG SCALE: Logarithmic or linear image intensity scalingMINIMUM DISPLAY VALUEEnter lowest data value in display rangeEnter valid realMAXIMUM DISPLAY VALUEEnter lowest data value in display rangeEnter valid realWARNING: The minimum of the range has been set greater than or equal to the maximum of the display range. You must reset the values.?Z_SCALING_MODEZ_SCALING_MINIMUMZ_SCALING_MAXIMUMZ_SCALING_LOGSubroutine F2D_IDEALSPACE V0.1 ɞSubroutine F2D_IN_SPATIAL V0.10Subroutine F2D_IN_SPATIAL V0.10READ_ASCIIName of file for spatial distortion interpolation functionREAD_ASCIISPATIAL DISTORTION SPLINEDISTORTION FUNCTION FROM IDEALWARNING: File is wrong sort of distortion spline function (ideal grid to distorted grid spline)WARNING: File is not a distortion spline function file57Subroutine F2D_IN_SPATIAL V0.10Subroutine F2D_INP_BEAMCENTRE V0.1 X-PIXEL COORDINATE OF BEAM CENTREEnter X-pixel coordinate of beam centreMust be valid real numberY-PIXEL COORDINATE OF BEAM CENTREEnter Y-pixel coordinate of beam centreMust be valid real numberX-PIXEL COORDINATE OF BEAM CENTREEnter X-pixel coordinate of beam centreMust be valid real numberY-PIXEL COORDINATE OF BEAM CENTREEnter Y-pixel coordinate of beam centreMust be valid real numberSubroutine F2D_INP_DATATYPE V0.1 iINTEGER VALUElLOGICAL (BOOLEAN) VALUErFLOATING POINT (REAL) VALUEsCHARACTER STRING VALUEuCHARACTER STRING VALUEENTER DATA TYPE OF VARIABLEChoice one of the available data typesBOOLEAN VALUElCHARACTER STRING VALUEsFLOATING POINT (REAL) VALUErINTEGER VALUEiLOGICAL (BOOLEAN) VALUElREAL VALUErSTRING VALUEsSubroutine F2D_INP_DCLUT V0.7 Subroutine F2D_INP_DCLUT V0.7 DCLUT_FILE_NAME.dclttest.dcltUSE is the default file for input of the look-up table.If this file is appropriate enter "YES". If you want to use a different file, enter "NO".Enter "YES" or "NO"SELECT OUTPUT FILE FOR DISTORTIONCORRECTION LOOK-UP TABLEUse the file selection tool to select a directoryand an input file to contain the distortioncorrection lut. Normally such a file endswith the extension ".dclt".INPUT FILE NAMEName of file containing distortion correction LUTUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)Inverse Flat-Field Response ImageSubroutine F2D_INP_DETECTORTILT V0.2 C4@IThe detector would ideally be orthogonal to the direct X-ray beam, butin practice it is unlikely to be completely orthogonal, but hopefullyany tilt is small. To define the tilt two angles are specified. Thefirst angle is the rotation angle within the ideal orthogonal planeanti-clockwise from the X-axis (horizontal rightwards, looking from thesample to the detector). This rotation defines the "tilt plane" withinwhich the detector is tilted by a single rotation angle. The beam is inthe tilt plane. The tilt angle is the angle anti-clockwise from theideal orthogonal detector plane to the actual tilted detector plane.4TILT PLANE ROTATION ANGLE (DEGREES)Must be valid real number within given rangeTILT PLANE ROTATION ANGLE (DEGREES)Must be valid real number within given rangeDETECTOR TILT ANGLE (DEGREES)Must be valid real number within given rangeDETECTOR TILT ANGLE (DEGREES)Must be valid real number within given rangeSubroutine F2D_INP_PIXELSIZES V0.5 It$:oF@X-DIRECTION PIXEL SIZE (MICRONS)Enter X-dimension size of one raw pixel in microns Must be valid real numberX-DIRECTION PIXEL SIZE (MICRONS)Enter X-dimension size of one raw pixel in microns Must be valid real number57Y-DIRECTION PIXEL SIZE (MICRONS)Enter Y-dimension size of one raw pixel in microns Must be valid real numberY-DIRECTION PIXEL SIZE (MICRONS)Enter Y-dimension size of one raw pixel in microns Must be valid real numberX_PIXEL_SIZEY_PIXEL_SIZESubroutine F2D_INP_SAMPLEDISTANCE V0.2 DzEnter distance from the sample to the detector in millimetres. As thedetector may be tilted this is the distance from the centre of the sampleto the intersection of the direct beam and the detector or in the caseof a spatially corrected image the grid mask.=GPSAMPLE TO DETECTOR DISTANCE (MILLIMETRES)Must be valid real number within given rangeSAMPLE TO DETECTOR DISTANCE (MILLIMETRES)Must be valid real number within given rangeSubroutine F2D_INP_WAVELENGTH V0.4 Enter the wavelength of the X-ray radiation in Angstroms. (1 Angstrom =0.1 nm). Some typical values (Angstroms) are:Cu K alpha 1 = 1.540614 (8.04778 keV)Mo K alpha 1 = 0.7093243 (17.47934 keV)PGPWAVELENGTH (Angstroms) (0.0 for keV )Must be valid real numberWAVELENGTH (Angstroms) (0.0 for keV )Must be valid real number.AF`W:oF@ENERGY OF RADIATION (keV)Enter energy of X-rays in keV (an average will do)Must be valid real numberENERGY OF RADIATION (keV)Enter energy of X-rays in keV (an average will do)Must be valid real numberSubroutine F2D_INQ_GEOMETRY V0.7 WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLEDETECTOR_ROTATIONX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_INTEGRATE V0.10Subroutine F2D_INTEGRATE V0.10SCAN_TYPEMAXIMUM_DSCAN_TYPEMAXIMUM_DWORKING: CALCULATING TRANSFORMNOTE: ORIGINAL DATA STORED IN THE MEMORYCDzC4@I?: Radial ScanRadial Distance (mm)N.A.: 2-theta Scan2-Theta Angle (Degrees)N.A.: Q-Space ScanQ (Inverse Nanometres)N.A.: D-Spacing ScanD-spacing (Angstroms)N.A.Subroutine F2D_LEARNPROFILE V0.1 Enter size of profile to calculate in terms of input pixelsi.e. the number of input pixels whichwill be used to calculate the profileSIZE OF PROFILE (INPUT PIXELS)Value must be within given rangeEnter number of resolution samples per pixel to be used to calculatethe average profile e.g. 2 means that each output pixel corresponds tohalf of the original pixel sizeNUMBER OF OVER-SAMPLING SUB-PIXELSValue must be within given rangeWARNING: Program arrays are not big enough to calculate required profileɞ?Average Peak ProfileX-directionY-directionIntensity?Subroutine F2D_LSQFIT2D V0.10Subroutine F2D_LSQFIT2D V0.10WARNING: Geometry not defined7'ŬB57WARNING: Problem fitting the model to the data@Subroutine F2D_MASK V0.15Subroutine F2D_MASK V0.15FIT: MASK MENUnullnullCLEAR MASKEXIT?FULL UN-ZOOMMASK PEAKS (5)@ MASK PEAKS (9)@MASK PEAKS (15)@MASK PEAKS (27)AXMASK POLYGONUN-MASK POLYGONUN-ZOOMUPDATE DISPLAYZOOM INZ-SCALINGMASK ARCTHRESHOLD MASKCONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_MASKCOLOUR V0.2 COLOUR FOR MASKED OFF ELEMENTSSubroutine F2D_MASKMEMORY V0.1 Subroutine F2D_MASKMEMORY V0.1 ?Data Mask(1.0 equals masked element)Subroutine F2D_MASKSTATS V0.2 Subroutine F2D_MASKSTATS V0.2 BSubroutine F2D_MASKTHRESHOLD V0.2 Subroutine F2D_MASKTHRESHOLD V0.2 INFO: This option allows masked-off elements with the ADR to be defined automatically depending on the data values. The user can set a threshold operation ( or ) and a threshold level. All data values which CONFORM WITH the defined test will be set to be masked-off. All others will be changed.WARNING: This option used to also "un-mask" elements; this behaviour has been changed so now elements are only masked or left in their previous state. To un-mask elements, use "CLEAR MASK" before this command."YES" if mask elements are to be selected by a lesser than comparison(exclusive),"NO" if mask elements are to be selected by a greater than comparison(exclusive)LESS THAN COMPARISONEnter "YES" or "NO"LESS THAN COMPARISONEnter "YES" or "NO"DECISION THRESHOLD DATA VALUEInput pixel data value for threshold decisionEnter real numberDECISION THRESHOLD DATA VALUEInput pixel data value for threshold decisionEnter real numberCALCULATING MASK: PLEASE WAITSubroutine F2D_MFITDISPLAY V0.5 Subroutine F2D_MFITDISPLAY V0.5 Subroutine F2D_SUBMFITDISPLAY V0.4 Subroutine F2D_SUBMFITDISPLAY V0.4 >L=L?WARNING: Problem with variance valuesResidualsResiduals  B`>??L>>;d?(7?ff?5Subroutine F2D_MFITOPTIMISE V0.3 Subroutine F2D_MFITOPTIMISE V0.3 : Row : Row ?Subroutine F2D_MFITSETUP V0.4 FITTING CONTROL PARAMETERSThis size form allows you to adjustaspects of the fit and graphical display ofresults.INFO. LEVELITER / PARDIS. FREQ.EVOLUTIONWEIGHTEDLEVEL OF FITTING INFORMATIONNo. OF ITERATIONS PER PARAMETERDISPLAY FREQUENCY OF RESULTSALLOW FIT PARAMETER VALUES TO EVOLVEWEIGHTED FITTINGFitting information level: 0 = minimum, 2 = maximumEnter maximum number of iterations per fit parameterEnter number of rows bewteen graphical display of fitted resultsYes to allow the fitted values ofone fit to be used for the nextSelect fitted weighted by varianceexists or notSubroutine F2D_OPEN_INMACRO V0.1 SELECT MACRO FILE TO RUNUse the file selection tool to select a directoryand a macro file to run.Normally macro files end with theextension ".mac".PROBLEM OPENING MACRO FILESubroutine F2D_OPEN_OUTMACRO V0.1 STORE MACRO IN: is the default file for storing the macro.If this file is appropriate enter "YES". If you want to use a different file, enter "NO".Enter "YES" or "NO"SELECT OUTPUT FILE FORSTORING THE MACROUse the file selection tool to select a directoryand an output file to contain the macro.Normally such a file ends with theextension ".mac".PROBLEM OPENING FILE FOR THE MACROSubroutine F2D_OPEN_LOG V0.1 SAVE LOG IN: is the default file for saving the log.If this file is appropriate enter "YES". If you want to use a different file, enter "NO".Enter "YES" or "NO"SELECT OUTPUT FILE FORSAVING THE LOG RECORDUse the file selection tool to select a directoryand an output file to contain the log record.Normally such a file ends with theextension ".log".PROBLEM OPENING FILE FOR THE LOGSubroutine F2D_OPTIONS V0.16Subroutine F2D_OPTIONS V0.16NO LUTNO LUT: Don't add the look-up table to the image displayDRAW LUTDRAW LUT: Add a look-up table to the image displayimageFIT2D: IMAGE: OPTIONS MENUnullNULLEXIT?COLOURSCURVE STYLESDRAW LUTNO LUTNO LUT: Don't add the look-up table to the image displayGRIDNO LUTDRAW LUTDRAW LUT: Add the look-up table to the image displayPOSITIONROTATE LUTTITLEENTER TITLE FOR IMAGEEnter new titleEnter valid charactersX-AXIS LABELENTER TEXT FOR X-AXIS LABELEnter new X-axis labelEnter valid charactersY-AXIS LABELENTER TEXT FOR Y-AXIS LABELEnter new Y-axis labelEnter valid charactersZ-AXIS LABELENTER TEXT FOR Z-AXIS LABELEnter new Z-axis labelEnter valid charactersZ-SCALINGASPECT RATIOEnter "YES" if you want image display with automatic correct aspectratios i.e. the pixels are square. Enter "NO" to use all the availabledisplay region. This may result in non-square pixels, but may bepreferable for very non-square images.AUTOMATIC CORRECT ASPECT RATIO IMAGE DISPLAYEnter "YES" on "NO"Subroutine F2D_OUT_DCLUT V0.9 Subroutine F2D_OUT_DCLUT V0.9 ERROR: The defined size of the data is not the same as the size of the look-up table..dclttest.dcltUSE is the default file for output of the look-up table.If this file is appropriate enter "YES". If you want to use a different file, enter "NO".Enter "YES" or "NO"SELECT OUTPUT FILE FOR DISTORTIONCORRECTION LOOK-UP TABLEUse the file selection tool to select a directoryand an output file to contain the distortioncorrection lut. Normally such a file endswith the extension ".dclt".OUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)STORE INVERSE NORMALISED FLAT-FIELD RESPONSE (MUST BE PRESENT)Enter "YES" to save inverse flat-field response dataClick on "YES" or "NO"STORE INVERSE NORMALISED