8__PAGEZERO__TEXT p p __text__TEXTt] t__picsymbol_stub__TEXTtdd$__symbol_stub__TEXTvf__picsymbolstub1__TEXTv`f __cstring__TEXTX~X__const__TEXT`TP__literal4__TEXT fl Vl__literal8__TEXT m` ]`__eh_frame__TEXT oX _X` __DATA # p__data__DATA  p__la_symbol_ptr__DATA'&__nl_symbol_ptr__DATA' &__dyld__DATA''__const__DATA'l0'__bss__DATA'}v__common__DATA?E8__LINKEDITD@'p /usr/lib/dyld 4@HG/usr/lib/libSystem.B.dylib 8@V,/usr/X11R6/lib/libX11.6.dylib'pZ+ PQ%Q%Y+ 7+(t|: x8!T!48!z8;cW{:|H |!B||x|#x|+xH<_ hD<_ hH<_ hL<_'B</A }N!<_'B8/A }N!H_<_ hX /A }N!H<_ hT /A }N!<8cv8@Hea@/AH^8<_'B4=}"Kx/Ad9@9` |t/A0|X|t//@}K9k}"Kx| X|t/@/A 8 H<_ hPx/A/@xxx8H]H]|!B<8cu,8@Hy@}N!h8!`|N =`'k,AN 8N8`8`8D8`;8D=' | =aN =`'k}iN |!|> x~hl8`8(H^5|`x8^8h^8l^88(88`-H]ݐ}8`-8H]!|N |!|> x~x|8@8`-H]~888<^</Ax^<^@ ^@/(AH\р^ xBH\<_'Bl88/A^8T>+@H<_ bdH[<_ bdH[y!|N |! |> xB8|xH8|xH89><8cD|x}%Kx8 Ha,@8<8cD|x8,Ha8<8cD@|x8HI=? 9)e(8А =? 9)e(8 < 8ce(H< 8cJ\<8DD8H H89>< 8cJ`|x}%Kx8PH9~9^;;88<8cDD=?'=?'8< 8e}g[x}HSxxxHz89>|x< 8e< 8e$}&KxH!),A8<8cDL|x8H 89>|x}$KxH Հ,A,AH48< 8cJd< 8Jh< 8Jl< 8Jp|xH HL,A,AH08< 8cJd< 8Jt< 8Jp< 8Jl|xH Υ= a)|H@P8|xH8<8cDd|x8&Hi8<8cD|x8HQ<8cD8H)888=?'i9k=?') T< =?'i9k=?') =?'i9k =?')9) =?'i=?')9)k | T:89~|x=?'8 }e[xH]=?') T:89~|x=?'8,}e[xH)=?')9) T:89~|x=?'80}e[xH=? 9)e ,A=?'i=?')9)k | T:89~|x=?'84}e[xHܕ=?') T:89~|x=?'8<}e[xHa=?')9) T:89~|x=?'8@}e[xH),A=?'i=?')9)k | T:89~|x=?'8$}e[xH=? 9)e ,AL=?'i=?')9)k | T:89~|x=?'88}e[xHy89>< 8cJx|x}%KxH]88< 8cJ|< 8J< 8J\< 8J\< 8J|= 9J=? 9)J^H 8828>8 ,@HLT :8})9)8 T :8})9) 8 >8 K8<8cD|x8NH,A9~9^;;88=? 9)e!<=?' @=?')9)!D=?')9)!H=?')9) !L8@P8T8X80\=? 9)e!`=? 9)e$!d=?')9)!h=?')9)!l=?')9)!p=?')9)!t8x8|888888P88=? 9)e!=? 9)e !=? 9)J|!=? 9)J!8888 p8888P8P8P8P8P8P8P8P8P<8cDD< 8J\}e[x< 8d}GSx= 9exxHH9~9^9;;88=? 9)e!<=?' @=?')9)!D=?')9)!H=?')9) !L8@P8T8X80\=? 9)e!`=? 9)e$!d=?')9)!h=?')9)!l=?')9)!p=?')9)!t8x8|888888P88=? 9)e!=? 9)e !=? 9)J|!=? 9)J!8888 p8888P8P8P8P8P8P8P8P8P<8cDD}d[x}ESx< 8d}Cx= 9exxH=? 9)e ,A8|xH],A8|xH e8=?'i8c |xHө8=?'i8c,|xHӑ8=?'i8c0|xHy=? 9)e ,AL8=?'i8c4|xHM8=?'i8c<|xH58=?'i8c@|xH,AH8=?'i8c$|xH=? 9)e ,A8=?'i8c8|xH̀,A8=?'i8c(|xHҩ89>|x}$KxHҕ89><8cD|x}%Kx8 H̀,A8<8cD|x8&H8<8cDD|x8HzA8|xH9<8cD8H|! Ba !A $hlapAt!x|= a)|H@L,A 8H,A 8><`| A$=)9)><8c88HMH`! ,@D< 8cY8ch<8888H< 8cZ8c<898P8PH8a888xH -8a888xH ё8 ;;`;A0=? >d;=?9)9h!0=? 9)Y!8=? 9)Y!@=? 9)Y!H=? 9)Y!P=? 9)Y!X=? 9)Y!h=? 9)Y!p=? 9)Y!x? c9<`|>:9,ACx<898P8PH8a<898P8PH8a<898P8PH8a <8:08P8PHm8ap<898P8PHU8a<8:8P8PH=8a<898P8PH%8a`<8:8P8PH 8a<898P8PHh(o88P<< 8c>D< 8>H< 8>LFx899!9AH ߵ8 < 8c>|dx< 8>P< 8>TxH 88h(o9!!<@8DH< 8c>|dx<8; < 8>X8= 9Y9!9AH ϡ;8a<8;<8(8(H8<8(@< 8c>X8< 8Y8 899!9AH ],A\8a<8;<8(8(H,@ ;H48a<8;d8(8(H,A$8a<8;8(8(H,@t! ,A`Cx<8;8P8PH8a<8<8P8PH8a<8D< 8>H< 8>\Fx899!9AH M!0!88<@9 !D8#H9 !L< 8c>< 8>D|ex|fx<8<|hx=?9)<|jxH yHCx<898P8PH8a<898P8PH8a<8<8P8PH8a <898P8PHy8ap<8=$8P8PHa8a<898P8PHI8a<898P8PH188P<< 8c>D< 8>H< 8>\Fx899!9AH xH 8! iH8a<8=t8(8(H,@(< 8c>X8< 8Zx8PH H@8a<8=8(8(H,@< 8c>xHDHT8a<8=8(8(H}|`y4@ !(!8,8(8(H|`yD@ !(!8,<8(8(H|`yL@HCx<898P8PHa8a<8>d8P8PHI8a<8>8P8PH18a <8?8P8PH8ap<8?T8P8PH8a<8?8P8PH8a<8?8P8PH8a`<8@D8P8PH8a<8@8P8PH8a<8@8P8PH8aP<8A48P8PHq8a<8A8P8PHY8a<8A8P8PHA8a@<8B$8P8PH)8a<898P8PH88P<< 8c>D< 8>H|#xFx899!9AH < 8c>|dx<8Btx8&H QxH ۝8!!<@D(H!,!L0P!4!T8X! !AH L!PH8a<8B8(8(HU,@xHE;H8a<8B8(8(H%|`yT@`!(!8,`8 8$xH ֙\!` !(!8,xH։= a)|HA!,88(<9!,!@D80H9 !L< 8c>< 8>D|ex|fx<8C|hx=?9)C|jxH a(,AxHՅH;`,@Ѐ8!|N |!@B|{x|#x|+x|3x= a)|HA<8c-8"HH;@8`<?dAh<8c-8L8@8Px9 9 HuP,@,A|8aT8XxH 8T; ? ;HP;쀁T8a@|88H,@8aT8XxH }xH ف!T9)!T7@<8c-8\8Px8HP,@;@<8c-8`8Px8H)<8c-8d8Px8H <8c-8h8Px8 H<8c.8L8@8Px9 9 HAP,@=? 9)I,8@ }#KxHޑ,@\< 8c'8l8HQ,@@< 8c'8p8H5,@$< 8c'8t8H,@Hء,A < 8c'8l8p8txH %,A,A8a\8`8dxH ]8ax8|88xH ҙ8a888xH i\,@$< 8c'|dx|ex|fxxH )H\,@0< 8c'< 8'|ex|#xxH 8a8`H\,@L< 8c'< 8'|ex|fxxH `=? (h*@8a8`88@HT\,@P< 8c'|dx|ex< 8'xH md=? (h(D8a8D88dxH 8ahxH8a8xH рh! | H8a8HxH 5<8c.$x8Px8 Ha<8c.$x8Px8 HE8!|N |!BaH|#xPTX\!`AdptaA!= a)|H@L,A 8H,A 8=<`| A$=)9)=<8c)8HۭH܀,@8a<8)88H988a0<8*8P8PH8a<8*X8P8PH8a<8*8P8PH8,A8;`?? ;9D;P?c=?'!܁) 9) !:>:*a8a0<8+8P8PH۽,@8a0< 8D8P8He!8;0<@8DHL9 (!PT< 8c#t<8+X< 8#< 8YL< 8#9|+x9AH< 8c#t8xHՀ|@4!؀ ,A$xHΝx<8+p8P8PH۱88!T!<X@!\!D`H!d!LhP!l!TX\x`!|!dh!!lp!!tx!!|!!!!!!!!!!!đ!Ȑ!̑!А!ԑ!ؐ!ܑ!Āȁ!!̀ВaԒA9!ȑ!8̐䓁!쓁! ! !!!!  < 8c#8< 8YLHGxP9!0=_ 9JDHuxH)= a)|HA8Б!Ԓ89!Б!<8Ԑ@9 !D80H9 !L< 8c#t< 8#|ex|fx<8+|hx=?9)+|jxHE,AxHHà,@(<8c,x8MH8a0<8*H0,@<<8c,Px8IHʭ<8c,x86Hʙ8a0<8,H,@<<8c-$x8BHi<8c-hx8;HU8a0<8-H,@<<8c-x8=H%<8c.4x8=H8a0<8.tHd,@<8c.x8IH4,@D<8c/x8DH<8c/Tx8+Hɭ8a0<8/8P8PHՁ!9)( A!܃ ,Ax<8c/x8LH]<8c0x8HI<8c0 x8LH5<8c0x8H!<8c/x8LH ~<!8cH !9)( A!܃  ,Al<8c/x8LH<8c0x8Hȱ<8c0lx8DHȝ<8c0x8Hȉ<8c/x8LHu~,@,A<8c0x8,HE88!0|N |!B|#x|+xT|;x\}9KxAdptAaA!ȃa  ><`| A<`| @xHȭH9T#x<8) ~x8H,@(xxxH1#x<8)$H9#x<8)(~x8HԱ,@ԁ!x ,ACT,ACH.|HA@aā+|HA@=?'L;4!!8<@a}$Kx~x}{x=|jxHv}!| ,A4Ёaa8<@a}d[x~x}{x=|jxHv5H4#x<8),~x8H,@xH յHID#x<8)<~x8 Hӕ,@xH?HI#x<8)H~x8Hi,@,AJl='kL9k, 8 $#x<8* ~x8 H,@\,AC='kL9k 8#x<8*~x8HE,AD#x<8*~x8H%,A$#x<8*~x8H,@xHH:t#x<8*~x8H,@xHHp#x<8*~x8Hȭ,@='kL9k 8<`| @H8a< 8|+x|gx|#x=? 9)='kLK(H^8! aa8!<`| A$=)9)><8c8HzH<8c< 8#8$x8H}]<8c< 8#8$x8 H}=<8c < 8# 8$x8 H};(8H! ,@;|I֐ 8a <&g(8(xHWi><`| @ȓ8xdx< 8”|+xxhx=? 9)¼=&kg(K(H! 8,80:@D8a0<8088H{I=?&!`)g(9) !\=?&)g(9),!d=_ 9J# Ah=?&)g(9),!l=?&)g(9),!p= 9kat=? 9) !x=?&)g09)!|=?&)g09)!=?&)g09) !=?&)g09)!=?&)g09)!=?&)g09)!=_'9JA=*9kLa=?'9)3!=_'9J7 A='9ka=?*9)!=_'9J A='9ka=?&)g(9),!=?&)g(9),!=? 9)# !=?&)g(9),!=_ 9J#A= 9k#a=? 9)!=_'9JA= 9k a=?'9) !=_'9J3A='9k7 a=?*9)!=_*9JLA=*9ka=?*9)l!=_'9JA='9k:,a=? 9)*!=_'9J̑A = 9k+ a 9*P! =_'9JA = 9k+$a =?'9)9)! =? 9)+@bR=`akaP,A,A|! a8!<@DHLPaTaTXX!\!\#xx~ȳx~x~xH 8a0<888HMH8aP<808P8PHL8a<8ɀ8P8PHL8a<808P8PHL8a@<88P8PHL8a<808P8PHL8a<8 8P8PHLm8a0<808P8PHLU8a<8p8P8PHL=8a<808P8PHL%8a <808P8PHL < 8c|dx8Px8PH ,At8< 8c< 8< 8< 8ƔxH :8 8< 8c< 8<8< 8ƕ 8= 9@x9@H !;;8a<88P8PHKI88 <9 P!@< 8c 8< 8@8899! 9AH ,@H,@8H,@,A!$ 8!<@DH9a aL8P!!TaaX8\9!!`dhaTalXp!\!t#xx~ųx~x~x~hxa$+KHթH 8a<88P8PHIE|cy@aaH 8a<8 8P8PHI,@;`aaH 8a<8p8P8PHH,@(< 8c 8< 8 x8PH +H H8a<88P8PHH,@ؐ8Am,@P,A!8<@DؐH!!LaaPTX\a`d!!ha@ l p t x |!$!a(a,!0!a4a8!H%u<8cx8?H%a<8cx8H%M<8cx8H%9! ,@;|I֐8a<&8(xHف=<`| @8xdx<8z|+xxhx=?9){=&kK(H-8! 88:8a<888H2=?&)9),!=?)9)p!=)9kpa=?9){d!=)9kp a=?*9)!=,9kDTa=?&)9)!=?&)9)!=?&)9) !=?9){l!=)9kpa =?)9){ԑ! =?&)9) ! =?&)9),! = 9kTa =?&)9),! =?&)9) ! =?9)! =9k{Da =?9){! $=9kza (=?&)9),! ,=?9){d! 0=9k{ha 4=? 9)T! 8=?&)9)! <=?&)9)! @=?&)9) ! D=)9kp a H=?,9)A4! L=*9ka P=?*9)! T=)9kpa X=?,9)J! \=)9kpa `=?)9)w! d=?&)9),! h=?&)9),! l= 9kTa p=?&)9),! t=? 9)H! x= 9k\a |=? 9)`! = 9kDa =? 9)P! =9k{da =?)9)p ! =9k{ha =?9){l! =)9kpa =?)9)p! =*9ka =?*9)! =,9kJa =?,9)A4! =,9kDTa =? 9)X! =,9kIa =?,9)Gt! =)9kwa =?*9)4! =)9kpa =?)9){ԑ! =)9kpa =?)9)p! =?&)9),! =?&)9) ! =?&)9),! =)9kpa =?)9)p! =9k{da =?)9)p ! =*9ka =?,9)DT! =?&)9)! =?&)9)! =?&)9) ! =9k{la =?)9)p! =)9k{ԑa =?