FLAT-FIELD RESPONSE (MUST BE PRESENT)Enter "YES" to save inverse flat-field response dataClick on "YES" or "NO"WRITEWARNING: Error in opening fileDISTORTION CORRECTION LOOK-UP TABLE V02.007'ŬG!!! END OF HEADER SECTION !!!ERROR: Problem writing data to fileERROR: The relative change in distortion is too large for the storage schemeERROR: Problem writing data to fileDCLUT_FILE_NAMEERROR: Problem writing data to fileSubroutine F2D_OUT_PARAMETERS V0.5 Subroutine F2D_OUT_PARAMETERS V0.5 fit2d.parOUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)UNKNOWNDIRECTUNFORMATTEDWARNING: Error in opening fileTRUEFALSE$FFF_STARTFIT2D Parameter File$BIG_ENDIANheaderFIT2D parameter filedata_masktotal_paramsnumber_featuresnumber_resultsx_ordery_orderx_min_polyy_min_polyx_max_polyy_max_polyapply_weightsaccuracyiters_per_parammodel_evolvedisplay_frequencyfast_displayhalt_criterionhalt_valueparameter_valuesparameter_descriptionsparameter_scalesparameter_namesresult_names$FFF_ENDEnd of parameter data?Subroutine F2D_OUT_SPATIAL V0.8 Subroutine F2D_OUT_SPATIAL V0.8 Name of file for spatial distortion interpolation functionWRITEWARNING: Problem outputting spatial distortion file (quota full ?)It$Subroutine F2D_PARAMETERS V0.8 Subroutine F2D_PARAMETERS V0.8 GRAPHICALLYInput methodEnter one of the available choicesFILEGRAPHICALLYSubroutine F2D_POWDERDIFFRACTION V0.18Subroutine F2D_POWDERDIFFRACTION V0.18It$DzC4@ICHANGE BEAM CENTRE AND/OR TILT VALUESYES: to specific new values for parametersEnter "YES" or "NO"Enter: "YES" if you want to produce a 1-D scan as a function of equal angle pixels. "NO" if you want to produce a 1-D scan as a function of equal radial distance pixels (on an orthogonal detector).(The two are not the same.)The best choice will depend on the capabilities on any furtherprocessing software. e.g. If a Rietveld program requires equal anglepixels then this is clearly the choice. If either type of scan may betreated then the equal radial re-binning is probably perferable.PRODUCE EQUAL ANGLE PIXEL SCANEnter "YES" or "NO"@Enter required angle step between bins for the calculation of the 1-D2 theta scan. (The default value corresponds to the angular size ofthe average pixel size at the beam centre.):oF@2 THETA SCAN ANGULAR PIXEL STEP (DEGREES)Must be within given rangeEnter required spacing between pixel positions for the calculation ofthe radial profile i.e. Each pixel in the radial profile should correspondto what pixel distance from the image.RADIAL PIXEL SIZE (MICRONS)Must be within given rangeYES: if a the detector spatial distortion has been characterised and isto be taken into account. If you answer "YES" you will be required toinput the name of a valid spatial distortion interpolation file.TAKE ACCOUNT OF SPATIAL DISTORTIONEnter "YES" or "NO"If the data is to be Rietveld refined it is probably appropriate tooutput it now into a "PDS" file (Powder Diffraction Standard) file.(The scan will be saved in the memory, but the number of pixelscontributing to each scan bin will be lost if the file is not created now.)SAVE DATA IN "POWDER DIFFRACTION STANDARD" FORMATEnter "YES" or "NO": Angular ProfileTwo-Theta Angle (degrees): Radial ProfileRadial distance (mm)Intensity (normalised)?Subroutine F2D_RADIAL V0.2 ?The world-coordinate spacing between pixelpositions for the calculation of the radial profile~ɞRADIAL PIXEL SPACINGMust be in set rangeX-COORDINATE OF RADIAL SYMMETRYX-centre for radial profileMust be valid realY-COORDINATE OF RADIAL SYMMETRYY-centre for radial profileMust be valid realSubroutine F2D_RECIP2UNIT V0.1 ?@Subroutine F2D_RESIDUALS V0.2 Subroutine F2D_RESIDUALS V0.2 CALCULATE X-RESIDUALSEnter "YES" for X-distortion fit residuals, "NO" for Y-distortionEnter "YES" or "NO"ɞX-DISTORTION FIT RESIDUALSY-DISTORTION FIT RESIDUALSSubroutine F2D_RTHETA V0.9 Subroutine F2D_RTHETA V0.9 WARNING : This option is still in a developmental stage User input will change, check results carefullyIt$DzC4@ICHANGE BEAM CENTRE AND/OR TILT VALUESYES: to specific new values for parametersEnter "YES" or "NO"@Enter: "YES" if you want to produce a 1-D scan as a function of equal angle pixels. "NO" if you want to produce a 1-D scan as a function of equal radial distance pixels (on an orthogonal detector).(The two are not the same.)The best choice will depend on the capabilities on any furtherprocessing software. e.g. If a Rietveld program requires equal anglepixels then this is clearly the choice. If either type of scan may betreated then the equal radial re-binning is probably perferable.PRODUCE EQUAL ANGLE PIXEL SCANEnter "YES" or "NO"The active data region, with the exception of masked-off areas isrebinned to a azimuth/radial binned array. Where each pixel representsan equal angular/radial area. You may chose the number of azimuth andradial bins to be used.NUMBER OF AZIMUTH BINSMust be within given rangeNUMBER OF 2-THETA ANGLE BINSMust be within given rangeNUMBER OF RADIAL DISTANCE BINSMust be within given rangeEnter the maximum 2-theta angle (degrees)for the output re-binned region.BMAXIMUM 2-THETA LIMIT (DEGREES)Must be within given rangeEnter the maximum radial distance (X-pixel units)for the output re-binned region.?MAXIMUM RADIAL LIMIT (X PIXELS)Must be within given range@YES: if a the detector spatial distortion has been characterised and isto be taken into account. If you answer "YES" you will be required toinput the name of a valid spatial distortion interpolation file.The total integrated intensity in the transformed region can bepreserved by answering "YES". The integrated intensity in definedazimuthal/radial regions should also be approximately preserved.However, for producing a number of 2 theta scans, it is probably betternot to preserve total intensity. Answering "NO" means that each outputpixel is normalised by the number of input pixelsCONSERVE INTEGRATED INTENSITYEnter "YES" or "NO"C: Azimuth/2-thetaAzimuth (Degrees)2-Theta Angle (Degrees): Azimuth/Radial DistanceAzimuth (Degrees)Radial Distance (mm)?Subroutine F2D_SAVE2DPEAKS V0.3 Subroutine F2D_SAVE2DPEAKS V0.3 Name of file for peak positionsWRITESubroutine F2D_SCALE V0.3 VIEWEXITENTER COMMANDMODIFYEnter number of parameter to be modified,(0 if no parameter is to be modified)PARAMETER NUMBER('PARAMETER NUMBER ', i3, 1x, a, ' Value = ', g12.5, 'Scale = ', g12.5)NEW SCALE SIZEVIEW('PARAMETER NUMBER ', i3, 1x, a, ' Value = ', g12.5, 'Scale = ', g12.5)EXITWARNING: Unknown command, please re-enterSubroutine F2D_SDLUT V0.4 Subroutine F2D_SDLUT V0.4 'ŬSubroutine F2D_SDLUTSUB V0.4 Subroutine F2D_SDLUTSUB V0.4 @INFO: Starting to create spatial distortion look-up table?7'Ŭ?57CBWARNING: At one or more positions the X-distortion was too large to be stored in the look-up table (+-127 pixels). At these points the distortion is set to the maximum storable value. If this only affects the extremes of the detector it is probably not important.WARNING: At one or more positions the Y-distortion was too large to be stored in the look-up table (+-127 pixels). At these points the distortion is set to the maximum storable value. If this only affects the extremes of the detector it is probably not important. re-binning into more than three output pixels (X-direction). re-binning into more than three output pixels (Y-direction).?tzGSubroutine F2D_SET_GEOMETRY V0.6 WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLEDETECTOR_ROTATIONX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_SETUP V0.2 VIEWFITTING SETUP SUB-MENU: ENTER COMMANDACCURACYRequired accuracy: 1.0 = An one sigma fit (on average) throughoutthe data region. ( < 1.0 higher accuracy, closer fit to data > 1.0 Lower accuracy, looser fit to data )3ֿBACCURACY LEVELEXITDISPLAY FREQUENCYHow often should the result of the fit be displayed.(0 = No display)Must be within set limitsGRAPH FREQUENCYEXITCHANGE FIT ORDERMultiple frame fitting will now be in reverse orderMultiple frame fitting will now be in normal orderEXITEXITFAST DISPLAYMinimal text will be added to fit graphical outputFull text will be added to fit graphical outputEXITHALT CRITERIONWhat halt criterion do you want to use to permaturely stop the fitting 0 = No halt criterion 1 = Upper limit on goodness of fitMust be within set limitsHALT CRITERIONEnter upper limit for the goodness of fitMust be within set limitsMAXIMUM GOOD FITEXITMAXIMUM LIKELIHOODThe Maximum Likelihood method (MLM) will be appliedLeast Squares fitting will be appliedEXITMODEL EVOLUTIONThe minimised fit parameters for one will be used as thestarting parameters for the next fitThe user input fit parameters will be used as thestarting parameters for all the fitsEXITNUMBER ITERATIONSMaximum number of iterations per fit per unconstrained parameterMust be within set limits=CHNUMBER PER PARAMETEREXITPOISSON STATISTICSPoissonian statistics will be taken into account by model derived weightingGaussian statistics weighted by entered data errorsEXITREQUEST CONTINUATIONHow many frames are to be fitted between continuation requestsReturn "0" for no requestsMust be within defined limitsREQUEST INTERVALEXITVIEW('ACCURACY : ', g12.5, ' (Average ','standard deviations per data point)')('DISPLAY FREQUENCY : ', i6,' (Frequency of graphical output)')FAST DISPLAY : TRUE (Minimal text will be added to fit graphical output)FAST DISPLAY : FALSE (Full text will be added to fit graphical output)REVERSE : TRUE (Multiple frame fitting in reverse order)REVERSE : FALSE (Multiple frame fitting in normal order)('HALT CRITERION : ', i1, ' (','No halt criterion)')('HALT CRITERION : ', i1 ,' (','Upper limit on goodness of fit)')('HALT VALUE : ', g12.5,' (','Meaning defined by HALT CRITERION)')MODEL EVOLUTION : TRUE (Minimised parameters used for next fit)MODEL EVOLUTION : FALSE (Initial parameters used for all fits)('NUMBER ITERATIONS : ', g12.5, ' (Per unconstrained parameter)')WEIGHTED FIT : TRUE (Fit weighted by error values)WEIGHTED FIT : FALSE (Fit unweighted)POISSON STATISTICS : TRUE ( Model derived weighting)POISSON STATISTICS : FALSE ( Weighting by ERROR array)MAXIMUM LIKELIHOOD METHOD : TRUE (Applied to fitting)MAXIMUM LIKELIHOOD METHOD : FALSE (Fit by Least Squares Method)No user CONTINUATION requests('User CONTINUATION ''prompts every ', i4, ' frames')WEIGHTED FITError weighting will now to be used for the fit minimisationNo weighting will now to be used for the fit minimisationEXITWARNING: Unknown command, please re-enterSubroutine F2D_SPHERICAL_MOD V0.1 Subroutine F2D_SPHERICAL_MOD V0.1 @Click on meridian CLICK ON MERIDIAN?