&)9),! =? 9)X! =?&)9),! =?&)9),! $=?&)9),! (=9k{a ,<` 0= a)! 4,A,Ap8a<8 88H--,@؁!Ԁ )aԁK 8aH8a<88P8PHڡ,@x,AdA8!<@DHL!!PTX\`dcx$x؀܁a8 +~jxHIHh;H`8a<8(8P8PH ,@,A!< 8a b1>b,A<,A| 28<@aaDHaaLPTXaa\`aad<8cdxEx xH 1H8aP<88P8PH8a<88P8PH8a<88P8PHԵ8a@<8T8P8PHԝ8a<88P8PHԅ88P<<8c<8<88P899!9AH Y,Ah<8c<8<8<8xH Ia8<8cx<8<8<8 8= 9x9@H .;:8a<88P8PHӱ8a<88P8PHә8a<8P@<8c 8< 88899!9AH ,@H ,@8H,@,A؁! 8aa<@!!DaaH8L9!!PaaTX9!!\9aa`dhl!!paatcxDxx~x~dzx~xa+KH]H08a<88P8PHщ|cy@aaH8a<88P8PH],@;H8a<8T8P8PH-,@(<8c 8< 8dx8PH H8a<88P8PH,@,@89 878cxDxx~x~dzx~x=?9)aKHmcx}{x<8<8ā! xHvICx}sx<8<8ā!xHv!a<8}kx8Hрa<88Hйa<8 8HСa<88 HЉ!!8lt=`C0app(x8x<ltp(|9!|!@aaD!đ!HaȑaL!̑!PaБaT! X\cxDxx~x~dzx~x}+Kx)KH~H8a<88P8PH,@T8!!<`| A$=)9)><8cjh8"H H;acx<8j8P8PH8a<8j8P8PH8aP<8k,8P8PHq8a<8k|8P8PHY8a<8k8P8PHA8a@<8l8P8PH)8a`<8ll8P8PH;`8=? 9)@!<@8D;PHL<8c$<8$|#x<8<8l=9ix|3xH8=? 9)D!<@8DHL<8c$<8$|#x<8<8l=9ix|3xHӥ8=? 9)H!<@8,DHL<8c$<8$|#x<8<8l=9ix|3xHI><`| @88Cxx%x< 8Ɵ@< 8D= 9H~xAH[8!|N |H։$!`|nx|#x|+x|3x|;x}Cx};Kx}WSx؃A܁= a)|H@,A 8H\,A 8HH<| A| @ 8H$:| A | @ 8><`| A$=)9)><8cj 8HH$8a88 889xH !8axHـ,A<< 8cL8c<8j,8 8 HE< 8c8cP<8j8H8< 8cL8c<8j8 8 H < 8c8cP<8j8P8PH=? )@, A<< 8cL8c<8j8 8 H< 8c8c<8jH8< 8cL8c<8k@8 8 H< 8c8c<8kL8P8PHe8a 8$8(xH !8a,80xH 8a488xH Q=? )<,} J9)0| @| x!8a,8xH8=? )<|H@} Kx8a48xH xH {Uk:}k<U):}) h*\=?i4\P\wUk:}k:U):}) h*``P`8dzUk:}k7U):}) (|Uk:}k;U):}) h(TT`(cnT8a<8@8DxH 8aH8LxH :} HP9i;| PP| x9)!P| X@aP!P9)!P} Kx!L|K֐P| x9)!P8<88@<8D@Dxx}{xfx~xxIx9APH ,AT*X=?4rXD= 8-(!n!aHU@=? -(!n!aH- (X$H4T*X=?4rXD@(Xh$X8h; :`:=K=?9)!|=+4=?I= 9kHa=?)=? 9)D!=? =? =9ka=?=?9)!=9ka=?=?=? 9)H!==?©=?9)k!= 9kDa=?‰8=?i= 9k@aa= 9k b1,ATѡP9aTa8a<8X@D8a\8`8d< 8ƜH< 8D99!9AH A8<@!!DaaHLP!!TaaX\xx}{x~Ƴx~xhx~xxH Y}sx<8k8 Hi:,Ah<8c<8,<8$|#xxH m8 8<8c<8<8k<88h= 9Lx9@H :`:8a<8k8P8PHٓ88 <9 P!@<8c8h< 8L<8@8l99!p9AtH n9l,A l,AH8a<8k8P8PH,A(8a<8l 8P8PH},@; :`:H d8a<8lp8P8PHM,@(<8c8h< 8x8PH !H 8a<8l8P8PH ,@8x8<@!!DaaHL!|!PaTX\A`daahl!!paatx<8c}sx<8xx~ȳx~x}{xHMH \8a<8m8P8PHM,@4:@#> :H=?é=?=?*LA@ (TѡP9aTa8a<8X@D8a\8`8d< 8ƜH< 8D99!9AH A8<@!!DaaHLP!!TaaX\xx}{x~Ƴx~xhx~xxH }sx<8k8 H:6RA K8a<8m`8P8PH,@{Uk:}k<U):}) r~ѡ\wUk:}k:U):}) r~ѡ`AdzUk:}k7U):}) (r|Uk:}k;U):}) h(r`( `.T*rD@`(h$X!)a H 8a<8m8P8PH,@4=? 9)H * ahLA@h(H8a<8n8P8PH,@(=? 9)H ( @x*HP8a<8nP8P8PHa,@,=? 9)D * ah@4HH8a<8n8P8PH,@0=? 9)D ( ah@ѩH8a<8n8P8PH,@Tp$H,8a<8o@8P8PH,@TTH8a<8o8P8PHq,@T\mH08a<8o8P8PHA,@T\m\H$8a<8p08P8PH ,@TdmH08a<8p8P8PH,@TdmdH8a<8p8P8PH,@X=?rH,8a<8q 8P8PHu,@X=?h$H8a<8qp8P8PHA,@! $ aa8!<@8D9 '!H9`aL<8c<8<8|fx<8q|hx=?9)q|jxH ! r$ a $ !!8a<@9`aD8H9 !L<8c<8<8|fx<8q|hx=?9)r|jxH !! r$ H$8a<8r,8P8PH ,@<8cxH< 8cL8c<8j,8 8 H< 8c8cP<8r|8P8PH}T`*raDá@ ($Xh$r2+(!!aH=(!n!aH ($XH@8a<8r8P8PH),@<8cxH5< 8cL8c<8j8 8 H< 8c8cP<8s8P8PHÁT*|rD>(!!aHá@=(!n!aH ({$X$r2($XH\8a<8sl8P8PHE|cy@!i8aH<8xH !,9) 0| @| x!8a,8xH8, @8 8a48xH xH < 8cL8c<8k@8 8 Hq< 8c8c<8kLH8a<8s8P8PHy,@9`!i8aH8LxH ! !,})9)0| @| x!8a,8xHـ8a+|H@} Kx8a48xH xH xH < 8cL8c<8j8 8 H< 8c8c<8j8P8PHiH8a<8t 8P8PH,@|8A<@D!!HaaLPT!!Xaa\`< 8c@xx}{x~dzx~xix~xH^A:`:xH|A; ,@d8a,80xH8a488xH xH xH 8!$H¸|!@B|~x= a)|HA<8c`(8 H}H8axH 8a`<8`H8P8PH 8a<8`8P8PH8a<8`8P8PH8aP<8a88P8PH=?9)a!8;<@8,D8PH8L<8cٸ<8|ex|fx<8a=99!`|jxHIxxH A8!|N |a̐!B|#x|+x|3x|;x}Cx}7KxDaH\a`dx= a)|H@,A 8H\,A 8HH(| A| @ 8H$7| A| @ 8><`| A$=)9)><8c`8$HH8<8c`x8H<8c`x8>H<8c`x8@H<8ca<x8<`| A$=)9)><8c]8HMH,@h(H <?,@h(H <?8a`<8]08P8PH8a<8]8P8PHm8a<8]8P8PHU8aP<8^ 8P8PH=,At=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8^=9Ӏ9!`|3xH Hp=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8^=9Ӏ9!`|3xH8a`<8^8P8PH=8a<8^8P8PH%8a<8_@8P8PH 8aP<8_8P8PH8a<8_8P8PH݀,At=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8`0=9Ӡ9!`|3xH Hp=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8`0=9Ӡ9!`|3xHI8a`<8`H8P8PH8a<8]8P8PH8a<8]8P8PH8aP<8^ 8P8PH,At=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8`=9Ӏ9!`|3xH 9Hp=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8`=9Ӏ9!`|3xH8a`<8`8P8PH8a<8^8P8PH}8a<8_@8P8PHe8aP<8_8P8PHM8a<8_8P8PH5,At=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8a=9Ӡ9!`|3xH Hp=?9)^p!88<@8D8PH8L<8cd<8d<8ӈ<8<<8a=9Ӡ9!`|3xH= a)|H@<xx88gxxH,U#x~x88GxxH,988!0|N |ؐ!B|xx|#x|+x|3x= a)|HA<8cZ8HHH8H^I,A;::P?@cZ;8aP<8Z,8P8PHU8<@<8cx8< 8<8̈89P9!9AH S,A8aP<8Z,8P8PH-,@ ;H8aP<8Z|8P8PH,@<8c4xH\H\8aP<8Z8P8PH,@ ;H8aP<8[8P8PH,@<8c4xH[;HL8aP<8[l8P8PHq,@,xH Pxx%xKe<8c[8H,Axdxx&xH\|A$<8c[x8<`| A$=)9)><8cYP8HH,A?;Yl8=?9)!<@;@ AD;`,aH; L<8cɌ|dx%x|fx<8Y|hx=?9)Y|jxH 8=?9)!<@ADaHL<8cɌ|dxx|fx<8Y|hx=?9)Y|jxH H?;Yl8=?9)!<@;@ AD;`,aH; L<8cɌ|dx%x|fx<8Y|hx=?9)Y|jxHݓ8=?9)!<@ADaHL<8cɌ|dxx|fx<8Y|hx=?9)Y|jxH?;8?;Ɍy,A8-=?)})m)!d<C0``=?ɩЀh(=?$ѡh8#xx~ųx~x~x~x9!h~JxH<]8!|AN |Hٽ!0|}x= a)|HA<8cV|8H~H`8a<8V8P8PHa8;@>:|<;a:P?;|4=?é=?>?:1V:?;|0>:s|8=?iT>_:R~T;!`=?Éx!90 a$=?9)~l!(x!,xa0=?9)~!4=?9)~!8=?I>:W8a<@8&DH9 #!L8PT<8c <8W<8p<8||gx=9W<|+x9AH cx<8V8P8PH~Y,@<8c4<8|8xHb!r$!8<@D8 HL<8c <84<8|fx<8W`|hx=?9)W||jxH<!!$<!HU !*$2<8c~TH{2<8c 88H_ Hv#xx8PHocx<8WH8;x<8W8P8PH}9,A$x<8X<8P8PH},@ ;@H;x<8W8P8PH|,@<8c4<8|8xH`2!!8<@8DHL<8c <8 <8|fx<8X|hx=?9)X|jxH$*!$)!$!@a@DHб !*! )!()<8c~lHz ! r$<8c 8H;x<8X8P8PH{,@2!,!8<@8DHL<8c <8 <8|fx<8X|hx=?9)X|jxH$ r$ !,!8<@D8 HL<8c <84<8|fx<8W`|hx=?9)W||jxH-!!$-*!Hq r!0!4)<8c~Hx!0 2<8c 88H\!Ht#xx8PHm!8)<8c~HxY!0 2$ <8c 8 8H[Hs#xx8PHlx<8V8P8PHzH<8cY$x82HlxHn = a)|HA8!89!!<8@9 !DH8L<8c <84|ex|fx<8YX|hx=?9)Yh|jxH-,AxHmH;@,@8!йH|ؐ!pB||x|#x|+x|3x|;x}Cx}6Kx}^Sx = a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8cR8HwqH=?9)S!8?;x<@9 !D8-H!L<8c<8<8<8ƿX<8S|3x=?9)S(|3xH =? A08xdx%x~xGxx=?9)x~ʳxH=58!|N |H!`|~x= a)|HA<8cQ8 HvqH!D89 ;;aP9;@P9==?9)v!8=_,9JA<:J}+Kx!@ADAH}j[xaL=9kQaP=9QT}ISxAX=_,9JA\A`}(Kx!d=?9)Q!h=_9JQAl} Cxp=,9txa|=9kQa=9Q=?,9)!=_9JvAA!=?9)Q!=_9JQA=9kva=,9A}j[xa}HSxAAA} Cx=,9=?9)Qđ!}j[xa} Cx}HSxA}i[xaؒA} Cx}(Kx!=?Ĩ}j[xa} CxA}ISxAaa!a=_ 9JdAa aa=_9JvAa=9Q a(=_9JvA,A0}HSxA4:=?,9)!8=_9JQ̑A<@!D=?9)Qԑ!H=_ 9J|AL= 9kaP= 9T=? 9)đ!X=_9JvA\=9kvha`=,9d}ISxAh=_9JvpAl} Cxp}(Kx!t=?9)vx!x}j[xa|} Cx=9v}ISxAa!=9Q=?9)Q!=_9JvA=,9ka~QxAa~PxAA=9v`=?,9)!!=9kva}(Kx!̑a=_ê=?É} Cx=9vؑaܑ=9kva=?,9)!!=9Q=?9)Q!=_,9JA =9kva a A =_9JQđA > :}o[x~Tx? c9>b>:sQcx<8R 8P8PHs8a<8R\8P8PHs8a<8R8P8PHs8ŀT8<8c|B8H>HV8aPx8PHO!9)!7AK8a<8d$8P8PH\,@8(, @U)8A})R a H8a<8St8P8PH\},@T=9vH, @,UI8a})Z9i ( h(щ 8 H;x<8dt8P8PH\ ,A$x<8d8P8PH[,@āȀ,@;9!!89AA<@ADHL<8c8 8x8$9(9!,9AHy ,A x<8e8P8PH\)Hp=9kv+9)+ | @889<@ADHL<8cv8 888$9(9!,9AH88<9)@9 !DAH<8c<8ed|ex<8ex|gx=9e=?9)d9AH́Ё(U)8A})R A|LA@,*l=`C0aH((l<C0(`(h$@\9i$A؁*U)8a})Z LA@*H((H(8r$(U)8A})R 8A<@D8a8$8(8,899!9AH18ax8PHhH(<8cex8H8a<8e8P8PHY ,@(, @U)8A})R A<8cW(x8DHKM(U)8A})R9iIh *x2Jj!iZb A X$X:H: P<`| A$=)9)><8cE48 HS}H.@=?)n, A;<8cET8`x8dx9 9 PHTmd,Ax<8Ed8P8PHT;x<8E8P8PHS,A$x<8F8P8PHS,@=?<Ez n(=?8H==? n(=?8X m=?8 n?;{n ,@?+;pT8?+;pl< `08a0<+8pxH/=|IT:48a4<+8p4xH/m=|IT:88a8<+8pxH/E=|IT:<8a<<+8p0xH/?+;pX8Ȑ?+;pp8 @8a@<+8p$xH.T:D8aD<+8p<xH.ŀT:H8aH<+8p(xH.T:L8aL<+8p@xH.|Uk:9k=9)}kI֑aP8aP<+8p xH.U|Uk:9k=9)}kI֑aT8aT<+8p8xH.%><`| @+88h=?+)px, A8a<8FTH0=?)n , A8a<8FH8a<8F8P8PHR;`?;n0;:#;P=?+9)px!=+9kpta=?+9)p,!=+9kpDa=?+9)p!=9kn a=?+9)p$!=+9kp(a=?+9)p !=+9kp`a=?+9)pd!=+9kp_:RG8<@DH9`1aLPT<8c<8G<8<8rJ|gx=9G|+x9AhHQ<8c8lxHex<8G8P8PHF,@,8ah<8rJx8PH.x<8HM,@Ё!4 ,A 8aP<8N48P8PH>8a<8N8P8PH>8a<8N8P8PH>8a@<8O$8P8PH>8a<8Ot8P8PH>8a<8O8P8PH>m!8!8aHP8a<8Q8P8PH:|cy@!iađa8!ȑ!H8a<8FH\8a<8X8P8PH(,@L8<Cx$x~ųx}{x~x}sx!AH8a<8LX8P8PH)YH88a<8Xh8P8PH(u,A<8cXx82HxHi= a)|HAa|!A88|<9!!@9`aD80H9 !L<8c<8|ex|fx<8X|hx=?9)X|jxH/|,AxH]H;`,@P;;`x<8Y,8P8PH(U8a<8Y|8P8PH(=8a<8Y8P8PH(%=?9)G!88<@8D8PH8L<8c<8|ex|fx<8Z=9 x|jxH.,A=?9)n =?9)n=?9)n <+8cpxH<+8cp4xH<+8cpxH<+8cp0xH<+8cp$xH<+8cp<xHu<+8cp(xHe<+8cp@xHU<+8cp xHE<+8cp8xH588!0|N |Ԑ!`B||x|#x|+x|3x|;x}Cx}5Kx}VSx܀= a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c*8H$1H$=?9)*ȑ!8?;L$<@9 !D81H!L<8clD<8lD|#x<8l<8*|3x=?9)*|3xHO=? lD @<8c+$x8'HH?;L$=?lhhAt $8xdx%x~xGxxx~ʳxH,A82`8xdx%x~xGxx9!`AHQ8!|N |!B|~x|#xHNр|@x,AP8a@xHC5<8cjHxHC<8ck|dx<8Jx8MH i8a@xHCH <8ck<8Jx8MH h8!`|N |Ԑ!`B|}x|#x|+x|3x|;x}Cx}5Kx}VSx܀= a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c(l8H!QH=?9)(!8? ;{ܬa<@8D83H8L<8cid<8id|#x<8i<<8(|3x=?9)(|3xHL=? i Ap8xx%x~xGxx=? 9)ܬ~ʳxH,A82`8xx%x~xGxx9!`AHݥ8!|N |!B|tx= a)|HA<8c&8"H H>? :1ڼ!8a<8@;`aD; H;L<8cgH<8'|ex<8',|gx=9'<|ix9AHk? ;ۼ8<8@aDHL<8cgH<8'H|ex<8',|gx=9'<|ix9AHk}!, @P,@Dx~9x!`Ad|x}5Kxhl8a`8`8h<8g8HFHX,@8a`< 8ڼH,@8a`< 8ۼ8H8a`<8'\88H U<8c(\~x8H;p:a`=?:I(pAhal;:`dx8h8`<8g8HEx~x8H88<; @8 DH<8cgH<8(x|ex<8(|gx=9(=?9)g=_ 9JܼHP!|J8<8@8D< 8cܼ<8(8889~ix9AHWU,A\;=? : ܼ=?9(9 9$x88<8g8DHDx~x8DHh8!`|N |!@B|ox|#x|+x|3x|;x}Cx}5Kx}TSxa!= a)|H@L,A 8H,A 8><`| A$=)9)><8c%8H]HH?;%ȓ8<@;@ AD;`7aH;L<8cd |dx%x|fx<8%|hx=?9)%|jxH ]8A<@ADaHL<8cd |dxx|fx<8&,|hx=?9)&8|jxH 88#xx~ųx~x~x~hx=?9)d4AH,A08#xx~ųx~x~x~hx=?9)d4AHe9`4AL=@C0=?ɩk=?dTUi:})m`dA``h(`( 9k4@Ѐ9`4AL=@C0=?ɩk=?dTUi:})m`dA``h(`( 9k4@Ѐa <8&p 8Ha<8&$8Ha<8&(8Ha<8&,8 Hɀ8!|N |HIT! a|+x|3x|;x}Cx!}NSx4= a)|HA<8c#8HH88a888899!9AHn,@8<@! !D$H!(!L,P!0!TX8\!H <8c#x80H <8c#x8H 8a<8$(8P8PH 8a<8$x8P8PH8a <8$8P8PH8ap<8%8P8PH8a<8%h8P8PH8a<8%8P8PH8a`<8&8P8PHy8a<8&X8P8PHa8a<8&8P8PHI;!P#x<8&8P8PH-?;'H8=? 9)ּ!<@;D;@PAH: L<8ca<8a0<8b(|fx<8'h=9at9!|jxHC#x<8'8P8PH8=? 9)ȑ!<@DAHL<8ca<8a0<8b(|fx<8'=9at9!|jxHB#x<8'8P8PH98=? 9)ԑ!<@DAHL<8ca<8a0<8aT|fx<8(8=9at9!|jxHB5#x<8(P8P8PHɓ8> :sa<@;DAHL<8ca<8a0<8b|fx<8(=9at9!|jxHA#x<8(8P8PHU8> :̒<@DAHL<8ca<8a0<8b|fx<8)=9at9!|jxHAQ#x<8)8P8PH8> :ؒ<@DAHL<8ca<8a0<8b|fx<8)h=9at9!|jxH@#x<8)|8P8PHu8> :Ē<@;DAHL<8ca<8a<8a|fx<8)=9at9!|jxH@m#x<8)8P8PH8? ;{Гa<@DAHL<8ca<8a<8a|fx<8*,=9at9!|jxH?#x<8*<8P8PH8? ;ܓ<@DAHL<8ca<8a<8a|fx<8*=9at9!|jxH?=? a2=?)b$ Hiu2$ Hi] Hh Hh[Z2Z$Ý2$:(Hi z a $ Hh2$ Hh` HhEõ2$( Hh ްz a $ Hhu{2r( Hh z a $ HhA=? 9);}#KxHr$<8ca88HH uxx8PHu=? 9)}#KxHr$<8ca88HIH -xx8PH-=? 9)}#KxHr$<8ca88HH xx8PH8=? 9)֜!<@;D8/HL<8ca<8b,<8b0|fx<8*|hx=?9)*|jxHy8=? 9)֠!<@D80HL<8ca< 8֜<8b0|fx<8*|hx=?9)*|jxH>:'H8? ;֤<@D;`/aH: L<8ca<8b,<8b0|fx<8+|hx=?9)+,|jxH8?? ;9֨!<@D;0HL<8ca< 8֤<8b0|fx<8+\|hx=?9)+l|jxHY8?_ ;Z֬A<@DaHL<8ca<8b,<8b0|fx<8+|hx=?9)+|jxH8? ;{ְa<@DHL<8ca< 8֬<8b0|fx<8+|hx=?9)+|jxH? ;֠? ;֜=| PT <9)!9} HP9)|I֐;} HP9)|I֐T88a8xHT88a8xHrTc:|crT:|jT:|rT:|j8c888xH =? =?a2=?bh$=? 2h$=? 2h$=? 2h$=? 9)ԑ!8=? 2h$8Đ<=? 2h$8Ȑ@DHL!PATaX;AA\8`8dhlpa,0< 8ּ88= 99!9AH<8ca<8a0|ex|#xxH <8ca\<8a0<8a|#xxH 8;a;,@<8? ;ָ<@8 D8&HL<8ca<8a0|ex|fx<8,|hx=?9),(|jxH,@d=?9),P!8=?9),X!<@8D8HLCx<8a\|#xfxx!=_9J,`H H8KxA! = a)|H@,A 8H8,A 8HP'| A| @8! H,(| A| @8a a+<`| A$=)9)+<8cl8HH 8'~HP:(} HP9)~I<`<`a9@!U):})Z=)I!9)!4@܀(|x|HQA؀'}@HQA8|=?K=L =a!})U):}) `LA@h*aHh(a=+9)| @@@!9)!HUk:}k"=k+9)+!9)!5J@t8c4@08;< 8cH-}<8cK88HрT:|<<8cK88HH+=!9)!7@<8c8>Hu=? 9);`}#KxH<8cK88HQ= C0=ɋRlđ!ɡ`(hn̑!`($ѡ<8cK88HHx8PH<`@8=?)RHW9 9@! A$<`?c?C0=?R!U):a})Z=) ,@Xl̓(nē($PaPT HW!!$ ( !9)!7@|=? 9);`}#KxHY<8cK8 8HHx8PH=? 9)(}#KxH=? Rɡ h$<8cK88HHyx8PHy<8cȀ8-He9 9@!(A,=?iR<`=a=@C0=ɋRnA@`(!m đAɡ`(U+:}k:=k lܑA`(2P$(h*(| IlAɡ`( l`(mX:9)!5@t= C0=ɋRn!`(ɡ(r[|8lܑ!!!`( $HT!0=? 9)@;`}#KxH<8cK8(8HHx8PH=? 9)X}#KxHI<8cK808HHx8PHɡ(=? R LA@ = R *H=? R (9`9@(| @PU`=A!9)!4@9k5J@9`a@89@8@!U):}i:})B=) paUi:})B=) !@})!@9ka5J@P< 8cpH(Y<8cK88HߩH&=;@888@88;|x;9@aUi:}):)p| @|xx} Kx}|[xH$aUi:}):)p| @@ }(Kx}~[x!9)!5J@WI8}):hlW:}):pW:}):|B p;Z4@T8;;aaTc 6|{8c<888H!9)!7@;W 6|}8c<888HW 68}<888H;@; ;a@:>:(?;,WI8})hlW 6;cxx88H=:cx8Ha|sxa~ҳxqx!Ax88<8L8H":cx8H|oxW 6|uxmx 8c88<8L8H";Z79@08;? ;„;a`;|< 8c„H<8cK88H!aTc 6|~8c8Hua<8cK88HT 6|"<8cK88HHcx8PH!9)!7@h=? 9)œ;`}#KxH<8cK88H}Hax8PHa9 9@!8A<8;;?C0=?RaTc 6|~8c8Hlca䓡ɡ(aUi:})=) lܓ(2nē($8h*89ka7@t8a8H 8c= C0=ɋRlca!ɡ`(a@| Plܑ!`(2nđ!`($8h*8=? 9)´;`}#KxH<8cK888H Hx8PH=? 9)̓}#KxHE=? Rɡ8h$<8cK88HڽHx8PH=? 9)䓩}#KxH =?ɩRrɡ8h$<8cK88HeHIx8PHI<8cȀ8-H58!|ˡN |!B|+x|3x|;x}Cx}9Kx}XSx= a)|H@L,A 8H,A 8><`| A$=)9)><8c8HHT<%c08c 8xH <%c08c,8xH<%c08c08xH<%c08c$8xHxxHxxHaxHaxHaxHqaxHacxxHG-CxxHG#xxHFxx HFaxHGqaxHGaaxH5h8!`|N |!@B|#x|+x|3x|;x}Cx}+KxAa! = a)|H@,A 8H\,A 8HH2| A | @ 8H$0| A | @ 8><`| A$=)9)><8c 8HHpt,A?; <88p<@;`aD8/H;(L<8c<$x~ųx|fx<8 d|hx=?9) x|jxH _88t<@aD8-HL<8c<Dx~x|fx<8 |hx=?9) |jxH _H?; <88p<@;`aD8/H;(L<8c<$x~ųx|fx<8 d|hx=?9) x|jxH͓88t<@aD8-HL<8c<Dx~x|fx<8 |hx=?9) |jxH}9p|H@<8 `8~óx~x8`<8<8pHx=?9)<~jxH :t|H@<8 `8~óx~x<8<8`8p9t=?9)<~jxHŀ,A9p|H@<8 `8~óx~x8`<8<8pHx=?9)<~*xHq:t|H@<8 `8~óx~x<8<8`8p9t=?9)<~*xH)9p|P9 4Ad<`| A$=)9)><8cp8HH)888a<88P8PHa8H! ؀ ,@ =? P88a0< 8t< 8x< 8ƭd< 8p= 9l=? 9)h9A4H?8=? 9)|!::P=?%ؐ;,= 9kda=? 9)D!= 9k`a=? 9)t!= 9kxa=? 9)l!= 9kha=? 9)d!= 9kpa=? 9)D!= 9k`a=? 9)@!= 9kta=? 9)x!= 9kla=? 9)h!=+9k a=?%)ؐ9)(!̑a=?%)ؐ9) !=?%)ؐ9) !ؓ=9k4pa=?9)4t!=.9kȑa=?+9)r!=+9kua=?+9) !=.9k(a=?+9)!=+9ka =?+9)! =?%)ؘ9)! =?%)ؘ9)! =?%)ؘ9) ! =?%)ؘ9)! =?%)ؘ9)! =?%)ؘ9)! =+9k a =? 9)P! $= 9kTa (=? 9)\! ,= 9kHa 0=? 9)8! 4= 9kLa 8=? 9)<`| A$=)9)><8cL8HAH=?9)h!8=? 9)!<@8&D8JH8L<8c ,<8 T|ex|fx<8||hx=?9)|jxHu8< 8cxxFxxhx)x~xHy,A08< 8cxxFxxhx)xAHA8!|N |H5!|+x|3x|;x}Cx}YSx,= a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c(8HyHx<8cDx8H<8cHx8 H<8cDx8H<8chx88H<8cDx8H<8cx8<`| @@=? =_,A@=,@ $|@|p|2p A2|q@`h=? )9`8, AL, @$8|[, @4q*@,|H$8q*A|Y})qA }kYK;7A?.;{ɰ=? )?@C0=˫Xm)!dA``(=?$=_ 2=Ë=? W:olAhh($(@<`@$8=?)AHM >r|=.;7@4|x|HQA|P|+x|;yA8|=.9ɰ=?=_}<2U):})9I `LA@h*ptHh(x|T:|. ;5k@8c4@p8!H$|!0B|vx|#x|+x|3x|;x}Cx}2Kx}QSx = a)|H@,A 8Hl,A 8HX,@'|HA| @ 8H,,@(|HA| @ 8><`| A$=)9)><8c8HH0>2:4uUk:}k3U):}) h*=?02?2;8pUk:}k/U):}) h*2?;8<@;`aD;$HaL<8c<8|#x<8<8|3x=?9)8|3xH!8<@aDHaL<8c<8|#x<8<8\|3x=?9)x|3xHѓ8?? ;9|!<@8D8HaL<8c<8|#x<8<8|3x=?9)|3xHq? ;=?=?$8<@aD86HaL<8c<8<8|fx<8|hx=?9)|jxH$8?_ ;ZA<@8'D82HaL<8c<8<88|fx<8(|hx=?9)P|jxHㅓ8? ;<@8(D83HaL<8c<8<88|fx<8|hx=?9)|jxH%!8<@ADHL=?9)!P=?9)!TX\~óx~x~x~x~gx}{x~Ix~*xHgQ8!|N |!B|ux|#x|+x|3x|;x}Cx}9Kx}TSxptx= a)|H@,A 8Hl,A 8HX,@(|HA| @ 8H,,@9|HA| @ 8><`| A$=)9)><8c8HH=})=`C0=_ɪm)!ah(=?29|Jlh(2=? l=? 8<8c88x8 H<8c88x8Hu<8c88x8 HY<8c88x8 H=<8c88x8H!