+Meridian point must not be on beam centreC4@IڿSubroutine F2D_TILTCENTRE V0.26Subroutine F2D_TILTCENTRE V0.26WARNING: This is a development routine, user prompts are likely to changeTILT / BEAM CENTRE REFINEMENT(FITTING TO POWDER RINGS)ANGULAR SECTIONSREJECT OUTLIERSREJECT LIMITFULL INFOREFINE BEAMREFINE TILTNUMBER OF AZIMUTHAL SECTIONSREJECT OUT-LYING POSITIONS AND RE-REFINEREJECT LIMIT FROM IDEAL (STANDARD DEVIATIONS)OUTPUT FULL INFORMATIONFIND BEST FIT BEAM CENTREFIND BEST DETECTOR TILT ANGLESEnter number of azimuthal divisions to find average ring positionsEnter "YES" to reject badly fittingpositions and re-fit without themEnter number of standard deviations from ideal before rejectionEnter "YES" to output full diagnostics information in terminal windowEnter "YES" to refine beam centre positionEnter "YES" to refine angle of detector tilt@BThe powder ring is divided into a number of equal angle sections forcalculating the radial centre of each section. From the radial centreand the average angle two cartesian coordinates are calculated. Thesecoordinates are used to fit optimum beam centre and detector plane tiltangles. Enter required number of sections for calculations.NUMBER OF ANGULAR SECTIONSEnter an integer within the given rangeThe fitting of tilt angle and beam centre to the estimated ring centresmay be performed using weighted fitting or unweighted fitting. Ifweighted fitting is chosen then the average intensity (3 pixels) aroundthe calculated centre of each radial profile is used to weight the fit.This means that strong rings and strong angular regions of rings willhave more influence than weaker ones. This should make the fitting morerobust when the data has weak rings and noisy background.As you are using weighted fitting the weight applied to each estimatedring coordinate will depend on the square root of the estimated numberof counts for that coordinate. The number of counts is calculated fromthe averaged pixel intensity divided by the detector gain. Normallythe detector gain should be set to the best estimate of the gain, butit may be useful to vary it artifically to change the weighting betweenstrong and weak rings. If the gain is set artifically high, then thefitting will be weighted more towards the weak rings.<# DETECTOR GAINEnter a real value within the given rangeOutlying coordinate positions which are more than an input number ofstandard deviations radially from the fitted ring positions may berejected from the coordinate lists. The beam centre/tilt can then bere-fitted without these coordinates. If erroneous coordinate positionsare infuencing the fit, this option may allow them to be removed.REJECT OUTLYING COORDINATESEnter "YES" or "NO"Enter the limit of number of standard deviations after which coordinatepositions are to be rejected from the coordinate lists. A three sigmalimit should be reasonable for less than about 200 coordinates (assumingthey are normally distributed.)?A REJECT LIMIT (NUMBER OF STANDARD DEVIATIONS)Enter a real value within the given rangeFULL ALGORITHM INFORMATIONYES: if you want step by step diagnostics informationEnter "YES" or "NO"INFO: Control passed to graphics windowCONTROL RETURNED TO TERMINAL WINDOWThe entered beam centre position may be kept fixed or may be refinedalong with the tilt and powder ring opening angles. If the beam centreis well known e.g. by using a semi-transparant beam-stop then it isprobably better not to refine the position. Enter "YES" for the beam centre position to be refined, and "NO" ifthe present values are to be kept fixed.REFINE BEAM CENTREEnter "YES" or "NO"The non-orthogonality of the detector plane to the beam may berefined using the shape of the powder rings. If you want torefine this non-orthogonality or "detector tilt" angles, enter "YES".Entering "NO" uses the existing tilt angles as constant in anyrefinement of the beam centre.REFINE DETECTOR TILTEnter "YES" or "NO"Enter "YES" to refine the sample to detector distance. Normally it isprobably best initially to keep this fixed, so answer "NO". Havingrefined all other parameters, on a second iteration the distance canalso be simultaneously refined.REFINE SAMPLE DISTANCEEnter "YES" or "NO"WARNING: There is nothing left to refine !!!NOTHING LEFT TO REFINE !!!INFO: Fitting ellipse to centre of gravity coordinates>2¾2INFO: Fitting powder rings to centre of gravity coordinatesINFO: Fit of powder ring to inclined detectorINFO: Alternative fit of powder rings to centre of gravity coordinatesINFO: Fit of powder ring to inclined detector@IIINFO: In the absence of any other information, there are two equally valid solutions to the tilt angle and beam centre which could have formed a powder ring on an inclined detector. Theoretically these should both give the same goodness of fit, so both solutions are output. If the position of the beam-stop is known, then the "correct" solution may be selected.INFO: SOLUTION 1INFO: SOLUTIONINFO: SOLUTION 2WHICH SOLUTION (SEE TERMINAL WINDOW)Enter "1" or "2" to choose the solution to saveYou can only input "1" or "2"WHICH SOLUTIONEnter "1" or "2" to chose the solution to saveYou can only input "1" or "2"Subroutine F2D_TILTINFO V0.3 DzC4@IINFO: The coordinate radial position error is totally undeterminedSubroutine F2D_TILT2INFO V0.3 DzC4@ISubroutine F2D_TRIANGLE V0.1 Subroutine F2D_TRIANGLE V0.1 X-PIXEL FOR 1ST VERTEXEnter X-pixel number of first triangle vertexEnter integer number in rangeY-PIXEL FOR 1ST VERTEXEnter Y-pixel number of first triangle vertexEnter integer number in rangeX-PIXEL FOR 2ND VERTEXEnter X-pixel number of second triangle vertexEnter integer number in rangeY-PIXEL FOR 2ND VERTEXEnter Y-pixel number of second triangle vertexEnter integer number in rangeX-PIXEL FOR 3RD VERTEXEnter X-pixel number of third triangle vertexEnter integer number in rangeY-PIXEL FOR 3RD VERTEXEnter Y-pixel number of third triangle vertexEnter integer number in range?ADDITION CONSTANTEnter real value to add to active data regionEnter real numberSubroutine F2D_UNINORMALISE V0.4 Subroutine F2D_UNINORMALISE V0.4 HORIZONTAL NORMALISATION"YES" if normalisation for horizontal direction, "NO" for verticalEnter "YES" or "NO"WARNING: Work arrays too small, operation not performed?Subroutine F2D_UNIT2RECIPROCAL V0.1 @?Subroutine F2D_VIEW2DPEAKS V0.2 Subroutine F2D_VIEW2DPEAKS V0.2 X-PEAK NUMBER TO VIEW (0 to exit)Enter X-peak number to see it's positionValue must be within given rangeY-PEAK NUMBER TO VIEWEnter Y-peak number to see it's positionValue must be within given rangeɞINFO: Peak was not foundOUTPUT VALUES OF ROW OR COLUMNYES for choice of row or column outputEnter "YES" or "NO"OUTPUT VALUES OF ROW OF PEAKSYES for grid row, "NO" for grid columnEnter "YES" or "NO"NUMBER OF ROWEnter number of row to outputEnter integer in given rangeINFO: Peak was not foundNUMBER OF COLUMNEnter number of column to outputEnter integer in given rangeINFO: Peak was not foundSubroutine F2D_XRIIFLATFIELD V0.1 @9IRINFO: The detector system is modelled by two spheres of finite thicknesses: an inner sphere where the X-rays are detected, and an outer sphere (vacuum vessel or the detector) which attenuates the X-ray prior to possible detection. The source position is assumed to be on-axis.Enter radius of curvature of the outer surface of the X-ray detectionlayer. Units are in metres. (For the ESRF XRII/CCD Beryllium systemradius = 0.4m???, and the Aluminium system radius = 0.5m???):oA RADIUS OF DETECTION LAYER (OUTER SURFACE: METRES) Must be valid real number within given range0p_=RADIAL THICKNESS OF DETECTION LAYER (METRES) Enter thickness of X-ray detection layer (metres)Must be valid real number within given rangeEnter absorption coefficient for the detection layer at the photonwavelength/energy you wish to correct. The units are per metre and NOTper centimetre. If you have a value in per centimetre units you shouldmultiply it by 100. Values for the ESRF XRII/CCD system at differentphoton energies/wavelengths are: (to be defined)DETECTION LAYER ABSORPTION COEFFICIENT (PER METRE)Must be valid real number within given rangeEnter radius of curvature of the outer surface of the vacuum vessellayer. Units are in metres. (For the ESRF XRII/CCD Beryllium systemradius = 0.4m???, and the Aluminium system radius = 0.5m???)RADIUS OF VACUUM LAYER (OUTER SURFACE: METRES) Must be valid real number within given rangeRADIAL THICKNESS OF VACCUM/PROTECTION LAYER (METRES)Enter thickness of vacuum/protection layer (metres)Must be valid real number within given rangeEnter absorption coefficient for the detection layer at the photonwavelength/energy you wish to correct. The units are per metre and NOTper centimetre. If you have a value in per centimetre units you shouldmultiply it by 100. Values for the ESRF XRII/CCD system at differentphoton energies/wavelengths are: (to be defined)DETECTION LAYER ABSORPTION COEFFICIENT (PER METRE)Must be valid real number within given rangeFLAT FIELD CENTRE X-COORDINATE Enter X-coordinate of centre flat field measurementMust be valid real numberFLAT FIELD CENTRE Y-COORDINATE Enter Y-coordinate of centre of flat field measurementMust be valid real numberEnter the distance from the centre of the sample to the outer edge ofthe detector vaccum vessel in metres8ѷGPSAMPLE TO DETECTOR (OUTER VACUUM VESSEL) DISTANCE (METRES)Must be valid real numberIt$F@RAW PIXEL X-SIZE (MICRONS)Enter X-size of one raw pixel in microns Must be valid real number57RAW PIXEL Y-SIZE (MICRONS)Enter Y-size of one raw pixel in microns Must be valid real number?Subroutine F2D_ZOOMIN V0.17Subroutine F2D_ZOOMIN V0.17Click on two coordinates to define requiredzoom in region. Clicking just outside theimage region is equivalent to clicking onthe very edge.CLICK ON OPPOSITE CORNERS OF NEW REGIONINFO: !!!!! CORRECTING COMPILER BUG, PLEASE REPORT THIS INCIDENTINFO: !!!!! CORRECTING COMPILER BUG, PLEASE REPORT THIS INCIDENT?9Subroutine F2D_1DFEATURE V0.3 @?zGdSubroutine F2D_1DMASK V0.1 Subroutine F2D_1DMASK V0.1 FIT: MASK MENUnullnullCLEAR MASKEXIT?HELPUN-ZOOMMASK REGIONUN-MASK REGIONZOOM INCONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_ARCSLICE V0.8 Subroutine F2D_ARCSLICE V0.8 In order to define an arc, three coordinates mustbe input in the following order: starting point,a point on the arc, and the end point. Note thatchanging the order of the first and third pointwill result in the 1-D slice being the oppositeway round.ENTER ARC THREE COORDINATES (START, MIDDLE, END)Arc Slice: PixelsNot definedINFO: The "Arc-Slice" is stored in the memorySubroutine F2D_BEAMGAUSSIAN V0.7 Subroutine F2D_BEAMGAUSSIAN V0.7 ɞ~ɞ?ERROR: Problem with finding initial parameters for the Gaussian fit?C ?s33@C4@ISubroutine F2D_CAL_CAKE V0.10Subroutine F2D_CAL_CAKE V0.10SCAN_TYPEMAXIMUM_DC4@I@PANIC: The type of Lorentz/geometrical correction is unknownTYPE OF AZIMUTH/RADIAL OR 2-THETA TRANSFORMATIONThis form allows you to control various options in the re-binningfrom the 2-D detector data to an azimuthal versus 2-theta or radial distance coordinate system. Further help will be added when this option is completed.START AZIMUTHEND AZIMUTHINNER RADIUSOUTER RADIUSSCAN TYPEAZIMUTH BINSRADIAL BINSCONSERVE INT.POLARISATIONFACTORMAX. D-SPACINGGEOMETRY COR.STARTING AZIMUTH ANGLE (DEGREES)END AZIMUTH ANGLE (DEGREES)INNER RADIAL LIMIT (PIXELS)OUTER RADIAL LIMIT (PIXELS)SCAN TYPE (RADIAL, 2-THETA, Q-SPACE)NUMBER OF AZIMUTHAL BINSNUMBER OF RADIAL/2-THETA BINSINTENSITY CONSERVATIONAPPLY POLARISATION CORRECTIONPOLARISATION FACTORMAXIMUM FOR D-SPACINGS SCANS (ANGSTROMS)GEOMETRICAL CORRECTION TO INTENSITIESEnter azimuth angle for start of region to be integrated (degrees)Enter azimuth angle for end of region to be integrated (degrees)Enter radius for inner radial limit of region to be integrated (pixels)Enter radius for outer radial limit of region to be integrated (pixels)Select type of output 1-D scan: "RADIAL", "2-THETA", or "Q-SPACE"Number of bins in the azimuthNumber of bins in the 2-theta/radial directionEnter "YES" to conserve total intensity, "NO" for "2-theta scans"(integers only)Enter "YES" to apply polarisation correctionEnter ratio of horizontal to vertical polarisationEnter maximum value of range for calculation of D-spacing scans (Angstroms)Enter "YES" if scan intensities are corrected for geometryôCF@?SCAN_TYPEMAXIMUM_D!!! OUTER LIMIT MUST BE GREATER THAN INNER LIMIT !!!WORKING: CALCULATING TRANSFORMNOTE: ORIGINAL DATA STORED IN THE MEMORYDz: Azimuth/Radial DistanceRadial Distance (mm)Azimuth (Degrees): Azimuth/2-theta2-Theta Angle (Degrees)Azimuth (Degrees): Q-Space ScanQ (Inverse Nanometres)Azimuth (Degrees): D-Spacings ScanD-spacing (Angstroms)Azimuth (Degrees)Subroutine F2D_CAL_GISAXS V0.6 Subroutine F2D_CAL_GISAXS V0.6 ?Iڿ@I@8ѷC4AINnk(P?Dz?Subroutine F2D_CAL_PROJECTION V0.1 ?Subroutine F2D_CAL_PROJECTION V0.1 Subroutine F2D_CAL2_CAKE V0.10Subroutine F2D_CAL2_CAKE V0.10@AINnk(@P?nINFO: Starting to transform active data region (this may take some time)~ɞ2+w57??BINFO: (The reciprocal value is applied to the data.)