<8c88x8 H<8c88x8 Hrrē8A<@!D`HdLhPlTX\=?9)!`8Ȑd;h;ēl8̐p8Аt8Ԑx8ؐ||~x<8exx~x9܁!XA\Hmh$h$Ā,A08~x~ijx88xx9!9AHH~x8xH~x8xH!~x~x~ųxxH q~x88xH =?=?t$=?9)!88<@8+D8NH8L<8c<8x<8||fx<84|hx=?9)`|jxH)$8<8c888899!9AH(8! |N |!B|~x|#xHݡ|@x,AP8a@xH <8cxH ҁ<8c|dx<8~lx8OH 98a@xH UH <8c<8~lx8OHih8!`|N |!Bax|#x|+x|3x|;x}Cx!}VSxȂ= a)|H@,A 8H`,A 8HL(| A| @ 8H(A*| A| @ 8><`| A$=)9)><8c$8HH:蒡8<~x~ųx}sx}kx}{x!9AH|<8cDx8HA=?!9);`}#KxH<8c88HHxx8PH=?!9)ē}#KxHU<8c~x8HHxx8PH<8cDx8H!x ,A?;H8;쓁<@; !D;`3aH;@AL<8cx~x|fx<8\|hx=?9)t|jxH %8<@!DaHAL<8cx~x|fx<8ݨ|hx=?9)|jxH %UH?;H8;쓁<@;@AD; 3!H;`aL<8cx8|fx<8\|hx=?9)t|jxH)88萡<@AD!HaL<8cx|fx<8ݨ|hx=?9)|jxH=? 0 LA@ =_ P *!H= P (!w=_ 0 LA@ =_ P *H=_ P (Ȁ|HP|X@aax ,Ah=?9)H!88<@8D8'H8L<8c|dx~x|fx<8|hx=?9) |jxH Hd=?9)H!88<@8D8'H8L<8c|dx~x|fx<8|hx=?9) |jxH9@4A 9`UI:9)}xI.9J4@`(am`<C0=?ɩh($ A*|x|HQA}P``}}[x|3x} CyAp8|Xx=?T}*:U):}) h($Ȁ4@ |(AT :9)|L.`*|M.9J5k@8c4@9`!i!i! !i:aH|sxaؒ=?:I4!!Aa88<8\Hma<8L8 Hia<8D8HQa<8X8 H9a9@5kAX=C0=?ɉ=?iPUI:})m@ԑ`(X(o 9J5k@<?! h8!`|N |ܐ!B|~x= a)|HA<8cT8HH?;l8=?!9)!<`| A$=)9)><8cդ8HHlA8<@DHLPTXa\x~x~x~Fx~'xhx)xxH aX<88H!80<8c<8T<8`<8 xH %8 8<8c<8<8<8L80=!9x9@H a8L;= a)!X@D8a<88P8PHy88 <9 P!@<8cL80<!8<8D8499!89A<`| A$=)9)><8c8HH,?;8>!:$<@:D8\HL<8cμ<8ϼ<8|fx<8|hx=?9)$|jxHY,AT8a`<8ŀ8P8PH;x<88P8PH;ACx<8 8P8PH;!P#x<8p8P8PH8a<88P8PHu8=?!9) !<@8D;`PaHL<8cμ<8p<8|fx<8=9 9!`|jxHi8a`<8$8P8PHx<8t8P8PH8?!;<@8DaHL<8cμ<8ϼ<8|fx<8=99!`|jxHm28a`<88P8PHex<808P8PHM8=?!9)!<@8DaHL<8cμ<8ϼ<8 |fx<8Ȁ=99!`|jxHE8a`<8Ș8P8PHx<88P8PHCx<888P8PH#x<8Ɉ8P8PH8=?!9)!<@8DaHL<8cμ<8ϼ<8|fx<8=99!`|jxH8a`<88P8PHx<8D8P8PH8=?!9) !<@8DaHL<8cμ<8<8|fx<8ʔ=99!`|jxH=?9)!8?!;<@8D8KH8L<8cμ<8ϼ<8p|fx<8ʤ|hx=?9)ʼ|jxH,Ad=?! $$! a+|x~HQA8.|x@HQA8>!:!I=?ϸ>_!:R$>!:s >!:>!: =Ë};U):}) A @};U):})jHW:-$W:j22TB*!aAH r*$*z2;{7Z@8;96@Ё! a+|x|HQAt.|x}`HQAT8|=!9$=_!9J};U):}) `$r z2 ;{5k@;94@8!H|! B|}x= a)|HA<8c8"HEH@8p88@:X>?:1`>_:Rh>:sl~4x>:p>: ~8x8<@DAHL8a8t8x8 8|99!9AHو|,i@ 8a88HUx8HP|,l@ ~x88H١8a@~xH(|,r@(8a88H8a@888H-|,s@܀p,@D8cx8 H5aԓ!Вa!8ap88<8H~x88pH։8a`~x88HpD8@8a`8Hɐa<88cx8 Ha4!0dA`8`\aXaTP8ap8P80H`x8Hqa8AܓAcx8 HQaԓ!Г8|a8ap88<88H8apx8Hp!9)!7@Ԁ8!|N |А!`B|tx|#x|+x|3x|;x}Cx}7Kx}VSx؃܃d|lx= a)|H@,A 8H\,A 8HH(| A| @ 8H$7| A| @ 8<<`| A$=)9)<<8c8H{HЀ,À7|x|HQA:| x}HQA8|=?|a:<@Dcxx%x~xGx~x=?9)=_9JHIA,AL8d`8`<@Dcxx%x~xGx~x=?9)}*KxHH,A08cxx%x~xGx~x=?9)TxH6e8!|N |a̐!0B|#x|+x|3x|;x}Cx}5Kx}SSx = a)|H@,A 8H\,A 8HH(| A| @ 8H$5| A| @ 8><`| A$=)9)><8c8!Hx!HȀ,A7} HP9)!p?;8=?!9)t!<@;@AD;`$aH; L<8c|dx8p|fx<8|hx=?9)|jxH y5} HP9)!p8=?!9)x!<@ADaHL<8c|dx8p|fx<8|hx=?9)|jxH H7} HP9)!p?;8=?!9)t!<@;@AD;`$aH; L<8c|dx8p|fx<8|hx=?9)|jxH{!5} HP9)!p8=?!9)x!<@ADaHL<8c|dx8p|fx<8|hx=?9)|jxHz?!;x=?!)t})֑!T:p8ap8txHSiT:p8ap8xxHSMT:p8ap8|xHS188<8@!DHtLxP|TX\#xx~ex~Ƴx~x~x~x=_!9JtHF8atxHPi8axxHP]8a|xHPQ8!|aN |! B ,= a)|HA<8cp8HuH<8cx84Hha=?$)`؀ ,A$<!8cHH<!8cHH8?c;`; ;@;`;PHd!9)!IP}XR8!<`| A$=)9)><8c8HrH8a<88P8PHs8a<8H8P8PHs8a <88P8PHs8ap<88P8PHsm8a<888P8PHsU8a<88P8PHs=8a`<88P8PHs%8a<8(8P8PHs 8a<8x8P8PHr8aP<88P8PHr=?9)!8?!;<@8&D8PH8L<8c$<8L|ex|fx<8,=99!|jxHya,A<8cTx8@Hd<8cx84Hd?!;=?ɻ=?$=?9)ȑ!8<@8D8HH8L<8c$<8<8 |fx<8|hx=?9)|jxH $=?LhA$sUk:}k7U):}) h*=?l2nUk:}k6U):}) h*2?;H88<@;D;`"aHL<8cL<8L|#x<8ƺ$<8\|3x=?9)p|3xH88<@DaHL<8cL<8L|#x<8ƺ$<8罔|3x=?9)|3xH?;H8=?!9),!<@;@ AD;`4aH;L<8cL<8L|#x<8ƺ$<8|3x=?9)|3xH]8=?!9)@!<@ADaHL<8cL<8L|#x<8ƺ$<8|3x=?9) |3xHH$<8cTx8AHaY<8cx86HaE<8cx83Ha1<8cx8?Ha<8cDx82Ha <8cxx8BH`?;H8=?!9)!<@;@AD;`+aH;L<8cL<8L|#x<8ƺ$<8翼|3x=?9)|3xH8=?!9)0!<@ADaHL<8cL<8L|#x<8ƺ$<8|3x=?9)|3xHœ8=?!9) !<@;@AD;`,aHL<8cL<8L|#x<8ƺ$<8D|3x=?9)`|3xHe8=?!9)4!<@ADaHL<8cL<8L|#x<8ƺ$<8|3x=?9)|3xH 8=?!9)$!<@ADaHL<8cL<8L|#x<8ƺ$<8|3x=?9)|3xH8=?!9)8!<@ADaHL<8cL<8L|#x<8ƺ$<8|3x=?9)8|3xH]8=?!9)(!<@;@AD;`-aHL<8cL<8L|#x<8ƺ$<8d|3x=?9)|3xH8=?!9)<`| A$=)9)><8c88HbH(8xx~xFxxhx)x9AHO=? h @=?Hh$8xxExxgx(x9!~xH݀,A$28xxExxgx(x9!AHHl<8cXx8?:1\::a =?!9)!$:p=?!9)(!(=?!9)@!,=?!9)X!0=?ɧP=?!9)p!4=?É=?!9)!8=?éX=?!9)!<=?!9)!@=?i8!89!!<@aD!H8L9 !P<8c|dx<8<8ơ<8=9\=?9)=_9JH 1,@(!$<!8cHU}<8c\~x8H9 <8c\~dx8H8HP~x$x8PHI~óx~Dx}kx~x8(xH~x}{x~fx8(xH!9)!!9)!!(<!8c(HT<8c\88H8Q<8c\88H8=HP!~x$x8PHI!!9)})ր})U):})  !,<!8c@HTQ<8c\8 8H7HO~x$x8PHH7A;!9)r|H@};Kx7A;!9)|H@}=Kx=?頄}QA\|P|;yA8!9)}Iցa}*ZU):}) *9ka4@܁!9)!5@!0<!8cXHSY}~P9k}<`| A$=)9)><8cH8 HPH8?;h8!<@;@ AD;`;aH; L<8ct|dx~ųx|fx<8稈|hx=?9)|jxHT8<@ADaHL<8ct|dx~x|fx<8|hx=?9)|jxHTQ8<@ADaHL<8ct$x~ųx|fx<8 |hx=?9)0|jxHT 8<@ADaHL<8ctx~x|fx<8l|hx=?9)||jxHS8!|N |H\!`|+x|3x }Cx}5Kx}PSxA ؂! ܁ ~ӳx= a)|H@L,A 8H,A 8><`| A$=)9)><8c8!HNHL8a 8 8 8 xH )œ88a <18^<18^<18^8 9 9! 9A H=?!9) ,A ,@ -A Ȁ })=`C0=_ɪ@m)! a  h(=?2=?1 ^.|Jl a  h(2=?1 ^=? =?1 ^8 ;acx<88F8FHO)8aV<88F8FHO8a<8D88HN8a<8X88HN8a<8X88HN8a<8l88HN8a<888HN8a<888HN8;x<88<81:^=?ɖ |?_1;Z^ ??1;9^ 888<@D8H9! ̑!L!P8 T8 @X!\!`8 pd8h8 Аlp9 F!t88x8|;<!8 <8c|dxex<8Ɨ|3x=!9=?9)9A H  ,A p t$ x$ |$  ;x<88<81:^o`  ((h(`r a ȁ+|xHQA>C0=?)@=_J?_1;Z^=t??1;9^=? ?!;ޒo  ((h(r?;H@X ؐ@! a A H Y! a A H H=?Ét  HǺ<*H r H= !r|9{}+}=JU):}) 2 ,A$}+}=JU):})zr ;7@;{7@88! \HwT|!B|~x= a)|HA<8c$8HFH<8cDx82H:Y8a@8D8HxH р@! | @,A<8cxx8/H<8cx88H:8a@8D8HxH h8!`|N |A! B|yx|#x|+x|3x|;x}Cx}5Kx}RSx= a)|H@,A 8Hl,A 8HX,@'|HA| @ 8H,,@(|HA| @ 8><`| A$=)9)><8c8HEaH88a<18U<18U<!8ƒ<!8璸=!9=?!9)=_!9JH,@=?!), A=`C0=?ɉPltapɡp`(h=?IP(l|axx`(*=?i=?1ѩUԀl|axɡx`(hP(ltapp`(*=?1ѩU<8c~x~ExxH<8c<18U<18UxHY<8c<!8xHI<8c<!8<!8xH1?!;=?ɎT=?<$?;$8<@8+D81H;@AL<8c\<8<8L|fx<8@|hx=?9)l|jxHoU$8?!;{a<@8D82HAL<8c<8|#x<8ƍ\<8礠|3x=?9)|3xHn員8?!;<@85D84HAL<8c\<8<8|fx<8|hx=?9)$|jxHn=?19)Uԑ!8=?19)Uؑ!<=?!9)!@DaHr8L=?!9)!P=?!9)!TX\#xx~x~x~dzx~hx~x~JxH8<8c\<18U<18U<!8ƒ<!8璸=!9=?!9)=_!9JHU8!|AN |ܐ!B|{x|#x|+x|3x|;x}Cx}8Kx= a)|H@,A 8H\,A 8HH(| A| @ 8H$8| A| @ 8><`| A$=)9)><8c8H@H,At=?9)!8=?!9)!<@8 D87H8L<8c<8|#x<8ƈ<8破|3x=?9)|3xH Hp=?9)!8=?!9)!<@8 D87H8L<8c<8|#x<8ƈ<8破|3x=?9)|3xHk88<xx%x~xGxx=?!9)AxH.ŀ,@`,A,8a`<88P8PHA8a<8HHh<8cx83H2<8cx8,H,@,AT8a`<88P8PH@8a<8H8P8PH@<8c|dx8`x8PH aH,<8cx8#H2<8cx8H1H8!@|N |Ԑ!B|#x|+x},KxADH\`dxd= a)|H@,A 8H\,A 8HH(| A| @ 8H$,| A| @ 8><`| A$=)9)><8c8H=H<(} HP9):,} HP9)88H8|p|9 ,A9 , @;H;|p|9 ,A9 , @|+x9`9@,AL,@$8}@[, @4p@,}JH$9@q A}JY})qA }kYK| @lx9`9@,AL,@$8}@[, @4s@,}JH$9@q A}JY})qA }kYK| A9`9@|+yAL, @$8}@[, @4q @,}JH$9@q A}JY})qA }kYK| A@<8cx8=H/!<8c$x8=H/ <8cdx8H.9`9@yAL, @$8}@[, @4q @,}JH$9@q A}JY})qA }kYK| A@<8cxx8=H.<8c$x8=H.m<8cdx8H.Y=?!9);`}#KxH9<8cpDx8H5<8cpx8H!H5xx8PH.HL!8=?9)p!<`| A$=)9)><8c8H4%H+8a`<88P8PH58a<88P8PH58a<8l8P8PH58aP<88P8PH5u8a<88P8PH5]8a<8 8P8PH5E8a@<8\8P8PH5-8a<88P8PH58a<88P8PH48a0<88P8PH48a<8L8P8PH48a<88P8PH48a <88P8PH48ap<8<8P8PH48a<88P8PH4m8a<88P8PH4U8a`<8,8P8PH4=8a<8|8P8PH4%8a<88P8PH4 8aP<88P8PH38a<8l8P8PH38a<88P8PH38a@<8 8P8PH38a<88P8PH38a<8\8P8PH3},Ap=?9)!8=?!9)!<@8D8PH8&L<8c|,|dx<8}|fx<8=9}9!`|jxH 5Hl=?9)!8=?!9)!<@8D8PH8&L<8c|,|dx<8}|fx<8=9}9!`|jxH5Q= a)|H@<`H(= a)|H@(l=?!), A"049)}iր}kUk:}k})})U):}) 6} P9I5A 49)||=?i|T=?|t}i}kUk:}k9k})})U):}) HLA@P*PATHP(@AD9>})ր})U):}) HLA@,P*8<|PPl\AXXH(P(04|PPlLAHH@( 69)}*Kx} QA8||=?i|T=?