<# ??kNW,Subroutine F2D_CAL2_DISTORTION V0.5 Subroutine F2D_CAL2_DISTORTION V0.5 Subroutine F2D_CALABSORPTION V0.3 Subroutine F2D_CALABSORPTION V0.3 @IERROR: The source/detector geometry is impossible, the source cannot be on the surface of the detection sphereERROR: The detector cannot be hit by the X-ray !Subroutine F2D_CALFLATFIELD V0.1 Subroutine F2D_CALIBRANT_USER V0.1 Subroutine F2D_CALIBRANT_USER V0.1 CALIBRANT_USER_FILESelect file containing list of D-spacings(In Angstroms, and in decreasing order)Select ASCII file with D-spacings to be usedfor calibration. One value per line, in unitsof Angstroms. e.g. The first 6 D-spacings forSilicon would be defined:3.13551.92011.63751.35771.24591.1086.CALIBRANT_USER_FILESubroutine F2D_CALPROFILE V0.6 ?57C4@ISubroutine F2D_CALTEMPLATE V0.1 ?@@?Subroutine F2D_COLOURS V0.12Subroutine F2D_COLOURS V0.12FIT2D: IMAGE: COLOURS MENUEXIT?HELPCOLOUR_TABLESubroutine F2D_CONTINUE V0.4 FIT2D: DISPLAY WAIT MENUnullnullEXIT?PRINTDISPLAY WAIT MENUSubroutine F2D_CORR5_SPATIAL V0.3 Subroutine F2D_CORR5_SPATIAL V0.3 @INFO: Starting to correct data for spatial distortion?B re-binning into more than four output pixels (X-direction). re-binning into more than four output pixels (Y-direction).??`bMSubroutine F2D_CORR6_SPATIAL V0.6 Subroutine F2D_CORR6_SPATIAL V0.6 @INFO: Starting to correct data for spatial distortion7'Ŭ?57B re-binning into more than three output pixels (X-direction). re-binning into more than three output pixels (Y-direction).?tzGSubroutine F2D_DEF_FS V0.3 SELECT FIRST FILE IN SERIES(click on "HELP" for list of formats)FILE O.K.Enter "YES" if the file is O.K.Enter an integer number Select LAST Input file in series(click on "INFO" for details of file types)Select the last file in the series to be input.The file selection tool will help you tosearch directories and find the required file. COULD NOT DEDUCE REQUIRED FILE SEQUENCEThe "FILE INCREMENT" is the numerical step betweeninput files. This allows, for example, everyalternative file to be input by entering 2, or todefine a series where the file number changes, 10,20, 30, etc. by entering 10. Normally, to inputevery file, 1 should be entered.FILE INCREMENTEnter integer in rangeSubroutine F2D_DISTANCE V0.1 Subroutine F2D_DISTANCE V0.1 ENTER POINTS FOR DISTANCE CALCULATIONClick on 2 X/Y coordinatesDzSubroutine F2D_DRAW_CAKE V0.3 ?8ѷ@Subroutine F2D_EDITPEAKS V0.3 Subroutine F2D_EDITPEAKS V0.3 EDIT PEAK LISTnullnullEXIT?HELPADD PEAKSClick on coordinates for new peaksCLICK ON PEAK CENTRES TO ADDPEAK LIST FULL: NO MORE PEAKS CAN BE STORED?@PREMOVE PEAKSClick on peaks to remove from listCLICK ON PEAK CENTRES TO REMOVE~ɞFULL UN-ZOOMUN-ZOOMZ-SCALINGZOOM INSubroutine F2D_ELLIPSE V0.4 ??Subroutine F2D_FIND2DGRID V0.2 Subroutine F2D_FIND2DGRID V0.2 INFO: Central cross peaks foundERROR: Peak position arrays are too smallERROR: Peaks are missing from central crossSubroutine F2D_FINDCENTRE V0.1 Subroutine F2D_FINDCENTRE V0.1 ?Subroutine F2D_FINDRINGS V0.5 Subroutine F2D_FINDRINGS V0.5 @?INFO: Calculating integrated intensities on 1 powder ringINFO: Calculating centre of gravity coordinates on 1 powder ringINFO: Calculating integrated intensities on powder ringsINFO: Calculating centre of gravity coordinates on powder ringsSubroutine F2D_FINDROTATE V0.2 Subroutine EXPG_F2D_FINDLINE V0.2 ɞSubroutine F2D_FIT2DTEST V0.4 Subroutine F2D_FIT2DTEST V0.4 ɞ~ɞINFO: Worst case fit discrepancies in pixels (spline value - measured)Subroutine F2D_FITCALIBRANT V0.5 Subroutine F2D_FITCALIBRANT V0.5 @@I@Subroutine F2D_FITCHEBYSHEV V0.2 Subroutine F2D_FITCHEBYSHEV V0.2 Subroutine F2D_FITPOWDER V0.4 Subroutine F2D_FITPOWDER V0.4 @I@Subroutine F2D_FUNTYPE V0.1 Subroutine F2D_FUNTYPE V0.1 Subroutine F2D_GSTATISTICS V0.12Subroutine F2D_GSTATISTICS V0.12Click on points to define an arbitrary polygonregion, in which various statistics will becalculated.ENTER COORDINATES TO DEFINE POLYGON REGION?PLEASE WAIT: CALCULATING POLYGON STATISTICS~ɞɞ=>##MINIMUM##MAXIMUM##MEAN##MINIMUM##RMS##SIGMA##TOTAL##INTEG_MINUS_BACKSubroutine F2D_GUI_GRID V0.5 NO HORIZONTAL COARSENO HORIZONTAL COARSE: Remove horizontal coarse grid linesNO VERTICAL COARSENO VERTICAL COARSE: Remove vertical coarse grid linesNO HORIZONTAL FINENO HORIZONTAL FINE: Remove horizontal fine grid linesNO VERTICAL FINENO VERTICAL FINE: Remove vertical fine grid linesFIT2D: IMAGE: OPTIONS: GRIDnullnullEXIT?HELPThe grid option allows the addition or removal of grid linesoverlaid on the graphics. The "coarse" grid lines will appearwhere large ticks appear on the axes, and the "fine" grid lineswill appear where the small tick marks appear on the axes. Thestyle (colour, width, line type) of each of the grid linecategories may be changed using the main keyboard menu"SET GRID STYLE" command.HORIZONTAL COARSENO HORIZONTAL COARSENO HORIZONTAL COARSE: Remove horizontal coarse grid linesNO HORIZONTAL COARSEHORIZONTAL COARSEHORIZONTAL COARSE: Add horizontal coarse grid linesVERTICAL COARSENO VERTICAL COARSENO VERTICAL COARSE: Remove vertical coarse grid linesNO VERTICAL COARSEVERTICAL COARSEVERTICAL COARSE: Add vertical coarse grid linesHORIZONTAL FINENO HORIZONTAL FINENO HORIZONTAL FINE: Remove horizontal fine grid linesNO HORIZONTAL FINEHORIZONTAL FINEHORIZONTAL FINE: Add horizontal fine grid linesVERTICAL FINENO VERTICAL FINENO VERTICAL FINE: Remove vertical fine grid linesNO VERTICAL FINEVERTICAL FINEVERTICAL FINE: Add vertical fine grid linesUPDATESubroutine F2D_GUI_ROI V0.1 Subroutine F2D_GUI_ROI V0.1 imageFIT2D: REGION OF INTEREST MENUnullnullEXIT?HELPUN-ZOOMFULLZOOM INSubroutine F2D_GUI_SCALEDSUB V0.3 Subroutine F2D_GUI_SCALEDSUB V0.3 MATHS_SUB_SCALE_FACTORFailed to allocate temporary memoryEnter the scale factor to be applied to the data in thememory prior to the result being subtracted from the datain the current (displayed) imageɞ~ɞSCALE FACTOR APPLIED TO MEMORY PRIOR TO SUBTRACTIONEnter value within given rangenullnullO.K.?HELPCANCELFACTORSCALE FACTOR APPLIED TO MEMORY PRIOR TO SUBTRACTIONEnter value within given rangeINCREASE 1%?GINCREASE 10%?INCREASE 50%?DECREASE 1%DECREASE 9%DECREASE 33%Z-SCALINGMATHS_SUB_SCALE_FACTORSubroutine F2D_IN2DCLUT V0.2 Subroutine F2D_IN2DCLUT V0.2 WARNING: Error in opening file: ERROR: Problem in inputting header; wrong format ?DISTORTION CORRECTION LOOK-UP TABLE V02.00ERROR: This file is not a valid distortion correction LUT fileX_PIXEL_SIZE =ERROR: "X_PIXEL_SIZE" Corrupted fileY_PIXEL_SIZE =ERROR: "Y_PIXEL_SIZE" Corrupted fileX_NUMBER =ERROR: "X_NUMBER" Corrupted fileY_NUMBER =ERROR: "Y_NUMBER" Corrupted fileBYTES_PER_PIXEL_LUT =ERROR: "BYTES_PER_PIXEL_LUT =" Corrupted fileWARNING: Only 1 byte per pixel LUT is availableFLAT_FIELD_STORED =ERROR: "FLAT_FIELD_STORED" Corrupted filetTFF_OFFSET =ERROR: "FF_OFFSET" Corrupted fileFF_SCALING =ERROR: "FF_SCALING" Corrupted file!!! END OF HEADER SECTION !!!ERROR: Header terminator corrupted ERROR: The look-up table is too big for the internal arraysSubroutine F2D_INITGRIDSEARCH V0.11Click on peak to define starting point for thepeak search. It is best to choose a reasonablycentral peak, by it must be positioned suchthat the row and column do not contain anymissing peaks, and neither does the row above,nor the column to the left.Click on centre of starting peak?Click on next peak to the right of the startingpeak. This defines a horizontal search vector.Click on centre of next peak right horizontallyClick on next peak above the starting peak.This defines a vertical search vector.Click on next peak vertically upwards (left most)CONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_INP_CAKE V0.5 Subroutine F2D_INP_CAKE V0.5 @Click on a coordinate to define the startingazimuth of the region to be transformed to2-theta or other scans. If you click in themessage box (yellow, therefore active), thenthe X-axis (azimuth 0.0) will be used as thestart of the region.STARTING AZIMUTH (CLICK HERE FOR 0.0)?DClick on a coordinate to define the endazimuth of the region to be transformed to2-theta or other scans. If you click in themessage box (yellow, therefore active), thenthe complete 360.0 of data will be used.END AZIMUTH (CLICK HERE FOR START + 360.0)@Click on a coordinate to define the inner radiusof the "CAKE" region to be transformed. By clickingin the prompt box (yellow therefore active) the beamcentre will be used and the output scans will bedefined starting from 0.0 angle or radius in the2-theta / radial direction.INNER LIMIT (CLICK HERE FOR BEAM CENTRE)Click on coordinate to define outer limitof "cake" region to be transformed.CLICK TO DEFINE OUTER LIMITWARNING: Outer radial limit is less than inner limit8ѷSubroutine F2D_INP_CORRECTION V0.1 CONTROL OF DETECTORDISTORTION CORRECTIONFLAT-FIELDFF FILEFF SCALEFF MULTIPLIERSPATIAL DIS.SD FILE8ѷZAPPLY FLAT FIELD CORRECTIONNAME OF FLAT-FIELD FILEAPPLY SCALING AFTER FLAT FIELD CORRECTIONFLAT FIELD MULTIPLIER TO APPLYAPPLY SPATIAL DISTORTION CORRECTIONNAME OF SPATIAL DISTORTION FILEEnter "YES" to input a flat fieldimage and apply a correctionSelect file containing the flat-fieldimage for correctionEnter "YES" to multiply correctedimage by the user controlled scale factorScale factor to multiple imageafter flat-field correctionEnter "YES" to input a spatial distortion defining function and apply correctionSelect file containing the spatialdistortion defining functionControl flat-field and spatial distortioncorrectionSubroutine F2D_INP_POLARISATION V0.3 Subroutine F2D_INP_POLARISATION V0.3 Enter "YES" if you want to correct for the effects of beam polarisation.FIT2D will take into account the 2-D effects as function of both 2-thetaangle and azimuth angle. However, if you correct for the effects ofpolarisation here it will be important to make sure that they are notcorrected a second time by subsequent processing software !CORRECT FOR X-RAY BEAM POLARISATIONEnter "YES" or "NO"Enter the "polarisation" of the main beam on the sample. This is defined as(I_h - I_v) / (I_h + I_v), where I_h is the horizontal component of theintensity and I_v is the vertical. (The horizontal should correspond withthe X-direction on an image. Normally for a synchrotron the polarisationis positive and approaches 1.0. e.g. Station 9.6 at the SRS Daresbury hasbeen measured to have a polarisation of 0.86. This is a value which isdependent on the X-ray source, beam-line mirrors, and on the monochromator.The beam-line scientist should be able to give a good estimate of thisnumber.?BEAM POLARISATION (AT SAMPLE)Must be valid real number within given rangeEnter the type of "Lorentz" correction which you want to apply to the output intensities. At present the following choices are available: NONE: No correction factors applied PARTIAL POWDER (2-THETA SCAN): Correct intensities to be equivalent to a 2-theta scan with a single counter. This allows standard powder diffraction software to apply their own Lorentz corrections.TYPE OF LORENTZIAN CORRECTION TO APPLYENTER ONE OF AVAILABLE CHOICESnullNONEPARTIAL POWDER (2-THETA SCAN)ERROR: Unknown user choiceSubroutine F2D_INP_PARAMETERS V0.7 fit2d.parPARAMETER FILE NAMEName of input file containing fit parametersUnacceptable inputDIRECTUNFORMATTEDWARNING: Error in opening file$FFF_STARTWARNING: This is not a Flexible File Format (FFF) file and cannot be read$BIG_ENDIANTRUEdata_maskWARNING: Data mask not found setting mask to zero (no mask)WARNING: Not all of the mask data could be input (too big)total_paramsnumber_featuresnumber_resultsx_ordery_orderx_min_polyERROR: Old parameter file: not compatible with new polynomial fittingy_min_polyx_max_polyy_max_polyapply_weightsaccuracyiters_per_parammodel_evolvedisplay_frequencyfast_displayhalt_criterionhalt_valueparameter_valuesparameter_descriptionsparameter_scalesparameter_namesresult_names?Subroutine F2D_INP_ELLIPSE V0.13Subroutine F2D_INP_ELLIPSE V0.13Click on initial powder ring to be used fordetermining the tilt/ beam centre.CLICK ON POWDER RING TO FITClick on a coordinate to define one side oftheprofile search limit. The search limit willbe symmetric either side of ring positions.Ideally the whole of the choosen powder ringsshould lie within the search annuli. Similarlyother rings should not enter the search region.However a double ring which lies completelywithin the search region may be fittedsuccessfully provided that the intensities ofthe two components are constant around theazimuth or vary together.CLICK ON RING PROFILE SEARCH LIMITDzSubroutine F2D_INP_PROJECTION V0.4 Subroutine F2D_INP_PROJECTION V0.4 @Click on a coordinates to define the end of the projection line of the 1-D scan.ENTER END OF PROJECTION LINE (ONE COORDINATE)?Click on two coordinates to define the projectionline i.e. the line to form the X-axis of the1-D output.ENTER ENDS OF PROJECTION LINE (TWO COORDINATES)Click on two coordinates to define the extentof the region to be projected onto the line.These two coordinates should normally definea line roughly perpendicular to the projectionline.ENTER LIMITS OF PROJECTION REGIONA rectangle has been drawn around theprojection region.Press the "YES" button to proceed, or the"NO" button to re-define the regionIS THE DEFINED PROJECTION REGION O.K.Enter "YES" or "NO" onlySubroutine F2D_INPRADIA V0.7 Subroutine F2D_INPRADIA V0.7 Click on any other rings to be used in fittingthe tilt / beam centre. It is possible tocontinue without further rings, but generallyit is better to use several rings.CLICK ON OTHER RINGS TO USE IN FITTING TILTDzSubroutine F2D_INPUTMODEL V0.5 Subroutine F2D_INPUTMODEL V0.5 ENTER PEAK TYPEEXIT?2-D POLYNOMIALThe 2-D polynomial is already defined2-D POLYNOMIAL X ORDEROrder of polynomial function in X-directionMust be within specified boundsPOLYNOMIAL Y ORDEROrder of polynomial function in Y-directionMust be within specified boundsINITIALISATION POLYNOMIAL X ORDEROrder of initialisation polynomial function in X-directionMust be within specified boundsINITIALISATION POLYNOMIAL Y ORDEROrder of initialisation polynomial function in Y-directionMust be within specified boundsFailed to fit polynomial coefficientsMASKROW-LINEA "row-line" is already defined (1 maximum)GAUSSIANPOLAR GAUSSIANTWIN POLAR GAUSSIANGAUSSIANPOLAR GAUSSIANTWIN POLAR GAUSSIANPOLAR GAUSSIANTWIN POLAR GAUSSIANCLICK ON SYMMETRY CENTREPlace cursor on centre of polar symmetryCLICK ON PEAK CENTREPlace cursor on centre of peak to be definedCLICK ON FIRST (OR RADIAL) HALF HEIGHT COORDINATEPlace cursor on first half height positionCLICK ON SECOND (OR ANGULAR) HALF HEIGHT COORDINATEPlace cursor on second half height position@TWIN POLAR GAUSSIANCLICK ON TWIN PEAK CENTREPlace cursor on centre of twin peakGAUSSIAN?Yc@POLAR GAUSSIANTWIN POLAR GAUSSIANREMOVE LAST PEAKTWIN POLAR GAUSSIANSubroutine F2D_INQ_INTEGRATE V0.6 Subroutine F2D_INQ_INTEGRATE V0.6 PANIC: The type of Lorentz/geometrical correction is unknownCONTROL OF RADIAL, 2-THETA, OR QSCAN RE-BINNING PARAMETERSSCAN TYPECONSERVE INT.POLARISATIONFACTORGEOMETRY COR.MAX. ANGLESCAN BINSMAX. D-SPACINGSCAN TYPE (D, RADIAL, 2-THETA, Q-SPACE)INTENSITY CONSERVATIONAPPLY POLARISATION CORRECTIONPOLARISATION FACTORGEOMETRICAL CORRECTION TO INTENSITIESMAXIMUM 2-THETA ANGLE OF SCAN (DEGREES)NUMBER OF BINS IN OUTPUT SCANMAXIMUM FOR D-SPACINGS SCANS (ANGSTROMS)Select type of output 1-D scan: "RADIAL", "2-THETA", or "Q-SPACE"Enter "YES" to conserve total intensity, "NO" for "2-theta scans"(integers only)Enter "YES" to apply polarisation correctionEnter ratio of horizontal to vertical polarisationEnter "YES" if scan intensities are corrected for geometryEnter maximum 2-theta angle of scan (degrees)Enter number of 2-theta or radial bins in output scanEnter maximum of range for calculation of D-spacing scans (Angstroms)?C4@I:oBF@SCAN_TYPEDzAIP@?Subroutine F2D_LORENTZ V0.2 Subroutine F2D_LORENTZ V0.2 @IC4?Subroutine F2D_LSQCIRCLE V0.4 Subroutine F2D_LSQCIRCLE V0.4 B7'Ŭ57WARNING: Problem fitting the circleSubroutine F2D_LSQELLIPSE V0.4 Subroutine F2D_LSQELLIPSE V0.4 ?}pB=L7'Ŭ57WARNING: Problem fitting the ellipseɞ?Iڿ@ISubroutine F2D_LSQMFIT V0.15Subroutine F2D_LSQMFIT V0.157'ŬB57WARNING: Problem fitting the model to the dataWARNING: Problem fitting the model to the data?C4@I@@ l?@@,U@kf@=>Loptimise??6C5'?zGdSubroutine F2D_LSQPOLARISATION V0.1 Subroutine F2D_LSQPOLARISATION V0.1 ERROR: There are no coordinates to fit !Subroutine F2D_LSQPOLARISATION V0.1 C4@I7'ŬB57=LWARNING: Problem fitting the polarisation factorSubroutine F2D_MASKARC V0.3 Subroutine F2D_MASKARC V0.3 In order to define an arc, three coordinates mustbe input in the following order: starting point,a point on the arc, and the end point. Note that(This option can be used to define a straightline !) ENTER ARC THREE COORDINATES (START, MIDDLE, END)WARNING: Arc centre cannot be calculated?BWIDTH OF ARC (PIXELS)Enter number of pixels for width of masking arcEnter integer within given range@?@II@@?Subroutine F2D_MASKPEAKS V0.6 Subroutine F2D_MASKPEAKS V0.6 Click on coordinates to define centre ofcircular regions to mask-out. Click in prompttest region to end defining coordinates.CLICK ON PEAKS TO REMOVESubroutine F2D_MASKPOLYGON V0.9 Subroutine F2D_MASKPOLYGON V0.9 Click on coordinates to define vertices ofpolygon region. (Clicking just outside theimage region is equivalent to clicking onthe edge.) Click in the prompt text box tofinish entering vertices.ENTER COORDINATES OF MASKED REGIONPLEASE WAIT: CALCULATING POLYGON MASKSubroutine F2D_NUMBERS V0.5 Subroutine F2D_NUMBERS V0.5 Click on centre of region, for which intensityvalues are to be output. The intensity informationof the 11 * 11 region centred on the clickedpixel will be output in the terminal window.When finished click in the text prompt box.CLICK ON IMAGE PIXEL~ɞɞIt#O? . . . . . . . . . . . . . . . . . . . . . . . . .Subroutine F2D_PEAKSEARCH V0.9 Subroutine F2D_PEAKSEARCH V0.9 INFO: Data smoothed or copied?@PSubroutine F2D_PEAKXY V0.4 ?@?Subroutine F2D_PGAUINT V0.1 Subroutine F2D_PGAUINT V0.1 @Subroutine F2D_PIXELXY V0.10Subroutine F2D_PIXELXY V0.10Click on coordinate to obtain informationon position and intensity. If the experimentalgeometry has been defined, d-spacing informationwill also be output.CLICK ON IMAGE PIXEL?@P@@=Subroutine F2D_POLYNOMIAL V0.7 Subroutine F2D_POLYNOMIAL V0.7 ?~ɞORDER OF POLYNOMIALEnter order of polynomial for fitting scanValue must be within given rangeSubroutine F2D_POSITION V0.3 CLICK ON A CORNER OF REQUIRED DISPLAY REGIONCLICK ON A CORNER OF DISPLAY REGIONCLICK ON OPPOSITE CORNER OF REQUIRED DISPLAY REGIONCLICK ON OPPOSITE CORNER OF DISPLAY REGIONSubroutine F2D_PROJECTION V0.7 Subroutine F2D_PROJECTION V0.7 CALCULATING PROJECTION (this may take a while)@1-D Projection: PixelsNot definedINFO: The "Projection" is stored in the memory?Subroutine F2D_PROJECTFIT V0.2 Subroutine F2D_PROJECTFIT V0.2 CALCULATING PROJECTION (this may take a while)@ProjectionPixelsMASK OUT POINTS TO IGNOREPixelsOPTIMISING SYMMETRY POINT?CLICK TO CONTINUE??Subroutine F2D_ROWLINE V0.4 Subroutine F2D_ROWLINE V0.4 Subroutine F2D_ROWLINE V0.4 : Experimental geometry not defined@Subroutine F2D_RTHETA2 V0.10Subroutine F2D_RTHETA2 V0.10@@?nINFO: Starting to transform active data region (this may take some time)~ɞ57??2+wBINFO: (The reciprocal value is applied to the data.)<# ??kNW,Subroutine F2D_SATURATED V0.3 Subroutine F2D_SATURATED V0.3 THRESHOLD VALUE (INCLUSIVE)Enter threshold value for counts pixelsEnter valid realSubroutine F2D_SLICE V0.7 Subroutine F2D_SLICE V0.7 ENTER ENDS OF SLICE (TWO COORDINATES)Click on 2 X/Y coordinates, to define slice1-D Slice: PixelsNot definedINFO: The "Slice" is stored in the memorySubroutine F2D_SRADIAL V0.7 Subroutine F2D_SRADIAL V0.7 It$WARNING: Active Data Region (ADR) extends outside valid region ofspline. Pixels outside the valid region will be ignored.INFO: The valid region of the spline correction function is:In order to avoid over-loaded pixels being re-binned and their intensityspread out to an undetermined value, you can enter a "over-loaded" pixelvalue. All input pixels which have this value or more, will cause one ormore output pixels to be incremented by the value regardless of the normalproportional are re-binning algorithm. Thus over-loaded pixels in theoutput image can be easily identified and ignored.(This can be turned-off by entering a very large value.)~ɞOVER-LOADED PIXEL VALUEEnter a real value within given rangeFor efficiencies sake many rows of the distortion functions can be calculatedin one call to the NAG subroutine which performs the task. However, to storethe results extra memory is required. (The memory is allocated automaticallyfrom the machines virtual memory and is de-allocated after the spatialdistortion correction is finished and the storage is no longer necessary.)Thus, the value entered here choses a compromise between using more memoryand taking longer to calculate all the necessary distortion values. If themachine has plenty of available memory (virtual) a larger number such as 100may be more efficient. However, if the machine is short of virtual memorye.g. you have already received an error message that memory allocated hasfailed, then a smaler value will be appropriate. NOTE: Too big a number may be counter-productive as it may causeexcessive page faulting.NUMBER OF ROWS OF DISTORTION FUNCTIONS TO CALCULATED IN A BLOCKEnter an integer within given rangeSubroutine F2D_TILTDISPLAY V0.3 Subroutine F2D_TILTDISPLAY V0.3 ?Subroutine F2D_TILTRADIAL V0.10Subroutine F2D_TILTRADIAL V0.10@?nINFO: Starting to re-bin 2-D data to a 1-D profile, this can take some time for large arrays.