|t<`C0=?ɉ }**U):})8}*2U):}) XLA@h*PaTHh(@aD}*2U):}) XLA@,h*8<|XPl\aXXH(h(04|XPlLaHH`(9J5@4;4A$8K=?!), @4IP;7ZA$ =? |T=?I|t=C0=?) 9>}i}kUk:}k9k})})U):}) @LA@P*PATHP(@AD9>})ր})U):}) @LA@,P*8<|PPl\XXH(P(04|PPlLHHH( 69)}*Kx|QA\8|`|=?|T=?|t8|?C0=?i }*U):})8}**U):}) `LA@h*PTHh(@D}**U):}) `LA@h*8aC0=? 9>}i}kUk:}k9k})})U):}) HLA@P*hAlHP(`Ad9>})ր})U):}) HLA@,P*PT|PPl\XXH(P(@D|PPlLHH@( 69)}*Kx|QAd8||=?|T=?|t8|<`C0=?i }*"U):})8}**U):}) `LA@h*hlHh(`d}**U):}) `LA@h*PaTHh(@aD}*U):}) `LA@<h*8!<}(J9)})p})})XPm)!\aXXH8h(0!4}(J9)})p})})XPm)!LaHHX(9J4@;7AK=?!), @4IP;7ZA=?)|T=?I|t=C0=? 9>}i}kUk:}k9k})})U):}) HLA@P*hAlHP(`Ad9>})ր})U):}) HLA@,P*PT|PPl\XXH(P(@D|PPlLHH@( 69)}*Kx} QA8|`|=?|T=?|t8|}i}kUk:}k9k})})U):}) HLA@P*xA|HP(pAt9>})ր})U):}) HLA@,P*hl|PPl\XXH(P(`d|PPlLHH@( 69)}*Kx} QA8|`|=?|T=?|t8|C0=? =UUaUV9>})})U):})9 9>})})U):}) PLA@H*xA|HH(pAt9>})ր})U):}) PLA@H*halHH(`ad8|ց6|JT:|.PLA@8H*PT| |p||XPl\XXH4H(@D| |p||XPlLHH@(69)} P}*Kx5A8||=?|T=?|t8|<`C0=?i }*"U):})8}**U):}) `LA@h*xa|Hh(pat}*:U):}) `LA@h*hlHh(`d}k}*:U):}) `LA@h*PTHh(@D}k}**U):}) `LA@h*8!})ր})U):}) PLA@H*x|HH(pt}K9>})ր})U):}) PLA@H*halHH(`ad9>})ր})U):}) PLA@<H*P!T}*J| p})p| P|XPl\XXH8H(@!D}*J| p})p| P|XPlLHH@(;7AK =?!), @84IP;7ZA=?I|T=?)|t=C0=? =UUaUV9>})})U):})9 9>})})U):}) PLA@H*AHH(A9>})ր})U):}) PLA@H*xa|HH(pat8|ց6|JT:|.PLA@8H*hl| |p||XPl\XXH4H(`d| |p||XPlLHH@(69)|P}*Kx4A8|`|=?|T=?|t8|?C0=?i }*U):})8}*"U):}) `LA@h*aHh(a}*2U):}) `LA@h*x|Hh(pt}k}*2U):}) `LA@h*hlHh(`d} }*"U):}) `LA@h*PaTHh(@aD| 2T:|.`LA@<h*8!<}(J9)})p})})XPm)!\XXH8h(0!4}(J9)})p})})XPm)!LHHX(9J4@P9~}+ր})U):})9 }k}kUk:}k PLA@H*aHH(a9>})ր})U):}) PLA@H*x|HH(pt}K9>})ր})U):}) PLA@H*halHH(`ad9>})ր})U):}) PLA@@H*P!T}*J9)| `})p| P|XPl\XXH<H(@!D}*J9)| `})p| P|XPlLHH@(;7ZAxK=?!), @́4P;7AL=?I|T=?)|t=C0=? 9>}i}kUk:}k9k})})U):}) PLA@H*AHH(A9>})ր})U):}) PLA@,H*x||PPl\XXH(H(pt|PPlLHH@( 69)}*Kx|QA8|`|=?|T=?|t8|?@C0=?i }*U):})8}*"U):}) `LA@h*aHh(a}**U):}) `LA@h*x|Hh(pt}XP}*"U):}) `LA@h*halHh(`ad}**U):}) `LA@0h*PT||XPl\AXXH,h(@D||XPlLAHHX(9J4@;7A Kt=?!), @4P;7A t=?I|T=?)|t=C0=? 9>}i}kUk:}k9k})})U):}) PLA@H*AHH(A9>})ր})U):}) PLA@,H*x||PPl\XXH(H(pt|PPlLHH@( 69)}*Kx|QA8|`|=?|T=?|t8|?@C0=?i }*U):})8}**U):}) `LA@h*Hh(`}*"U):}) `LA@h*x|Hh(ptT<}XP}**U):}) `LA@h*halHh(`ad}*"U):}) `LA@<h*PT||p||XPl\AXXH8h(@D||p||XPlLAHHX(9J4@;7AKT=?!), @4IP;7ZA|=?I|T=?)|t=C0=? 9>}i}krUk:}k9k})})rU):}) PLA@H*AHH(A9>})ր})U):}) PLA@,H*x||PPl\XXH(H(pt|PPlLHH@( 69)}*Kx|QA8|=?|T=?|t8|<`UU`cUV>C0=?i }*U):})8}**U):}) `LA@h*Hh(T <}*"U):}) `LA@h*x|Hh(pt}XP}**U):}) `LA@h*halHh(`ad}*"U):}) `LA@@h*PTT<|} |p} HP})XPm)!\XXH<h(@DT<|} |p} HP})XPm)!LHHX(9J4@;7ZAKH=?!), @8a`<88P8PH8a<8@8P8PH,Ap=?9)!8=?!9)!<@8D8PH8&L<8c|,|dx<8||fx<8矐=9|9!`|jxH yH=?9)!8?!;<@8D8PH8&L<8c|,|dx<8||fx<8矐=9|9!`|jxHA8!<@xDxex~Ƴx~x~x~ixxH%;@8@97A }p|T<|pA|3} HP|Wx})|x7AWC<5} HP})|| x4A$8|=?i|T=?|t?`C0=?ɉ ||A}*"U):}) XLA@h*Hh(}'"U):}) XLA@h*aHh(a|Z|p|}'"U):})| @Pl\aXX`( }*"U):})l\aXX`( }J4@޺7AK3} HPTW<})|x7A\[x5} HP})|| x4A,|8|=?i|T=?|t8|`=C0=?ɉ |A}*"U):}) XLA@h*Hh(}*U):}) XLA@h*aHh(a|Z|p|}*U):})| @Pl\XX`( }*"U):})l\XX`( }J4@ ޺7@WZ<`| A$=)9)><8cr8HH8a888xH Aa8xH p=,Acx<8rx8 H,@\8A<@DaHALP!TX\`<8cO0x%x}kx ~x~ʳxH 9Hcx<8rx8 H5,@TA8<@aDAHL!PTX\x$x}kx ~x~ɳx xH vH<cx<8rx8H,@$<8cr<8O0x8H!Hcx<8rx8H,@TA8<@aDAHL!PTX\x$x}kx ~x~ɳx xH YeHcx<8sx8 H,@\8<`| A$=)9)><8c`<8HeHp8! 8ap<8`X8P8PH8a<8`8P8PH8a<8`8P8PH8a`<8aH8P8PH8a<8a8P8PH,A@5} HP9)? C0==`ak| XA<`| @~H, Ax=? ?=? 5 LA@ = 5 *@DH=? 5 (04P=? ?= 5 LA@ =? 5 *@DH= 5 (04T8T8=?9)5!<@aDHL,PTX\x~x~Fx~x~x~)x9APHс! ,A=? ?= 5 LA@ =? 5 *@DH= 5 (04X=? ?=? 5 LA@ = 5 *@DH=? 5 (04\8\8=?9)5!<@aDHLa0aPTX\x~x~Fx~x~x~)x9AXHٽ=? ?=? 5 LA@ = 5 *@DH=? 5 (04\=?9)5p!8!<@!DH!La$aPT8`X\x}$Kx~Fx}'Kx~x9A\H=? ?=? 5 LA@ = 5 *@DH=? 5 (04X=?9)5p!8!<`| A$=)9)><8cK`8HХH ,A48< 8;a8a<@D! ,!H 0L! 4!P 8T=?9)K|!X=9ka\=?9)K!`ad=?9)!h8<l;@p;Htx! !| ! ! 88)<8c}d[x~x~Ƴx~gx~Hx~x~xH 6@hHplt8T;x<8K8F8FH8a<8L8F8FH;!#x<8LH88H8a<8L\88H8a<8Lp88Hй8a,<8L88HС;Гԓؓ;ACx<8L8<8<`| @8! L 8! H 8!|N |!B|yx|#x|;x! <`| A$=)9)><8cF88H HD8a8xH Ih18| |x;;@;`;>b,Aha8(<`| A$=)9)><8cBh8 HH<8cB88x8Ha8a`<8B8P8PHE8a<8B8P8PH-=?9)C8!8? ;<@8D8PH8L<8c <8 |ex|fx<8CL=9 9!`|jxHɱ,A=?  ?;Cd8=? 9)!<@8D; H;`aL<8c <8 |#x<8 <8Cx|3x=?9)C|3xH8a`<8C8P8PH)8a<8C8P8PH=?9)C8!8=? 9)!<@D8PH8L<8c <8 |ex|fx<8DL=9 9!`|jxHș8=? 9)!<@8 D8.HaL<8c <8 |#x<8 <8Dl|3x=?9)D||3xH롁><`| @=? ), A8|xHQA\9| x}@HQA8|= 9< 8< 8c|dx| :T:}  @8,A 2H}+:U):}) h* 9k5J@87AK`8|xHQA9| x}@HQA8|= 9< 8< 8c|dx| :T:}  @8,A 2H}+:U):}) h* 9k5J@87@dH8!@|N |ۡ!Ba|#x = a)|HA<8c?8HH\=?$)| ,@ ,A(<8c@8EH<8c@Lx80H;?;{@|?_ ;Z9;P; >1:Έ> ::&> :9>bRx~x~ѳxx<8@8P8PH8a<8@8P8PH8a <8A48P8PHq8ap<8A8P8PHY8a<8A8P8PHA8a<8B$8P8PH)8a`<8Bt8P8PH8a<8B8P8PH8a<8C8P8PH8aP<8Cd8P8PH8a<8C8P8PHa8A<@DH!L<8c |dx|ex<8<8D=9hx|3xHa8<@DH!L<8c |dx|ex<8<8D=9hx|3xHœa8<@DH!L<8c |dx|ex<8<8DD=9hx|3xHy|A;:|HA,A$2| AA,@;,@@<8cD`x8EH<8cDx8(H<8cDx8?H,At;; ;@';`?c8! :$=19Έ=? = 9%> :%@= =?é,}sx> ::> :$:> :$P:? ;;;`P:`:A?? ;9p;9?_ ;Z\;Z9W:}+ ,Atl<C0(}+z}+k:LA@*H( H,1m =`C0a(! PW:a8a8HH=?9)?!8? ;T8"HMH=?9)>!8=? 9)t!<@8D8:H8L<8c8<8`|ex|fx<8>|hx=?9)>|jxH=?9)? !8? ;p<@8 D8<H8 L<8c8|dx<8||fx<8?,|hx=?9)?8|jxH,@T8:: > :;`?? ;9;A?;{?t? ;x;;P:!;< 8cH<8c888Hy<8c888HeHIY< 8cH<8c888H=<8c888H)H a8!|JT:|<@DHL<8c`<8`|#x<88x|3xIx|3xHQ!9)!7@!9)!6A0K=? )t, A@=? )p, @0=? 9)x<> <>   <=H=? )p, @x88= 9x=? 88G9`}*ZU):})B 9k4@84@Аa=? 9)x=  H\=? )p, @L888= 9x=? ̐9@9`} ZU):})B 9k5J@a!9)!4AK=? )p, @0=? 9)x<@ <   <?H=? )p, @L= 9kx=? =?   =?   HL=? )p, @<=? 9)x<@ <   8   =?9)!8!<`| A$=)9)><8c98HH$;a̓a8;AГA<:Ԓ@;!ؓ!D;ܓH:L8P8T8X8\`x~gx~x~x9AH=<8c9x8-Hy=? 9);p}#KxHɀT:|<8c88HIT:|<8c88H)H xx8PH =? 9),}#KxHaT:|<8c88HနT:|<8c88HHxx8PH=? 9)D}#KxH<8cx8H<8c~dx8Hq<8c~x8H]<8c~x8HIH-xx8PH-=? 9)\}#KxH5} HP9)!<8c88H4} HP9)!<8c88Hсu}`XP9k4} HP9)}kI֑a<8c88HHyxx8PHy=? 9)t}#KxH<8cdx8HYH=xx8PH==? 9)}#KxH<8c88HHxx8PH=? 9)}#KxHU<8cDx8HHxx8PH=? 9)}#KxH<8c~ijx8HHxx8PH=? 9)ԓ}#KxH<8c$x8HiHMxx8PHM=? 9)쓩}#KxH<8cx8H-Hxx8PH=? 9)}#KxHe<8c~x8HHxx8PHՓ8; <;@D<8c:<8:(88gx99!9AH8<@D<8c:,<8:(88899!9AH٭88<@D<8c:8<8:(88Gx99!9AHm8<@D<8c:<8:(88gx99!9AH188<@D<8c:@<8:(88'x99!9AH8;<@D<8c:H<8:(88x99!9AHر88 <@D<8c:P<8:(88~x99!9AHq8<@D<8c:\<8:(88~dzx99!9AH5X8!P|!N |! B|wx|#x|+x|3x|;x}Cx}>Kx}SSxA!!! a!$A!(!!4!8!<`| A$=)9)><8c.8HH\,A=?9).$!8? ;@<@8D87H8L<8c݈<8,<8|fx<8.4|hx=?9).L|jxH =? 9)D h@= * =?9).!8=? 9)D!<@8D87H8/L<8c݈< 8@<8|fx<8.|hx=?9).|jxH aH=?9).$!8? ;@<@8D87H8L<8c݈<8,<8|fx<8.4|hx=?9).L|jxH)=? 9)D h@= * =?9).!8=? 9)D!<@8D87H8/L<8c݈< 8@<8|fx<8.|hx=?9).|jxH=? 9)@!8=? 9)D!<@Dxdx%x~xGxx=?9)݈}*KxHbـ8!|N |!pB|#x|+x|3x|;x}Cx}3Kx̃!ЃAԃ؂A0= a)|H@,A 8H\,A 8HH:| A| @ 8H$8| A| @ 8><`| A$=)9)><8c+8H%H܀<|H@l,A,8a`<8+8P8PH8a<8,Hx<8c,hx8FH=<8c,x8FH)<8c,H;|H@,Al8a`<8+8P8PH)8a<8-8P8PH8a<8-d8P8PH<8cڔ|dx8`x8PH H@<8c-x8EH<8c,x8FHq<8c-x8H]8Ha8<@DHLPxdxx'xHx xxH! ,AHa8<@DHLPxdx~exx'xHx xxHa ܀D4Ha$䀡H<`| @8! 