~ɞ57??BINFO: (The reciprocal value is applied to the data.)<# C4@IDz??kNW,Subroutine F2D_TRANSFORM V0.4 Subroutine F2D_TRANSFORM V0.4 @ROTATION PARAMETERCONTROL FORMX-PIXEL SIZEY-PIXEL SIZEX-CENTREY-CENTREANGLEX-TRANSLATIONY-TRANSLATIONX-START OUTY-START OUTX-END OUTY-END OUTSIZE OF HORIZONTAL PIXELS (MICRONS)SIZE OF VERTICAL PIXELS (MICRONS)X-CENTRE OF ROTATION (PIXELS)Y-CENTRE OF ROTATION (PIXELS)ROTATION ANGLE (DEGREES)X-COMPONENT OF TRANSLATION VECTORY-COMPONENT OF TRANSLATION VECTORSTARTING PIXEL OF OUTPUT REGION (X)STARTING PIXEL OF OUTPUT REGION (Y)END PIXEL OF OUTPUT REGION (X)END PIXEL OF OUTPUT REGION (Y)Enter dimension of pixels horizontally, as displayed (microns)Enter dimension of pixels vertically, as displayed (microns)X-coordinate of centre of rotation (pixels)Y-coordinate of centre of rotation (pixels)Angle of rotation anticlockwise (degrees)Number of pixels to translate horizontallyNumber of pixels to translate verticallyMinimum pixel of output region (horizontally)Minimum pixel of output region (vertically)Maximum pixel of output region (horizontally)Maximum pixel of output region (vertically):oF@ôCIt$C4@IEnter rotation centre, angle of rotation,and output region limitsTRANSFORMING: Please wait?Subroutine F2D_VIGNETTING V0.4 @It$Enter the thickness of the grid mask in microns, which causes off-axisshadowing. If the grid mask has been manufacturered with counter-sunkholes, e.g. the brass masks for the X-ray Image Intensifiers at thePhoton Factory, this will probably be the thickness of the final smallhole. (This of course assumes that the largest off-axis angle is smallenough that it is only the final part which shadows the hole.) At the ESRF the thin copper plated masks used for the Beryllium XRII havebeen measured to be 255 microns thick, and the solid copper mask usedfor the larger alumimium XRII should be 500 microns.?GPMASK THICKNESS (microns)Value must be within given rangeINFO: The beam centre does not need to be specified accurately. An approximate centre is appropriate.ɞ.?@oSubroutine F2D_1DMASKREGION V0.1 Subroutine F2D_1DMASKREGION V0.1 CLICK ON OPPOSITE CORNERS OF THE RECTANGLEClick on 2 X/Y coordinates, to define rectangleA Subroutine F2D_CORR2_RADIAL V0.8 Subroutine F2D_CORR2_RADIAL V0.8 @?nINFO: Starting to re-bin 2-D data to a 1-D profile, with correction for spatial distortion, this can take some time for large arrays.~ɞ57??B<# C4@IDz??kNW,Subroutine F2D_FINDLINE V0.2 Subroutine F2D_FINDLINE V0.2 ?Subroutine F2D_FINDLLQUAD V0.5 Subroutine F2D_FINDLLQUAD V0.5 ɞ?WARNING: Peak search problem, starting cross contains missing peak?Subroutine F2D_FINDLRQUAD V0.5 Subroutine F2D_FINDLRQUAD V0.5 ɞ?WARNING: Peak search problem, starting cross contains missing peak?Subroutine F2D_FINDULQUAD V0.5 Subroutine F2D_FINDULQUAD V0.5 ɞ?WARNING: Peak search problem, starting cross contains missing peak?Subroutine F2D_FINDURQUAD V0.5 Subroutine F2D_FINDURQUAD V0.5 ɞ?WARNING: Peak search problem, starting cross contains missing peak??@?Subroutine F2D_GRIDBEAMCENTRE V0.1 ~ɞɞSubroutine F2D_INPUTROWLINE V0.7 Subroutine F2D_INPUTROWLINE V0.7 ColumnsIntensityLOWEST ORDERLowest order to be simulatedMust be within set limit, which are program definedHIGHEST ORDERHighest order to be simulatedMust be within set limit, which are program defined@@@@ROW-LINE CENTRE X-COORDINATEX-coordinate of centre of lower (or right) row-lineEnter valid real valueROW-LINE CENTRE Y-COORDINATEY-coordinate of centre of lower (or right) row-lineEnter valid real valueRotation angle of the row line from row-line "equator" The angle is to be defined in degrees (positive means anticlockwise)´BROW LINE ROTATIONMust be within set limits@IC4A~ɞPEAK TO PEAK DISTANCESpacing between Bragg peaksMust be within set limitsAZERO ORDER PEAK DISTANCEDistance from row line centre to zero order peak centreMust be within set limits?Ratio of reflected row-line peak intensities to those of theprimary row-line peaksLEFT RIGHT INTENSITY RATIOMust be within set limits@ RADIAL STANDARD DEVIATIONStandard deviation of peaks in the radial directionMust be within set limits=Standard deviation of peaks in the angular direction(in degrees)ANGULAR STANDARD DEVIATIONMust be within set limits('Centre of Peak order ', i3,' is outside data region') please input intensity?>Subroutine F2D_LSQ1DSYMMETRY V0.1 Subroutine F2D_LSQ1DSYMMETRY V0.1 @@7'ŬB57WARNING: Problem fitting the symmetry centre?Subroutine F2D_LSQCALIBRANT V0.6 Subroutine F2D_LSQCALIBRANT V0.6 ERROR: There are no coordinates to fit !Subroutine F2D_LSQCALIBRANT V0.6 :o:o+ >33<# 7'ŬB57WARNING: Problem fitting the powder patternɞSubroutine F2D_LSQGAUSSIAN V0.6 Subroutine F2D_LSQGAUSSIAN V0.6 >?@=A=L@@8QB57WARNING: Problem fitting the GaussianSubroutine F2D_LSQPOWDER V0.8 Subroutine F2D_LSQPOWDER V0.8 ERROR: There are no coordinates to fit !Subroutine F2D_LSQPOWDER V0.8 :o:o>33<# ; 7'ŬB57WARNING: Problem fitting the powder patternɞSubroutine F2D_PEAKRZ V0.1 Subroutine F2D_PEAKSTRIP V0.10Subroutine F2D_PEAKSTRIP V0.10ɞ?Subroutine F2D_POLYFIT V0.7 A?Polynomial Fit to DataX-axisFitted ValuesACCEPT FIT ("NO" TO TRY ANOTHER ORDER)Enter "YES" to accept this fit, "NO" to try another order of fitAnswer "YES", or "NO"ORDER OF POLYNOMIALEnter order of polynomial for fitting scanValue must be within given range~ɞɞ@>Subroutine F2D_RINGCOORDS V0.8 Subroutine F2D_RINGCOORDS V0.8 ?5@@?n?ɞ@@???Subroutine F2D_RINGOUTLIERS V0.1 Subroutine F2D_RINGOUTLIERS V0.1 @@@Dz:o@@Subroutine F2D_PEAKINTEGRATE V0.3 Subroutine F2D_PEAKINTEGRATE V0.3 Subroutine FIO_FILEOPEN V0.3 Subroutine FIO_FILEOPEN V0.3 READWRITEREAD_ASCIIWRITE_ASCIISubroutine FIO_FILEOPEN V0.3 Subroutine FIO_FREAD_INTEGER V0.2 iSubroutine FIO_FREAD_CARRAY V0.3 aSubroutine FIO_FREAD_IARRAY V0.4 aSubroutine FIO_FREAD_L1ARRAY V0.3 aSubroutine FIO_FREAD_RARRAY V0.4 aSubroutine FIO_FREAD_REAL V0.2 rSubroutine FIO_FREAD_STRING V0.4 s Subroutine FIO_GUI_INPUT V0.48Subroutine FIO_GUI_INPUT V0.48Data for the program main data array is required, normallyinput a file stored on disk. The file selection tool willhelp you to search directories and find the required file. The following file formats are presently supported: . : (no extension) ESRF Gas detector format .bin: BINARY user specified format .bsl: BSL (Daresbury) / OTOKO (Hamburg) format .chi: CHIPLOT ASCII 1-D X/Y graph format .cor: BINARY user specified format .cor2: BINARY user specified format .corr: BINARY user specified format .edf: "KLORA" or BINARY format .f2d: FIT2D format .final: BINARY user specified format .gel: Molecular Dynamics IMAGEQUANT (tiff) format .inf: FUJI BAS-2000 (BAS-1500) format .info: BINARY user specified format .image: MarResearch IP scanner format .img: FUJI BAS-2000 (BAS-1500) format OR HAMAMATSU CCD format OR ADSC format .mar1200: MarResearch IP scanner format .mar1600: MarResearch IP scanner format .mar2000: MarResearch IP scanner format .mar2300: MarResearch IP scanner format .mar3450: MarResearch IP scanner format .mccd: TIFF format from MAR CCD camera .osc: Rigaku R-AXIS IV format .pck: Old compressed MarResearch format .pmi: PHOTOMETRICS CCD format .spe: PRINCETON INSTRUMENTS CCD format .tif: Adobe TIFF format .tiff: Adobe TIFF format Files with numerical extensions e.g. .001 will be tested to see if they appear to be Bruker area detector frame data file Files with unknown extensions will invokea menu containing the available choices. hmhmGAS 2-D DETECTOR (ESRF)BRUKER_dkBRUKER_ffBRUKERgelIMAGEQUANTbincorcor2corrfinalBINARYbslBSL/OTOKOchiCHIPLOTedfKLORABINARYimageMAR FORMATinfFUJI BAS-2000infoBINARYimginfFUJI BAS-2000infINFFUJI BAS-2000INFADSCHAMAMATSU PHOTONICSf2dFIT2D STANDARD FORMATmar1200mar1600mar2000mar2300mar3450MAR FORMAToscRIGAKU R-AXISpckMAR-PCKpmiPHOTOMETRICS CCD FORMATspePRINCETON CCD FORMATtiftiffmccdTIFFUNKNOWN EXTENSION: SELECT FILE FORMAT:CANCEL?HELPThe file format of the file that you have specifiedis not known from it's file extension type. You canchoose one of the available input formats. If theformat you need is not available press the "CANCEL"button. (In the "INPUT" command of the "KEYBOARD" interfacethere may be more input file formats available.)ADSCADSCBINARYBINARYBRUKERBRUKERBSL/OTOKOBSL/OTOKOCHIPLOTCHIPLOTFIT2DFIT2D STANDARD FORMATFUJI (BAS)FUJI BAS-2000HAMAMATSUHAMAMATSU PHOTONICSIMAGEQUANTIMAGEQUANTKLORAKLORAMARMAR FORMATMAR-PCKMAR-PCKPHOTOMETRICSPHOTOMETRICS CCD FORMATPRINCETONPRINCETON CCD FORMATRIGAKU R-AXISRIGAKU R-AXISTIFFTIFFFAILED TO FIND NEW "SEQUENCE" FILE:CAN'T INPUT ANOTHER FILE IN AN UNDEFINED SEQUENCEINPUTTING DATA FROM FILEGAS 2-D DETECTOR (ESRF)~ɞIMAGEQUANTGOBINARYADSCBRUKERBSL/OTOKOCHIPLOT? FIT2D STANDARD FORMATFUJI BAS-2000HAMAMATSU PHOTONICSGKLORAMAR FORMATGMAR-PCKPHOTOMETRICS CCD FORMATFPRINCETON CCD FORMATRIGAKU R-AXISTIFFG6WARNING: Unknown file formatWARNING: PROBLEM INPUTTING DATA FROM FILE:#OVERLOAD_VALUE#INPUT_FORMATX_PIXEL_SIZEY_PIXEL_SIZEWARNING: DATA NOT DEFINED CORRECTLYSubroutine FIO_GUI_OUT V0.5 Subroutine FIO_GUI_OUT V0.5 BINARYBSL/OTOKOCHIPLOTDENZO MARFIT2D FORMATGSASPowderCIFSPREAD SHEETTIFF 8 BITTIFF 16 BITOUTPUT FILE COULD NOT BE OPENEDERROR OCCURRED DURING FILE OUTPUTSubroutine FIO_GUI_OUTPUT V0.9 Subroutine FIO_GUI_OUTPUT V0.9 Subroutine FIO_IN_1DASCII V0.1 Subroutine FIO_IN_1DASCII V0.1 READ_ASCIIWARNING: Problem opening input file WARNING: Data items missing from fileWARNING: Problem inputting data value:Subroutine FIO_IN_FREEFORMAT V0.3 Subroutine FIO_IN_FREEFORMAT V0.3 WARNING: File could not be opened successfullySample of start of the input file:VERTICAL COLUMNSVERTICAL COLUMNSEnter general type of data format or file layout fromone of the following catergories: (more choices will be added) VERTICAL COLUMNS : file with one or more data-sets on each lineTYPE OF DATA FORMATEnter one of the given choicesNUMBER OF LINES TO IGNORENumber of lines at the start of the file to ignoreEnter integer in given rangeNUMBER OF CHARACTERS TO IGNORENumber of characters/spaces to ignore at the start of each lineEnter integer in given rangeNumber of coordinates read from the file for the data-set.Enter 0 or a number larger than the number of values in the file to read until the end of the file.NUMBER OF COORDINATESEnter integer in given rangeCOLUMN NUMBER FOR X-COORDINATESEnter number of column of numbers containing X-values or 0 for no X-coordinatesEnter integer in given rangeCOLUMN NUMBER FOR Y-COORDINATESEnter number of column of numbers containing Y-valuesEnter integer in given range Token =Subroutine FIO_INP_OUTPUT V0.2 CHOOSE OUTPUT FILE FORMATnullnullnull?HELPCANCELSubroutine FIO_INPUT V0.54Subroutine FIO_INPUT V0.54GAS 2-D DETECTOR (ESRF)PHOTOMETRICS CCD FORMATIMAGEQUANTNEW MAR CODEPRINCETON CCD FORMATNEW MAR CODEFUJI BAS-2000IMAGEQUANTRIGAKU R-AXIS1-D ASCII FREE FORMATFIT2D STANDARD FORMATFILE FORMATEnter one of available choices?1-D ASCII FREE FORMATEnter name of file containing 1-D dataX-axis Intensity~ɞ2-D ASCII FREE FORMATADSC DETECTOR FORMATBINARY (UNFORMATTED)BRUKER FORMATBSL FORMATCHIPLOT FORMAT? COMPRESSED DIFFRACTION DATAGDIP-2000 (MAC SCIENCE)GKLORAESRF DATA FORMATINFO: Problems caused by the "ESRF data format" are unfortunately far too common. The orginal software available from the ESRF is far too bugged to be usable. It is not available for many of the operating systems on which FIT2D is required to run, and users use. Therefore I (and others) have written their own input routines. However, this is only a partial solution. This is because the "format" is totally inadequately defined, and even where defined there are huge differences between the specification and the files actually produced. It is also an unnecessarily complicated format with certain data compression schemes almost totally undefined. Therefore this code has only been written to input a small subset of the possible file formats which could be produced. In particular all header information must be found before the image data, and data compression is not supported.INFO: imgCIF/CBF is a format developed with support of the IUCr, to try to end this sort of problem.FIT2D STANDARD FORMATFUJI BAS-2000GAS 2-D DETECTOR (ESRF)HAMAMATSU PHOTONICSHELPHUFFMANIMAGEQUANTGOMAR RESEARCH FORMATNEW MAR CODEMAR RESEARCH FORMATNOTE: USING NEW INPUT CODEMAR-PCK FORMATPDS FORMAT PHOTOMETRICS CCD FORMATFPMC FORMATWARNING: Format support removedPRINCETON CCD FORMATRIGAKU R-AXISTIFFUNKNOWNUSER INTENSITIESWESS FORMATC~#OVERLOAD_VALUE#INPUT_FORMATX_PIXEL_SIZEY_PIXEL_SIZEWARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGWARNING: File input failed during a macro. Macro automatically terminated.WARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGWARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGWARNING: File input failed during a sequence. Sequence terminated.WARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGSubroutine FIO_OPENFILE V0.3 FILE NAMEEnter Name of fileUnacceptable inputError in opening file, Please retype nameSubroutine FIO_OUT_PDS V0.3 Subroutine FIO_OUT_PDS V0.3 Enter name of output file WRITEC4@IBSubroutine FIO_OUTPUT V0.30Subroutine FIO_OUTPUT V0.30FILE FORMATEnter one of available choices3CAM4-BYTE INTEGERSBINARY (UNFORMATTED)DUMPBSL FORMATCBFWARNING: NOT PRESENTLY AVAILABLECHIPLOTDENZO MAR FORMATCOMPRESSED DIFFRACTION DATAFIT2D STANDARD FORMATGSASHEADER FILESMCA FORMATHUFFMAN"KLORA" FORMATklora.edfNO HEADER FILESPowderCIFSPREAD SHEETTIFF INTEGERSSubroutine FIO_FREAD_SEARCHITEM V0.5 !Subroutine FIO_IN_2DASCII V0.3 Subroutine FIO_IN_2DASCII V0.3 WARNING: File could not be opened successfullyX NUMBER PIXELSNumber of data elements horizontally in each line of dataEnter integer in rangeY NUMBER PIXELSNumber of data elements vertically (number of lines)Enter integer in rangeWARNING: Internal dimensions are too small to input all of the dataSample of start of the input file:NUMBER OF LINES TO IGNORENumber of lines at the start of the file to ignoreEnter integer in given range WARNING: Failed to convert: BColumnsRowsIntensity?@bMSubroutine FIO_IN_ADSC V0.1 Subroutine FIO_IN_ADSC V0.1 ADSC DETECTOR DATA FILE NAMEName of file containing ADSC detector format dataUnacceptable inputError in opening file, Please retype nameWARNING: Error in reading start of header: image not input WARNING: Error in reading keyword WARNING: Error in reading key valueBYTE_ORDERbig_endianlittle_endianTYPEunsigned_shortGWARNING: The image data in this file has been written using an unsupported data type. It cannot be input.SIZE1SIZE2HEADER_BYTESDIMERROR: Only 2-dimensional data supported at presentWARNING: Problem of converting key valueERROR: The size of header was not foundERROR: The size of the image was not foundColumnsRowsIntensitySubroutine FIO_IN_BAS2000 V0.10Subroutine FIO_IN_BAS2000 V0.10READ_ASCIIDATA FILE NAME (.inf file)Name of file containing file headerUnacceptable inputREAD_ASCIIWARNING: Error in opening header file, Please retype name WARNING: Problem reading from .inf file 57X PIXEL SIZE NOT PROPERLY DEFINEDWARNING: X pixel size not properly defined8ѷY PIXEL SIZE NOT PROPERLY DEFINEDWARNING: Y pixel size not properly definedNUMBER OF BITS IS NOT PROPERLY DEFINEDWARNING: Number of bits is not properly definedNUMBER OF PIXELS IN X-DIRECTION UNDEFINEDWARNING: Number of pixels in X-direction undefinedNUMBER OF PIXELS IN Y-DIRECTION UNDEFINEDWARNING: Number of pixels in Y-direction undefinedSENSITIVITY UNDEFINEDWARNING: Sensitivity undefinedLATITUDE UNDEFINEDWARNING: Latitude undefinedWARNING: The image is bigger than the presently defined program arrays only a part of the image will be input..imgIMGimgIMGTHE MATCHING .IMG FILE HAS NOT BEEN FOUNDPLEASE SELECT THE BINARY FILEBINARY DATA FILE NAME (.img file)Name of file containing the binary dataUnacceptable inputWARNING: Error in opening binary file Name of required binary file: INPUTTING DATA FROM FILEINFO: Inputting data from fileLINEARISING DATAINFO: Linearising data@EzBA ColumnsRowsIntensitySubroutine FIO_IN_BSL V0.14Subroutine FIO_IN_BSL V0.14INPUT FILE NAMEName of input header fileUnacceptable inputREAD_ASCIIWARNING: The entered file could not be opened (probably it doesn't exist) (You can enter user escape (\\) to exit this command.)WARNING: Could not input number of X-pixels (Maybe wrong file type ?)WARNING: Could not input number of Y-pixels (Maybe wrong file type ?)WARNING: Could not input frame number (Maybe wrong file type ?)WARNING: Could not input file byte ordering (Maybe wrong file type ?)WARNING: Could not input data type (Maybe wrong file type ?)WARNING: Could not input header file information. (Maybe wrong file type ?)DATA-SET ("MEMORY") NUMBEREnter number of data-set ("memory") to input Enter integer in rangeDATA-SET ("MEMORY") NUMBEREnter number of data-set ("memory") to input Enter integer in rangeWARNING: Internal dimensions are too small to input all of the dataWARNING: File data type not presently supportedIMAGE NUMBEREnter number of image within the data-set ("memory") to inputEnter integer in rangeIMAGE NUMBEREnter number of image within the data-set ("memory") to inputEnter integer in rangeWARNING: Error in opening binary image file:ColumnsRowsIntensity~ɞSubroutine FIO_IN_BINARY V0.10Subroutine FIO_IN_BINARY V0.10IN_BIN_SIGNEDIN_BIN_SWAPIN_BIN_STARTIN_BIN_DATA_TYPEINPUT FILE NAMEName of input file containing dataUnacceptable inputINTEGER (2-BYTE)4-BYTE INTEGERX NUMBER PIXELSNumber of data elements horizontally in each line of dataEnter integer in rangeY NUMBER PIXELSNumber of data elements vertically (number of lines)Enter integer in rangeWARNING: Internal dimensions are too small to input all of the dataDATA TYPEEnter type of data from available choices4-BYTE INTEGERINTEGER (2-BYTE)PERFORM BYTE SWAPPING"YES" if the byte order needs to be changedEnter "YES" or "NO"SIGNED DATA"YES" if the data is signed, "NO" for unsigned dataEnter "YES" or "NO"IN_BIN_SIGNEDIN_BIN_SWAPIN_BIN_STARTIN_BIN_DATA_TYPEINPUTTING DATA FROM FILE4-BYTE INTEGEROBYTE VALUESCINTEGER (2-BYTE)GREAL (4-BYTE IEEE)~ɞWARNING: Unknown data typeWARNING: Error in opening file4-BYTE INTEGERBYTE VALUESINTEGER (2-BYTE)REAL (4-BYTE IEEE)ColumnsRowsIntensitySubroutine FIO_IN_BRUKER V0.3 Subroutine FIO_IN_BRUKER V0.3 "BRUKER" AREA DETECTOR DATA FILE NAMEName of file containing "BRUKER" area detector format dataUnacceptable inputError in opening file, Please retype nameColumnsRowsIntensityG@Subroutine FIO_IN_CDD V0.6 Subroutine FIO_IN_CDD V0.6 DATA FILE NAMEName of file containing compressed diffraction dataUnacceptable inputDIRECTUNFORMATTEDError in opening file, Please retype nameCDD VWARNING: The file is not a "Compressed Diffraction Data" fileX NUMBER =Y NUMBER =DATA (C1) =ERROR: NOT IMPLEMENTEDColumnsRowsIntensity?Subroutine FIO_IN_CHIPLOT V0.8 Subroutine FIO_IN_CHIPLOT V0.8 READ_ASCIIWARNING: Problem opening input file WARNING: Problem reading from input fileWARNING: Error converting number of data points in fileError reading in the number of data pointsWARNING: Too many coordinates, the end ones will not be inputWARNING: Data items missing from fileWARNING: Problem inputting X-coordinate valueWARNING: Problem inputting Y-coordinate valueSubroutine FIO_IN_DIP2000 V0.4 Subroutine FIO_IN_DIP2000 V0.4 DATA FILE NAMEName of file containing data setUnacceptable inputDIRECTUNFORMATTEDError in opening file, Please retype namePERFORM BYTE SWAPPING"YES" if the byte order needs to be changedEnter "YES" or "NO"CGColumnsRowsIntensity?Subroutine FIO_IN_FIT2D V0.8 Subroutine FIO_IN_FIT2D V0.8 INPUT FILE NAMEName of input file containing dataUnacceptable inputDIRECTUNFORMATTEDWARNING: Error in opening file$BIG_ENDIANTRUEtitlex_axis_labely_axis_labelz_axis_labelx_pixel_size8ѷy_pixel_sizeoverload_valueGdata_arrayWARNING: Data array not foundWARNING: Not all of the data could be inputx_axisy_axisvariances_array?Subroutine FIO_IN_GAS2D V0.14Subroutine FIO_IN_GAS2D V0.14Enter the name of input file containing image header data. (Normallythis is the file without "hm" attached to the name.)INPUT HEADER FILE NAMEUnacceptable inputWARNING: The entered file could not be opened (probably it doesn't exist) (You can enter user escape (\\) to exit this command.)INFO: This format used to be defined with the binary "histogramming memory" file starting with a 512 byte "header". This header no longer seems to exist. You need to specify whether this header exists or not. If you have trouble inputting the data, try the opposite choice. (Unfortunately, the ASCII header is not always correct, which may be a further problem.)