88!|N |! B|~x= a)|HA<8c*8HH888Kx}XSx!CWx= a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 89<`| A$=)9)9<8c)8HiHh?;)<8=? 9)!}:IU):8<@ADHLPTX\cx<8|#x}{x~x~hx})xH HD8|9T:8<@Dcx}{x~x~fx|~Hx~x~xH I;|A`88|<@8D8*H8L<8c<8|ex|fx<8!|hx=?9)!|jxH9 |A|,A9 , @8ap8txH 8!|N |!0B|~x= a)|HA<8c8HHH8aL8P8TxH ;?`c{?;;!L;:P:>::P:`:@(:~x:!TH8a`<88P8PH8a<8 L8P8PH8a<8 8P8PH8aP<8 8P8PH}8a<8!<8P8PHe8a<8!8P8PHM8!<@DHL<8c<8<8|fx<8!=9X9!`|jxH!L9)( AT8<@aDAHL<8c<8|#x<8<8!|3x=?9)"|3xHL,A ,@TA8!<@aDAHL<8c<8|#x<8<8"0|3x=?9)"|3xHL,@DPT LA@0<8c"Hx8KHs<8c"x8AHsH;9 ,A|@9 , @8aXxH !8a`<8"8P8PH8a<8#(8P8PH8a<8#x8P8PHq8aP<8#8P8PHY=?9)$!8;X<@8D8PH8L<8c<8|ex|fx<8$,=99!`|jxHxxH E8a\8`xH tX! | @8a\8@xH vu8aL8P8TxH o 8ad8h8l8pxH sI8at8x8|8xH tL,@$<8c|dx|ex|fxxH tHL,@0<8c<8|ex|#xxH t8at8PHL,@L<8c<8|ex|fxxH tqP=?h*D8at8P8|8DHTL,@P<8c|dx|ex<8xH tT=?h(H8at8H8|8TxH u<8c$H8L8x8H<8c$X8P8x8He<8c$l8T8x8HI<8c$8X8x8 HQ8!|N |Ԑ!B|xx|#x|+x|3x|;x= a)|HA<8c8H|H;! #x<88F8FH~q8a <8\8F8FH~Y8a \<88F8FH~A;ACx<88F8FH~%8a<8 48F8FH~ 8a <8 |8F8FH}8aR<8 8F8FH}8a<8! 8F8FH}8a<8!T8F8FH}8a$<8!8F8FH}8aj<8!8F8FH}}8a<8",8F8FH}e8a<8"t8F8FH}M8a<<8!8F8FH}58a<8"8F8FH}8a<8#8F8FH}8a<8#L8F8FH|8aT<8#8F8FH|8a<8!8F8FH|8a<8#8F8FH|8a&<8$$8F8FH|8al<8!8F8FH|u8a<8$l8F8FH|]8a<8$8F8FH|E8a ><8$8F8FH|-8a <8%D8F8FH|88a<8%88H{8a<8%88H{8a<8%88H{8a<8%88H{; 8  ;a cx<8%8<8}9J9);< 8c8Hr8 P<8c8 P8HVYHn=~<|z;8c|8<~fxHui;7@889! !<@D9a TaHLPTX\W : })9)!`dhl! !ptx9`a|!!8 <8cX|dx8<8ƿ|3x9=?9)9A dH  `,A; 6@ 8! |N |!pB:@:`AaAaAaAaAaAa :::: ! !$|}x|#x|+x|3x|;x}Cx!Aā܀= a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c 8HquH 8 ! 8aL8P8T8XxH M8a\8`8d8hxH 98al8p8t8xxH 98a|8888xH <8c̀xH !<8cxH y !|,A LA@ L@@LA@L@@88̐<А@ԐDؐHaL!PATX!!\AA`=?9)̑!d8h8lptaax|<8cxxFxx!āAH:8 H !\ LA@d L@@A` LA@h L@@<8c|dx<8|+xxH <8c|dx<8|+xxH 88a888899!9AHå;|H@9|H@xxDx8xH%xxĀ8xH | x9)!| x9)!<8c<8 xH |Հ,A(X=?h(<8c8H$X=?h(<8c8<88X<8=9xH }=?9)!8=?9)!<@<8c<80<8}&Kx<8=9} Cx} CxH ~;x88Hx=?:I!Aa998a88<8ƺ 8PHX=?h(<8c88x8PH ; x88Hi=?9)!!!A!@AD9@AaaHL8a8@8H<8ƺ 8PH9X=?h(<8c88x8PH ;P8|)T:!|JT:|x88H}=?9)!$!!A!pAt9@A9`a!A!xA|8a8p8x<8ƺ 8PHqX=?h(<8c88x8PH =,A!)!(A !2a h(r2!zH !$!0a04H =? !2H !*$;=? 2x88H= =?9)!,!!A !A9@A9`a!A!A8a88<8ƺ 8PH1X=?h(<8c8Hx8a8xH _I,@8!I<`@$8=_*A004H !H! Ԁ,@8AJ<`@$8=+A004H] !H! <8c<8 xH x1X=?h(<8c8<88X<8=9xH y=?9)!8=?9)!<@<8c<80<8}&Kx<8=9} Cx} CxH z);x88HQx=?:!::8a88<8ƺ 8PHaX=?h(<8c88x8PH -;x88Hx=?: !!8!A!A8a88<8ƺ 8PHX=?h(<8c88x8PH ,Aa<8!48Hh,@!=? !2=? !2=_ !$H- !*$;=? 20x880Hœ$=?9)!,! ! A$!8A<9@A9`a!A!@AD8a888@<8ƺ 8PHX=?h(H<8c8H8x8PH xH X8a\8`8d8hxH 8al8p8t8xxH !8!|N |! B|}x|#x|;x }/KxAA!$!48A<@l= a)|H@,A 8H\,A 8HH:| A| @ 8H$8| A| @ 8><`| A$=)9)><8c8HeyH a<848Hg8P8a0<8<88Hf98`d;<`= a)!`,Ap8AKx = a)|H@T%|H@ 8H&|H@ 8><`| A$=)9)><8c 8HW1HȀ=|HA;|H@8a@8D8H8LxH Ke@,AD,AL,@P<8c|dx|ex|fxxH L;|H@8H,8H8x8!p|N |!B|~x|#xH-|@x,AP8a@xH v<8cxH w <8c0|dx< 8x82H 98a@xH vH <8c0< 8x82H=h8!`|N |Hu!P|rx!̐!А!Ԑ!}Cx}7KxA!䃁!"!"""a"< 8cXHN<8c8 8H2)<8c8 8H2HIW:j! )( })U):}))P H !(n:U):})z! 9)! 7@! 9)! 7@8!"X      ă t; 7AL;= 9kpa >@?:=? 9)و! = 9k٠a =?é=k=?鞌=? 9)ٸ! = 9kБa =? 9)! =?É= 9ka =? 9)! = 9k0a =? 9)H! = 9k`a =? 9)x! =˝H=? 9)ڐ! = 9kڨa =? 9)!!= 9kؑa!=? 9)!!= 9ka! =? 9) !!= 9k8a!=? 9)P!!= 9kha!=? 9)ۀ!! = 9kۘa!$=? 9)۰!!(W :,@,a"+9)|HA39)3! 9)! :9):U):})l zUk:}k39))h+:9)}6I}.Ja ȑ+< 8cpHK<8c8 8H/QHG5:U):})jI:U):})z:9):U):}) zUk:}k39)Px+:9)}6I}.Ja ̑+< 8cوHK1<8c8 8H.HF:U):})jI:U):})z:9):U):}) zUk:}k39)w+:9)}6I}.Ja Б+< 8c٠HJ<8c8 8H.)HF W:j<H !r(n:U):})z:9):U):})\*$ zUk:}k3=)9)+:9)}6I}.Ja ԑ+< 8cٸHI<8c8 8H-qHEU:U):})jI:U):})z:9):U):})*$ zUk:}k3=)9)Ũ+:9)}6I}.Ja ؑ+< 8cHIE<8c8 8H,HD:U):})jI:U):})z:9):U):}) zUk:}k3=)9)츑+:9)}6I}.Ja ܑ+< 8cHH<8c8 8H,9HD:U):})jӉ:U):})za"X+8   } Iցa"\}+Ja +"| < 8cHH9<8c8 H W):}) ,@, ,A9 ; H 9 ;a" | P:| A D39)3! 9)!  ,@$:9):U):}) l zUk:}k3}=J9)'+:9)}6I}.Ja +< 8cHGYHB݁:U):})jI:U):})z Đ :9):U):}) p zUk:}k3}=J9)N +:9)}6I}.Ja +< 8c0HFHBU:U):})jI:U):})z Đ 9 ! ;H;:9):U):})W;:{l :U):})'| :9)}6I}.Ja +< 8cHHF)<8c8 8H)HA:U):})jI:U):})z:9):U):}) zUk:}k3}:U):})jӉ:U):})za"X+8   } Iցa"\}+Ja!+"| < 8cHB<8c8 HDW):}) ,@T ,A9 ;LH 9 ;a" | P:| A39)3! 9)!  ,@$:9):U):}) l zUk:}k3}=J9)'+:9)}6I}.Ja!+< 8cHBH=:U):})jI:U):})z Đ :9):U):}) p zUk:}k3}=J9)N +:9)}6I}.Ja!+< 8cHAH=:U):})jI:U):})z Đ 9 ! ;H;:9):U):})W;:{l :U):})'| :9)}6I}.Ja! +< 8cH@<8c8 8H$yH<]:U):})jI:U):})z:9):U):}) zUk:}k3}5<8c8 8H!H9:U):})jӉ:U):})z:9):U):}) :U):})?;P:9)}6I}.Ja! +< 8cۀH=<8c8 8H!%H9 W:j;H !r(n:U):})za"X+8   } Iցa"\}+Ja!$+"| < 8cۘH= <8c8 8H H8}a"X+8   } Iցa"\}+Ja!(+"| < 8c۰H<<8c8 8H EH8)H<8c ~x8JH1!;97@ x,A39)3! 9)! :9):U):})?C0=룘 |l d ` `( zUk:}k3=)9)|ؑ+= 9kȁ:9)}6I}.J+}c[xH;<8c8 8HaH7E:U):})j;`i:U):})z;:9):U):}) l d ` `( zUk:}k3=)9)+= 9k:9)}6I}.J+}c[xH;<8c8 8HH6:U):})ji:U):})z:9):U):}) l zUk:}k3=)29)+= 9k:9)}6I}.J+}c[xH:H6 :U):})j??:U):})z;:9):U):}) p zUk:}k3=)29)ȑ+= 9k:9)}6I}.J+}c[xH9H5}:U):})j:U):})z:9):U):}) zUk:}k3=)29)ؑ+= 9k(:9)}6I}.J+}c[xH9u<8c8 8HH4:U):})j:U):})z:9):U):}) zUk:}k3=)29)*+= 9k@:9)}6I}.J+}c[xH8<8c8 8HiH4M:U):})j:U):})z:9):U):}) zUk:}k3=)9)x+= 9kX:9)}6I}.J+}c[xH8E<8c8 8HH3zUk:}kj=? :U):})z:9):U):}) zUk:}k3=)9)∑+= 9kp:9)}6I}.J+}c[xH7<8c8 8H1H3zUk:}kj=?鞘:U):})z:9):U):}) zUk:}k3=)9) += 9k܈:9)}6I}.J+}c[xH7<8c8 8HH2u:U):})j:U):})z:9):U):}) zUk:}k3=)9)(+= 9kܠ:9)}6I}.J+}c[xH6m<8c8 8HH1݁zUk:}kj=? X :U):})z:9):U):}) zUk:}k3=)9)W+= 9kܸ:9)}6I}.J+}c[xH5<8c8 8HYH1=:U):})j:U):})z:9):U):}) zUk:}k3=)9)ȑ+= 9kЁ:9)}6I}.J+}c[xH55<8c8 8HH0:U):})j:U):})z |!  HQA$;? ;{=?ɜ=H; z9kzUk:}k! U):}) 4 zUk:}k!  |} HP)'})=)9)X+:9)}6I}.J;< 8cH4M<8c8 8H<8c8 8HH/W:j! U):}))4H] !(n:U):})z)! 9)! 7@8!!He|Hd@bR> b1,A@8!D!<H@!,!D0H!4!L8PT!d!Xh\!l!`pda}sx}kx$(! A<`| A$=)9)><8cd8H$uH88a888899!9AHx,@<8cx8H!| l<C0=ɫsh(!t 2=? m LA@ = m( *؀H=? m( ( =?#)|a8 a< =? m<BȐ=? nX8?Hs $X$\!$!paptHs9!hQA=?˩sȐ Hr HsQ:8;<`| A$=)9)><8cd8HUH <|HA9|H@x8<@aDH!!LAPTX!\А`dAh!lptaxex}kx!AH9H89! ! | :=?9)d!=?9)d!=?9)d!=?9)d!=?9)bp!=?9)b! =?9)b!<`= a)!,A`8<`| A$=)9)><8c88H )H 8a 8$xH q ,A<< 8c\8c<8T8 8 H < 8c8c<8`H8< 8c\8c<8ְ8 8 H e< 8c8c<8ּ8P8PH E; 88!<;=?9)Tl!X=?9) !\=a<``8,Al8!<@DHLPTaXA\xdxx~ɳxJxH _a$<8 <8H <<,At8(<8cTl<8T<8T|<8TxH8 8<8cTD<8Tl<8(<8TH8(= 9\x9@H fœ8<8a<8<8P8PH 88 <9 P!@<8cTH8(< 8\<8T8,99!09A4HU,,A,@8!<@DH9!0!L84P!!T X9!8!\8<`dhlapAtxdxx~ƳxGx~x!AKH ,,@8a<8׌8P8PH -,A8a<88P8PH ,@; !8!݀PH8a<88P8PH,@X88<9 !@8DH<8cTD<8L|ex<8d|gx=9t|ix~*xHP8a<8ی8P8PH=,@T88<9 !@!DH<8cTD<8|ex<8|gx=9t|ix~ xH8a<88P8PH,@T88<9 !@!DaH<8cTD<8`|ex<8||gx=9t|ix}{xHp8a<8ܔ8P8PH],@X88<9 !@!DAH<8cTD<8|ex<8|gx=9t|ix}sxH H8a<88P8PH|`yT@9!@!8!<@DHLPATX\! !`!X!d80h9!4!lptxa|A<8cTlxex!AKΉTH8a<8h8P8PH1,@8aDxH q8a<8ݸ8P8PH8a0<88P8PH8a<8X8P8PH8a<8ި8P8PH!\!88H<@9 ,!D8PH9 !L<8cTD<8Tl|ex|fx<8=9T9!|jxHH!D|HA8aHxH H 88|h@xHH!`|HA; ,@Ȁ8!|N |AȐ!0B|}x|#x|+x|3x|;x}Cx}6Kx}TSxAa! $= a)|H@,A 8H\,A 8HH;| A| @ 8H$9| A| @ 8><`| A$=)9)><8c8HHĀ:|HA8|H@xH  8aH8L8P8TxH:|HAxdx~x8H8XxH xdx~x8P8\xH X@!D9):\@!D9);,@8;|H@} Kx=? 