-13WARNING: End of file found, before image header section. No data inputPROBLEM WITH HEADER FILE:EOF, NO IMAGE HEADER SECTIONWARNING: Bad input, before image header section. No data inputPROBLEM WITH HEADER FILE:BAD DATA BEFORE IMAGE HEADER SECTIONWARNING: No image header section. No data inputPROBLEM WITH HEADER FILE:IMAGE HEADER SECTION NOT FOUNDWARNING: The program arrays are not big enough to input an image.IMAGE TOO BIG FOR PROGRAMS ARRAYShmhmThe binary file ("hm") which contains the image data may or may nota 512 byte header record at the start of the file (old files used tobe defined this way, the new files no longer seem to have thisrecord. Enter "YES" if your file has a header record, "NO" if itdoes not. If you don't know, just try both, or count the number ofbytes in the file and compare to sensible image sizes.The default should now be correct.BINARY "HM" FILE HEADEREnter "YES" or "NO"IMAGE NUMBEREnter number of the required image to input from the image sequenceEnter integer within given rangeIMAGE NUMBEREnter number of the required image to input from the image sequenceEnter integer within given rangeEnter "YES" to swap the byte order on input. Normally byte swappingshould not be necessary for HP, Sun, and Silicon Graphicsworkstations. It will normally be necessary for VAX workstations.PERFORM BYTE SWAPPINGEnter "YES" or "NO"SIGNED DATA"YES" if the data is signed, "NO" for unsigned dataEnter "YES" or "NO"DIRECTUNFORMATTEDWARNING: Error in opening histogram memory filePROBLEM WITH HISTOGRAM MEMORY FILE:FILE NOT OPENEDWARNING: Unknown number of bits per pixel (data length)PROBLEM WITH HEADER FILE:UNKNOWN IMAGE HEADER FILE TYPEColumnsRowsIntensity?Subroutine FIO_IN_HAMAMATSU V0.10Subroutine FIO_IN_HAMAMATSU V0.10DATA FILE NAMEName of file containing data setUnacceptable inputWARNING: Error in opening file, Please retype nameWARNING: The image width has more pixels than the current program array X-dimension; only part of the image will be inputWARNING: The image height has more pixels than the current program array Y-dimension; only part of the image will be inputColumnsRowsIntensitySubroutine FIO_IN_HUFFMAN V0.5 Subroutine FIO_IN_HUFFMAN V0.5 DATA FILE NAMEName of file containing Huffman compressed dataUnacceptable inputError in opening file, Please retype nameColumnsRowsIntensitySubroutine FIO_IN_IQ V0.20Subroutine FIO_IN_IQ V0.20DATA FILE NAMEName of tiff file containing imageUnacceptable inputError in opening file, Please retype nameIMAGE SIZE NOT RETURNED FROM FILEWARNING: Image size not returned from fileINPUT REGION AND RE-BIN FACTOR FORMThis form allows you to specify the size and position ofthe region of data to be input, and if required to re-binthe raw data on input. These options allow handling of verylarge images, by working on sub-regions, or by working atreduced resolution. By default the whole of the image will beinput at full resolution (provided that the program arraysare large enough). Take care to define valid regions e.g. The end pixel mustbe greater of equal to the start pixel in each dimension.X-STARTY-STARTX-ENDY-ENDX RE-BINY RE-BINLEFT-HAND PIXEL INPUT LIMITLOWER PIXEL INPUT LIMITRIGHT-HAND PIXEL INPUT LIMITUPPER PIXEL INPUT LIMITHORIZONTAL RE-BIN FACTORVERTICAL RE-BIN FACTOREnter number of horizontal pixel for left limit of input regionEnter number of vertical pixel for lower limit of input regionEnter number of horizontal pixel for right limit of input regionEnter number of vertical pixel for upper limit of input regionEnter number of horizontal raw data pixels to be re-binned into one pixelEnter number of vertical raw data pixels to be re-binned into one pixelINPUT REGION IMPOSSIBLY DEFINEDINPUT REGION TOO LARGE FOR ARRAYSX REBIN NUMBERNumber of pixels for rebinning in X-directionNumber of pixels must be postiveY REBIN NUMBERNumber of pixels for rebinning in Y-directionNumber of pixels must be postiveLEFT-HAND PIXEL OF IMAGE REGIONEnter number of pixel of region of image to inputValue must be within given rangeLOWER PIXEL OF IMAGE REGIONEnter number of pixel of region of image to inputValue must be within given rangeRIGHT-HAND PIXEL OF IMAGE REGIONEnter number of pixel of region of image to inputValue must be within given rangeUPPER PIXEL OF IMAGE REGIONEnter number of pixel of region of image to inputValue must be within given rangeWARNING: Program arrays are not large enough to hold requested image.Redefine smaller region (or change array sizes).INPUTTING DATA FROM FILEWARNING: Image does not contain all of desired regionWARNING: Image not found WARNING: Cannot decode image WARNING: Bad tiff file WARNING: Image contains none of desired region ColumnsRowsIntensity?Subroutine FIO_IN_KLORA V0.20Subroutine FIO_IN_KLORA V0.20"KLORA" (limited ESRF) DATA FILE NAMEName of file containing "KLORA" (ESRF sub-set) format dataUnacceptable inputError in opening file, Please retype nameIMAGE NUMBERIndex number of required imageEnter valid integer within given rangeWARNING: Error in reading start of header: image not input WARNING: Error in reading keyword WARNING: Error in reading key valueBYTEORDERHIGHBYTEFIRSTLOWBYTEFIRSTCOMPRESSIONNOSPECIFICVALUENONEWARNING: The image data in this file has been written using a compression algorithm. It cannot be input.DATATYPEUNSIGNEDINTEGERUNSIGNEDLONGOSIGNEDINTEGEROUNSIGNEDSHORTGSIGNEDSHORTFFLOATFLOATVALUEREAL~ɞWARNING: The image data in this file has been written using an unsupported data type. It cannot be input.DIM_1DIM_2HEADERIDIMAGESIZETITLEWARNING: Problem of converting key valueERROR: The required "Image" number has not been found and I think that there are no more "Image" sections, since the "Size" keyword has not been found eitherColumnsRowsIntensitySubroutine FIO_IN_MAR V0.7 Subroutine FIO_IN_MAR V0.7 DATA FILE NAMEName of file containing data setUnacceptable inputWARNING: Problem in opening file (data is not defined):WARNING: Problem reading in file header9IRWARNING: Problem in opening file (bad file directory path)ColumnsRowsIntensitySubroutine FIO_IN_PDS V0.2 Subroutine FIO_IN_PDS V0.2 Error with start angle Error with step angleError with end angle Error reading in the number of data pointsWARNING: Too many coordinates, the end ones will not be input2 Theta Angle (degrees)IntensitySubroutine FIO_IN_PHOTOMETRICS V0.11Subroutine FIO_IN_PHOTOMETRICS V0.11DATA FILE NAMEName of file containing data setUnacceptable inputError in opening file, Please retype nameWARNING: Problem reading in file headerWARNING: The image width has more pixels than the current program array X-dimension; only part of the image will be inputWARNING: The image height has more pixels than the current program array Y-dimension; only part of the image will be inputIMAGE NUMBEREnter number of the required image to input from the image sequenceEnter integer within given rangeIMAGE NUMBEREnter number of the required image to input from the image sequenceEnter integer within given rangeColumnsRowsIntensitySubroutine FIO_IN_PRINCETON V0.9 Subroutine FIO_IN_PRINCETON V0.9 DATA FILE NAMEName of file containing data setUnacceptable inputWARNING: Error in opening file, Please retype nameWARNING: Problem reading in file headerWARNING: The image width has more pixels than the current program array X-dimension; only part of the image will be inputWARNING: The image height has more pixels than the current program array Y-dimension; only part of the image will be inputIMAGE NUMBEREnter number of the required image to input from the image sequenceEnter integer within given rangeIMAGE NUMBEREnter number of the required image to input from the image sequenceEnter integer within given rangeColumnsRowsIntensity?Subroutine FIO_IN_RAXIS V0.1 Subroutine FIO_IN_RAXIS V0.1 RAXIS DETECTOR DATA FILE NAMEName of file containing RAXIS detector format dataUnacceptable inputError in opening file, Please retype nameGColumnsRowsIntensitySubroutine FIO_IN_UNKNOWN V0.6 Subroutine FIO_IN_UNKNOWN V0.6 DATA FILE NAMEName of file containing image dataUnacceptable inputWARNING: The specified file doesn't existWARNING: The specified file exists, but is emptyWARNING: The specified file is too small to deduce its typeLOWER LIMIT, PIXELS PER ROWEnter lowest considered number of pixels per rowEnter integer within given range@AP@DIRECTUNFORMATTEDError in opening file, Please retype nameCINFO: The data appears to be little endian (this assumes that any header is an even number of bytes in length)INFO: The data appears to be big endian (this assumes that any header is an even number of bytes in length)INFO: The data values may be 4-byte floating point or integer values Integer values will be ASSUMED (?)INFO: The data appears to be little endian (this assumes that any header is an even number of bytes in length)INFO: The data appears to be big endian (this assumes that any header is an even number of bytes in length) (This data type is not supported)GWARNING: NOT IMPLEMENTED YET header bytesINPUT DATAEnter "YES" to input imageEnter "YES" or "NO"X-axisY-axisIntensity?Subroutine FIO_IN_USER V0.4 Subroutine FIO_IN_USER V0.4 INFO: Continue entering numbers as required, then use "USER ESCAPE"INFO: "USER ESCAPE" is double backslash: \\ENTER DATA VALUEEnter valid real value, or "USER ESCAPE"User Entered DataArbitraryUndefinedIntensity?DATA VALUE TO CHANGE (O = quit)Enter number of data point to changeEnter valid integer in given rangeENTER NEW DATA VALUEInput intensity value for data pointEnter valid real valueSubroutine FIO_IN_WESS V0.5 Subroutine FIO_IN_WESS V0.5 DATA FILE NAMEName of file containing data setUnacceptable inputINPUT DATA X-SIZENumber of pixels in the input data image in the X-dimensionMust be within defined limitsINPUT DATA Y-SIZENumber of pixels in the input data image in the Y-dimensionMust be within defined limitsDIRECTUNFORMATTEDError in opening file, Please retype nameX-START ELEMENTStart of input region in the X-dimensionMust be within defined limitsY-START ELEMENTStart of input region in the Y-dimensionMust be within defined limitsX-END ELEMENTEnd of input region in the X-dimensionMust be within defined limitsY-END ELEMENTEnd of input region in the Y-dimensionMust be within defined limitsX REBIN NUMBERNumber of pixels for rebinning in X-directionNumber of pixels must be postiveY REBIN NUMBERNumber of pixels for rebinning in Y-directionNumber of pixels must be postiveWARNING: Dynamic arrays not large enough to hold requested image.Redefine smaller region (or change array sizes).CollagenColumnsRowsIntensity?Subroutine FIO_IS_ADSC V0.1 WARNING: Error in opening file{Subroutine FIO_IS_BRUKER V0.1 Subroutine FIO_IS_BRUKER V0.1 WARNING: Error in inputting header lineFORMAT WARNING: The file appears to be a Bruker format file, but the format version number appears to have changed !?!?Subroutine FIO_IS_KLORA V0.3 WARNING: Error in opening file{Subroutine FIO_OUT_3CAM V0.2 Subroutine FIO_OUT_3CAM V0.2 Enter name of output file WRITEOUTPUT ROWS"YES" to output a row of data, "NO" for a columnEnter "YES" or "NO"NUMBER OF ROW TO OUTPUTEnter number of row to be output to fileEnter an integer within given rangeNUMBER OF COLUMN TO OUTPUTEnter number of column to be output to fileEnter an integer within given rangeSubroutine FIO_OUT_BINARY V0.10Subroutine FIO_OUT_BINARY V0.10Ifit2d.binGBINARY OUTPUT CONTROLVARIABLES FORMThis form allows you to control a number of parametersaffecting the layout of the binary data written to file.Often the default values will be suitable, but theseparameters offer flexibility in the binary format to helpinput to other programs. The "FILE NAME" button allows the output file to be selected, and changed from the default suggestion. The "RECORD LEN." button allows the record length inbytes to be specified for the output file. The conceptof record length does not really exist for Un*x systems,but this can nevertheless be useful in allowing blank"records" to be written at the start of the file, andfor writing only partially filled "records". The "PAD" button, together with the "RECORD LEN."choice, allows partially filled records to be outputwhen needed. (If you don't understand this, italmost certainly means that it is not necessary foryour applicable and may be ignored.) If "PAD" is"NO" then the image data will be written contiguouslyinto the output records. If "PAD" is "YES" and therecord length is greater than that needed by a lineof the image, then the remaining bytes in th