9);}#KxH<8cHDx8Hi<8cHdxHx$x~x8H8`xH !x$x~x8P8dxH `@!D9)8d@!D9)9,@89|H@} Kx=? 9)4;}#KxH <8cHxH8ah8l8p8txHU8|8a<88P8PH8a<8H8P8PH8aP<8Ԙ8P8PHm8a<88P8PHU88x<@DHL PT8hX8l\8p`8td=?9)8!h=?9)I@!l8p=?9)I$!t=?9)IP!x8||88(,048'8P<8cI$<8HxxGxxix*xH -><`| @<`HD= a)|H@0xdx~x88HxH x$x~x88LxH xdx~x88PxH ux$x~x88TxH YH@D9P@AD9JL@aD9kT@!D9)}Cx|P@}@Sx}`[x| H@} Kx}Cx|P@}@Sx}`[x| H@} Kx;|H@(<8c`x8@HCxdxxHI9|H@(<8c`x8@Hux$xxH,@8,@8;|H@} Kx9|H@} Kx,A 83|H@;,A 82|H@9;|H@<`| A$=)9)><8c8HܙH` t8 x:! 9)!  h! | 8<@8a8 |88 l89 tIxxH<1 ,A~cx<88P8PHE8a Dx8P8H1<8c$|dx~exx8PHxH8A8 h<`| A$=)9)><8c8HH84;@8DAH80=?#i:s ;)9),!LaP=?9)!TaX=9ka\=?#)9),!`>b>@bRD,A` 8<@!!DaaHL!PTX\cx$x~x~ɳx~xH HH,Al<8c<8<8<8xH88<8c<8<8<880=9d\x9@H ѓDH;8a<88P8PH88<9 P!@<8c80<8d\848899!<9A@H}a8,A,@DHHЀ8,@!؀ ,AaL+K 8<@aaDH9a<`| A$=)9)><8c8"HH8 P8T;@8dAh=?#!t)p9) !p;=?#)p9),!x=?#)p9),!|=9k@bR> b1,Al8<@aaDHL!H!PaLaTPX!T!\cxDxx~x}{x~x~ɳx~xHŒa  ,Al<8cP<8ݔ<8<8݀xHU88<8cP<8x<8<88=9kx9@H; ;8a<88P8PH88<9 P!@<8c8<8k8899!9AHc,@ H T,@8 H 8,@! ,A 8<@aaDH9!!L9aaPT!!X9aa\8 `d!H!haLalPp!T!tcxDx~x~Ƴx~x~x~ x}{xK H 8a<88P8PH|cy@aa H X8a<88P8PH,@; !! H (8a<808P8PHU,@<8c8<8lH|8a<88P8PH,@l8a<88P8PH8a <8 8P8PH8ap<8p8P8PH<8cݸ|dx8x8PHuHh8a<88P8PH,@!!8aa<@8D9 (!HL<8cx<8x|#x<8P<8|3x=?9)$|3xH ! A8cxDx~x~Ƴx~x~x=?9)k xH WyH8a<8L8P8PH,@!!8a a<@8D9 (!HL<8cx<8x|#x<8P<8燜|3x=?9)|3xH Q! @(<8cP|dx<8x8HH0!$ =ݜhA $8cxDx~x~Ƴx~x~x9! xH MI! ,AH8a<88P8PH,@!(!8?;k<@9`aD8*H9 !L<8cx<8x|#x<8P<8H|3x=?9)`|3xH 58cxDx~x~Ƴx~x~x=?9)k xH L}! ,A 28cxDx~x~Ƴx~x~x9!AH L9H8a<88P8PH,@! ,Aa+|HAa+|HA8<@DH!!LaaPTXH\!L!`aPadTha쀁exFx~x~ȳx~x~xHH8a<88P8PH,@p! ,Aa+|HAȀa+|HAA8<@cxDx~x~Ƴx~x~x!jxH 0H48a<8,8P8PHi,@|! ,AXa+|HA<a+|HA(8<`| @xHvHX=?")s8 =?")s ,A4=?0)=0k| XA=?0), @,=?0)=0k| XA=?0), A=?9)tx;p}#KxH<8c<088Hd=H|!<8cx8Huxx8PHu 88<;@A@AD<8c<8<088899!9AH=?0) } I!`;;`a8a<`| A$=)9)><8cz8!Hw-H+|5|HAp;x<8{8P8PHx8a <8{T8P8PHx8ap<8{8P8PHx<8c|dxxx8PH]H+<8c{x8Hj <8c{x8?Hi<8c|8x8EHi<8c|x8%Hi<8c{x8Hi8<@Cxxl<8ƿ@}sxd}sxJxH 8 T8!d T:8a88xHS ><`| @)8d=9@=?9){!=_9J|Ađ!=9|=?9)!=_Êh=9k{a=9|̑=?9)@!=_9J|A=9kha=9}=?9)}!=_j=9kj0a=9jH=?9)j`!=_9JjxA=9kja=9j=?9)j! =_9JjؑA=9kja=9k=?I=?)=_9Jk A=9kk8a =9kP$=?9)kh!(=_ =4=8=?©=_9J{A,=9k}La0=9@4=?9)}p!8=_9JhA<=9k}a@=9}D=?9)k!H=_9JkAL=9kkaP=9{T=?9)}!X=_9J@A\=9k~a`=9hd=?9)~@!h=_9J~\Al=9kkȑap=9kt=?9)k!x=@aJA|=`akad,A܀8|9T:|9ց8a<@!p!DAtAHaaLxPTX!!\9@A`aad<8c@Dx|exl||B~ȳx9!<~xH%8a@8D8H8LxHe8a@8D8H8LxH <8c@xH <8c@<8<8xH 8P7A;P!PU):}<`| A$=)9)><8cM8 H?MHT:8a8xHy!4)9)|IT:}IU:}9I֒8<8@<D@HDLHPATXT\X`\d`hdlhpltpxt||~x~xex~fx|}})A(H%8axH)8!|N |!`Ba|+x|3x|;x}Cx}1KxAԃa؃A܃!a $,A4A$= a)|H@3|H@} Kx,A 8H<,@,:|HA | A3|H@ 8<<`| A$=)9)<<8cK8#H=H ,8a888xHm<8c888xH<8c<8<|ex|fxxH3i8a8xH Yu5|H@} Kx;y| X@}i[x}(Kx| QA8xU :}I2}i}): h( 94@`(=?czp8a888pxH y8a88889xH Z8a8888=9<xH lm8a888xH08a888xH0<8c<<8|ex|#xxH1zUk:}k;U):}) `(=? l2,A@,A4 h(p:U):}) *t8ap88tHh,A,;U):}) h(p8ap88H4,A4:U):}) *p8a88p8xH2a! ,AT:x8ax8xH<<`| @ p=?9)!8<@~óx}$Kxxfx}'KxHxJxH 88<~óx<8ex|#xGx|#x=?9)\AH ),A<8cK(x8%H-)H 8a8xH B<8c<8xH G9|H@} Kx|5|H@} Kx9AA8<@=?9)KP!DH=?9)KT!LP8TX8 \~óx<8|#x8|8~x xH nAHx9|H@} Kx5|H@} Kx88<@8 D~x88~xx=9KP}{x=_9JK`HA8axH V<8c888xH V <8c888xH g |@|x9|H@} Kx|xQA=?p}> ,AW:}+  ,A}+ H0W:}) (!.!0a04H !<8c|dx|ex8 8|hxxH V;7@l<8c888xH f8a88889xH g8a888xH-M8a888xH.`(=?tczt8a8t88xH98a8xH S<8c<8xH d! ,A9AA8<@D=?9)KP!H!!LP(T8X!0!\~óx<8|#xfxGx~x~xH km8a8xH D%8axHHH8(<8@!0!D~óxdxEx~x~x=?9)KPAH<8c888xH SU<8c888xH dU:|xHQA=?p}> ,AW:}+  ,A}+ H0W:}) (!.!0a04HA !<8c|dx|ex8 8|hxxH TQ;7@l<8c888xH c8a888xH8a888xH hU<8cxH g<8c|<8`<8xxH MU!87AD;8~óx<8ex|#xGx|#x=?9)< xH E9|H@} Kx5|H@} Kx8<`| A=)9)><8c1l8H"H8<`!HL8H`<`!$ H<`!H<`!$(H<`8$H8 t,Ah<8ck<8k<<8l<8kXxH88<8cj|dx<81<8kT8t=98x9@H~-8 t;; ;P=98=?9)7ȑ!=91=?9)k,!=9k=?9)k`!<`?c=9k=?9)1!=9kL=?9)k!=9k`=?ék=q=?9)1!=9kL=?9)k!=9k`=?9)<`| A$=)9)><8c!8HH8aP8T8X8\xHE=?" 8!<@DAH!LPTX\`datxex  =JxHf=?)", Ad<8c!</8p8`x8H <8c"</8d8`x8H <8c"</8h8`x8H i<8c"$</8l8`x8H I!8<@AD!HLPaT!`!Xada\=?/9)p!`=?/9)d!d=?/9)h!h=?/9)l!lptx|xdx Ix xH ><`| @<`HX= a)|H@D=?8 "Hx9} HP9), @h7} HP9), @P=?/9)l!8<<8cP~x~ex`d=/9p=?/9)d=_/9JhH88d<8cPx<8P<8P|+xxH88<8cPx<8P<8"4<8R08d=9#x9@ Hb-8h8;=?") 9),!=?") 9) !=?9)Px!=/9kla=?") 9) !=?/9)p!=/9kda=?/9)h!=/9kla=?") 9) !=?9)"D!=9kPܑa=?9)P!=9kPxa<`= a)!=/9kdaa=/9kpa=?Q8=?/9)l!=?") 9) !=9k"pa=?9)Q !=9kPa =?9)Px!=/9khaa=P=?/9)l!=?") 9) ! =9k"a$=?9)P̑!(=9kPa,=?9)Px!0=/9kla4=?") 9) !<=?9)"!@=9kQ aD=?9)P!H=9kPxaL=?/9)p!P!T=?/9)l!X=?") 9),!\=?") 9),!d=9kPah=?") 9) !l=?/9)l!p=9k"ܑat=?") 9) !x=?/9)l!|x|8a<8"8P8PH8a<8"8P8PH88<9 P!@<8cR08d<8#8h8l99!p9AtHl,Al,@ 8Hl,@a+K 8<`| A$=)9)><8c<8HEH3888a88~x~gx99!9AH?,@$h$h$;x<8\8<8<`| @<`H Ȁ= a)|H@ ,A$<8c3T|dx<8$Px8*H9`4A<9AUi:})R 2  r 9k4@؀,@D888<@<8c5888~dzx~x9!9AH2H@8<8c5888~dzx~x9!9AH.8=?9) ; }#KxHօ=?3<8c3T88H<8c3T88HHxx8PH=?9)8}#KxHh$<8c3T88Hh$<8c3T88HmHQxx8PHQ=?9)P}#KxHե<8c3T88H%<8c3T88HHxx8PH,A8=?9)h}#KxH1h$<8c3T8H=?9); }#KxHh$<8c3T88Huh$<8c3T88HQH5xx8PH5=?9)}#KxHԉ=? 4L2=? 44$ѡ<8c3T88HHxx8PHـ,A ,@=?9); }#KxH=?3r<8c3T88HHqxx8PHq=?9)ȓ}#KxHh$<8c3T88HAH%xx8PH%a X([.=?5r<`QX*= 32=?")}.8a<8 88H=,A$8a<8488H,@=?3r8x~x~ųx~x899!=_9J3Hhh(h(8x~x~ųx~x899!=_9J3HhA **ѡ8x~x~ųx~x899!=_9J3Hg<8c3T|dx<8$|x8%HxHр 8<@DH=?9)3!L=?9)3T!P=?")<`Q})!T8X=?9) ̑!\=?9)3|!`=?9)5ԑ!d=?"h8<l8Tp8`|t8`|x|<8c ~Dx~%x~x}sx}{x}kxAHh=?) , AD=?9); }#KxH <8c3Tx8HHyxx8PHy8x~x<85<83<83T="9(<9HTHs1=?) , A<8c$x86H;쓁8;<@<8c5<"8<8T~dzx~x9!9AH,=?) , A48<x~x<"~Ƴx~x99!xHN=?/ P*3!$!`a`dH&e a* h(cn X!`a`dH& $=?) , AT=?9); }#KxHυ=? 32<8c3T88HHxx8PH$=? 5 A=? 4( @<8c$x8FHé<8c%$x8FHÕ<8c%lx8@HÁ<8c%x8FHm<8c%x8DHY<8c&8x8HE<8c3T|dx<8&Px8r=!|8x~x~ųx~x|:a}Z9!=_9J3Hbyh(h(8x~x~ųx~x899!=_9J3Hb1h*h*8x~x~ųx~x899!=_9J3Ha;Z7{@=?) , @ 8<@DH=?9)3!L;P=?")<`Q})!T8X=?9) ̑!\=?9)3|!`=?9)5ԑ!d?"h;}<`| A$=)9)><8cD8#HH 8a888xHA8a888xH<8ch88x8Hy,A=? <8cx<8T8x8 HM<8c8<8T8x99 H<8c<8X8x8H<8c<8`8x8 H<8c<8\8x8 H<8c8<8T8x99 H88<8cT<8T<8X<8`<8\=9Tx9@H>=`ak| XA<`| @ H~H @<8cx<8T8x8 HY<8cT8H!a<8c8<8T8x99 H1<8c<8X8x8H<8c<8`8x8 Hֹ<8c<8\8x8 H׽<8cT8HЅa<8c8<8T8x99 HǕ=?)T, A8a<88F8FH8a&<88F8FH8al<8T8F8H8a<88F8FH8a<88F8FH8a><88F8FH<8c||dx8x8FHxHM<8c\xH8a<8L8F8FH98a&<88F8FH!8=?9)T!8<`| A$<8c|dx<8x8 HL<8c|dx<8(x8%H~xH1888<8@8D8H8LԐPܐTX8\8`ؐdhlp8t<8c8 8<8T899!9A Hр,@<8c|dx<8PHP,@$<8c|dx<8hx8H,,@(<8c|dx<8|x8H H@8a<88P8PH8a<88P8PH<8c<|dx8x8PH}ixH888<Ԑ@ܐDH8L8PؐTX\a`Ad="k| ,h l pȐt!̑!xА|!ԑ!=?9)l!8Ȑ   aa<8c<8888 99!9AHM7|H@} Kx6|H@} Kx8}sx~exHq}kx~ExH]x~%xHIx~x H58!!<ؐ@ܐDaȑaH̐L!Б!PaԑaT!X\`!!dhlptx|aa!!a aaA!cxDxĀ!AK<8c|dx<84x8HzxH8axHa8axHU8axHI8axH=8axH18axH%8!|N |!B|~x|#xH|@x,AP8a@xH U<8chxH <8cd|dx<8Ԑx82H8a@xH ̥H <8cd<8Ԑx82Hh8!`|N |!B|#x|+x|3x|;x}Cx};Kx}ZSx= a)|HA<8c8!HH8<8c8@x8 H<8cx8@x8H}<8cx8@x8 Ha<8c dx8@x8 HE<8cDx8@x8H)<8c,$x8@x8 H <8c<x8@x8 Hx8!p|N |!B99Đa8<@DHL!PATȃ= a)|H@T!8 ,A 8HA< ,A 8><`| A$=)9)><8c8HYH<8c0<88x8 H<8c<<88x8 H̀8!!=`ak| XA<`| @~t8!x!<`| A$=)9)><8c8H H! ,@@<8cx8HY<8c x8IHE<8cx8H1!  !  ! r ! r ! ,A8~cx~Dx !AH->=`ak| XA<`| @~Hp8 ;ACx<8X8F8FH8aV<8ߠ8F8FH8a<888Hy8a<888Ha8a<888HI8a<8$88H18a<8888H8a<8L88H; @9 ! D8 H! L! P! T;acx<8`8<8с><`| @ H<= a)|H@(<8c|dx<8x8#H_xH! ,@;x<88P8PH;x<8T8P8PH;a0cx<88P8PH;ACx<88P8PH;!#x<8D8P8PH8a <88P8PHu?;ȓ8=?9) !<@8D:PH:L<8c<8@|ex|fx<8=9x|jxHx<88P8PHx<8H8P8PHcx<88P8PHCx<88P8PH#x<888P8PH8=?9)!<@8DHL<8c<8@|ex|fx<8=9|x|jxH)x<88P8PH%x<88P8PH cx<8<8P8PHCx<88P8PHݓ8=?9)!<@8DHL<8c<8@|ex|fx<8=9\x|jxHq=?) , @l=?), @\=?), @L<8cx8,H! ,A <8c|dx<8 x8H H =?) , A 8a|!  Hߕ  | H    =?), A,<8cx8H}=<8ctx8;H})=?9)!8=?9)!|!  H%  | H    =?), A,<8cx8Hz<8cx8FHz=?9)!8=?9)!<`| A$=)9)><8c@8!HzH 08|HA@;0x<8d8P8PH|!<8c<|dxxx8PHH 8 ;acx<8Ӵ8F8FH{8a<88F8FH{8a <8D8F8FH{8a<8Ԍ88H{8a<8Ԡ88H{}8a<8Դ88H{e8a<888H{M8a<888H{5;pt8x|;ACx<88<8@89)})}=JU):})8 @|x=?ˆ,A@=?ˆ,@ $|@|p|2p A2|q@W:}) =?)ˆ,A@=?)ˆ,@$|@|p|2p A!2|q@-r! a  H <H 89)})}=JU):})I;7A0K=?)$, @5|xHQA=?Ę?`89)})}=JU):ɺ>@ ! a  Hm >H 89)})}=JU):})i;7AK5|xHQA|=?Ę?;{$?@89)})}=JU):})8 @|x| xW:}) =?ˆ,A@=?ˆ,@ $|@|p|2p A2|q@+-r! a  Hi <H 89)})}=JU):})I;7AK(=?) , A=?)$, @5|x}`HQAX89)|=9 }=2U):})9I =?ˆ,A@=?ˆ,@ $|@|p|2p A2|q@Ѫ;5kAK5|x}`HQA89)|<8 =9$}=2U):})9I=?ˆ,A@=?ˆ,@h$|@|p|rp Ar|q@W:})=? ˆ,A@=? ˆ,@h$|@|p|rp Ar|q@ 2 ;5kAK,=?)$, A5|x}`HQA89)|<8$}=2U):})9I}HSxW:}) =?ˆ,A@=?ˆ,@ $|@|p|2p A2|q@ 2 ;5k@|=?)0, AX=?)(, AԀ5|xHQA=?D?;{(?@ W:})8 @t|x=?)ˆ,A@=?)ˆ,@$|@|p|2p A!2|q@! a  H <HW:})I;7AK\5|xHQA=?D?` W:@$ ! a  Hm <`| A$=)9)><8cʐ8#HmaH<8cʴ<8@8 x8 Hm<8c<8L8 x8 Ho<8c<8H8 x8Hn<8c<8D8 x8Hn 8! !< @ DA AHa aLPTXa\`d8 h8 0lpAt (x ,| 0<8cH|dx}sx}kx'x~x! A H,<`|@ 8x~x Ȁ }sx}kx! ؁A H|@ d8 8a<88F8FHm8a&<8<8F8FHmq8a<8˄88HmY8a<8˘88HmA8a<8ˬ88Hm)8a<888Hm8  8  8 ;x<88<8<`| @=?)H, A!  !( 8 4h(2!zH ! 8#x~x<8H|+xx|+x9! A H q! ,A< 2 d8#x~x<8H|+xx|+x9! dA H )9`! i ! ! i! i! i !  ! i=?)@, @h:~óxDxH|i|sxa h l=?:I~ѳx! pA ta 8 p8 h<8Ƶ 4Ha <8 88 H=?)@, @t:~óxDxH{|ox x |=?9)! Ē ! A đ! A a 8 8 x<8Ƶ 4Hea <8 88H=?)@, @8 ~óxDxH{qa ȁ! ȁA ̑! A =?9),! Ԓ ЁA Ёa ԑA a a 8 8 <8Ƶ 4Hـa <8@ 88H=?)@, @8 ~óxDxHza ؁! ؁A ܑ! A =?9)X! A a A a a 8 8 <8Ƶ 4HMa <8p 88H`I h8! `|N |!B|~x|#xHQ|@x,AP8a@xH ~<8cxH 1<8c |dx<8|x80HA8a@xH H <8c <8|x80HFh8!`|N |H!0|}x|#x|+x|3x|;x}Cx!aA! $(,= a)|H@L,A 8H,A 8><`| A$=)9)><8c8"H]H#x~ijx<8xHe<8c|dx%x~ƳxxH =848a<8,8<8<`| @4<`<8c<8%x~ƳxxH Hp= a)|H@\<8c<8%x~ƳxxH <8c<8<80xHtA#x~ijx888<xH-xHL8@h(`C0=?)=? o@,a((((h(0|xHQA>C0=?ɫ=?i=?éd8`o,((((@h(@@=? H( !@a@DA@@DH(W: H  !2=;7@`;Z7@8!кH<|!B= a)|H@8,A 8(<`| A$=)9)(<8c8HXH`9`4AP=@C0=?iUi:}):8 lDA@@X(k: 9k4@Āh8!`|N |!0B|+x|3x|;x}Cx}1Kx}^Sxc = a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c,8HWMHd?;L8>:ܒ<@;@AD:-H;`aL<8c0~x~Ex|fx<8l|hx=?9)|jxHœ8>:蒡<@ADHaL<8c0}{x}sx|fx<8罴|hx=?9)|jxHu8>:<@AD;.HaL<8c0~x~Ex|fx<8|hx=?9)|jxH!8?;<@ADHaL<8c0}{x}sx|fx<8D|hx=?9)\|jxHѓ8??;9!<@ADHaL<8c0~x~Ex|fx<8羌|hx=?9)|jxH8?;<@ADHaL<8c0}{x}sx|fx<8|hx=?9)|jxH1=?9)!8?;<@8DHL<8cX<8X<8|<8Ɵ0<80|3x=?9)D|3xH˹59)})ր})U):}) h* 89)})ր})U):}) h* <9)})ր})U):}) h* =? X Al;A`A8;ada<;h@;lDH<8c<8<8<8<8=99!p9AtH =_!JC9J@A8<8ap8tExfxxx=?9)9JH <8cH~<8c08t8H6<8c0x8H5H|al!t8xXQA=?!iC;{C;?<8c H~Y<8c08x8H5xT:<8c0|8H5xT:<8c0|8H5uH| !x9)!x7@= a)|H@al!t8x}iXQA=?!C8@C܁Ax!t}*J8|A|AUI:})2I| @| x!xU):})* 0|H@} Kx|x}@PQA<8|<8}(U):}) h* 95J@܁!x9)!x5k@H8!|N |!B|xx|+x|3x|;x}Cx}=Kx = a)|H@8,A 8=<`| A$=)9)=<8c8HQMH8a@8D8H8LxH9<8c4<8<88xH<8cxH E;7APW:}  P}  TP@ LA@H L@@TD LA@L L@@}  ,@ <8c8P8TxH HW:}) ,@<8c4HDW:}) , @(,At<8c8<8|exH<8c8<8<8dxH<8c8P8TxH E<8c4<8<88xHI;7@8!|N |He!a|#x|+x!A= a)|H@T! ,A 8H! ,A 8><`| A$=)9)><8c8#HNH<8a888xH*8 88<<8cx<8 <8Ʒ(8x!9@H?;,A<8c4<88x8HN<8cL<88x8HN<8c`<88x8HNy<8cx<88x8HNY<8c<88x8HP<8c<88x8HPm<8c<88x8HPM<8c<88x8HP-<8c<88x8HP <8c<88x8HO<8c8x8HN<8c(<88x8HN8,A 8;ACx<8<8F8FHNu8a<88F8FHN]8a<88F8FHNE8a<88F8FHN-;!#x<8\88HN8a<8p88HM8a<888HM8a<888HM8a<888HM8a<888HM8a(<888HM8a<<888HMi8aP<888HMQ8ad<888HM98ax<8$88HM!8a<8888HM 8a<8L88HL8a<8`88HL;P8TX\`dhlp9 !tx|!8;a`cx<8t8<8?:1>:>_:R>:>:s>:־! >:>: ?; <.8cd 8c 888HH%!88P@=?@?@>@ =?D=?əH>?Wk:}+ ,@}+B X@}+: h$9Jh* `@ 2x!|;H` P@ `(H$x!|;HBH=?ɘ?;{l;A:;,A08l!(**Hh, A08l!(z*H4,A48l!(*H ؒܓ[<8clH7I<8c88H<8c88HW:|"<8c88HH2Cxx8@Ap=A >@>@=?É> @@>@ =@=?éD=?@=?əH>`?=?i?_;Zׄ;!::;0,A,AL,A$,AAؑHؒAH,AAؑHđؒH,AؒH,AӁHӁؒ!H, AL, A$,A!ؒH`ؑHT, AӡH@ӡH4, AH , AؒaH aaܓ:<8cׄH5<8c88H<8c88HW:|<8c88Hq<8c88HYH0=#xx8<`| A$=)9)><8c8H3H 8a88889xH,A<<8ch8c(<88 8 H5I<8c8c@<8H8<8ch8c(<8X8 8 H5<8c8c@<8d8P8PH4,A<<8ch8c2<88 8 H4<8c8c<8H8<8ch8c2<88 8 H4<8c8c<88P8PH4m8axH U8a88xH,A<<8ch8c<<8l8 8 H4!<8c8c<8xH8<8ch8c<<88 8 H3<8c8c<88P8PH38a<8dxH|=?)d, A<<8ch8cF<8$8 8 H3<8c8c0<80H8<8ch8cF<88 8 H3M<8c8c0<88P8PH3-,A<<8ch8cP<88 8 H3<8c8c<8H8<8ch8cP<888 8 H2<8c8c<8D8P8PH28a8xH Se8a8xH&8a8 xH8 ;;;`: :P=?9)!$=?9)d!(=?9)d!0?@cZ,Ala8<@ؐD!ܑ!HLP!!TX!!\#xx~Ex~&x~x~x}{x~xH;`,Ad<8c{<8|H<8|<8| xH Œ8<8c{|dx<8<8|8=9hx9@H ;;`8ap<88P8PH198<@<8c|8<8h<8|489p9!9AH,A,AH8ap<88P8PH0,A(8ap<8 8P8PH/,@;;;`H8ap<8\8P8PH/,A$8ap<88P8PH/,@(<8c|8<8x8PHiHD8ap<88P8PH/Q,@`!$!88 <@9 !D8H9 !L<8c{<8|L<8}|fx<8L|hx=?9)d|jxHف!} HP9)!!$!88 <@9 !D8H9 !L<8c{|dx8|fx<8筄|hx=?9)|jxHi! ,A@8a8 xH! } J9)| @| x!8a8xH P݀! |H@} Kx8a8xH%xHH8ap<88P8PH-,@d88a88889xHx<8ch8c(<88 8 H.M<8c8c@<8HX8ap<88P8PH-U|cy@`a8a88889xHx<8ch8c(<8X8 8 H-<8c8c@<8dH8ap<8T8P8PH,,@d88a88889xHw<8ch8c2<88 8 H-Q<8c8c<8H\8ap<88P8PH,Y|cy@`a8a88889xHw!<8ch8c2<88 8 H,<8c8c<8H8ap<88P8PH+,@T<8c{|dx|exxHu<8ch8c<<8l8 8 H,e<8c8c<8xHp8ap<8D8P8PH+m,@`<8c||dx|exxHua<8ch8c<<88 8 H+<8c8c<88P8PH+H8ap<88P8PH*,@T<8ch8cF<8$8 8 H+<8c8c0<88P8PH+q8!( H`8ap<848P8PH*|`y,@h<8ch8cF<88 8 H+<8c8c0<88P8PH*,!0 8a<8dxHtH8ap<88P8PH),@L<8ch8cP<88 8 H*<8c8c<88P8PH*y8Hl8ap<88P8PH)|`y4@`<8ch8cP<888 8 H*-<8c8c<8D8P8PH* 48a<8dxHsxH9|A;,@8!|N |!B|~x|#xHS|@x,AP8a@xH HE<8coXxH H<8cq|dx<8ɶx84H y8a@xH HH <8cq<8ɶx84Hh8!`|N |!B|~x|#xHS)|@x,AP8a@xH G<8cnxH H <8cq |dx<8"x8;H 8a@xH GH <8cq <8"x8;Hh8!`|N |HVqaĔ!||x|#x|+x|3x= a)|HA<8c8 H&QH <8cm|dx<8m|+xxH Jq<8cm|dx<8m|+xxH M}8axH8,A ,@(=? o<?<>Hl,A ,@$<?=? o=? pdH(!9)( A(<?=? ph=? m<8cm|dx88xH<8cm|dx88xHT!`(Aj@(=? n@$$h(n*с=? plk@:a)(!J(A=? pp=? oX:с*!(ѡԀ,A ,@*`HX,A ,@=? o2=? ptH(!9)( A=? o2=? pP~2,A ,@$(*(=? pHh,A ,@((*(=? oP2H4!9)( A$(*(=? o$*((<8cm<8mxH18a888<8m=9mxH3I<8cm<8mxH18a888<8m=9mxH3 <8cm<8m<8nxH;*`*d(h(l8a`8d8h8l<8m=9mxH2*`*p(t(x8a`8p8t8x<8m=9mxH29=?or *` *|h(h(8a`8|88<8m=9mxH18a8xH =?nTk:<8cm<8nxH/<8c88x8Hm<8cm<8mxH/<8c88x8Hm<8cm<8nxH/<8c 88x8Hm]<8cm<8mxH/]<8c88x8Hm)<8cm<8nxH/)<8c88x8Hl<8cm<8n4xH.h*=?m`88a88|#x8`9=?9)m=_9JmH<8cm<8m<8n xH9 `*`(ѡa (ѡX*с*88a`88889=?9)m=_9JmHi=?!)T=? px L@@=? p|H8=?!)T=? nT L@@=? pH =? p2`=?9)mȑ!8=?9)m!<@<8cm|dx8`}&Kx<8m=9m=?9)m} CxH/h*=?m`8a`8<8x8*H MA(h*`8a`8<8Dx8"H M(h*`8a`8<8hx8H L(,A4h*`8a`8<8x8H8h*=?mr`8a`8<8x8H LI((h*=?mr`8a`8xxgxH L,A<8cm|dx<8n4<8nxH`*`(=?oPcz ((=? p$h(888<@8D8H<8cm<8m<8<8m|3x=9799!9AH9@8=?!P8P8P88 P9UI:}i* }i2 }i: })B 9J4@`*aX*`(=?ph$`*X(=?oP[z888<@8D8H<8cm<8m<8<8m|3x=979!9AH=?!)P8 <?  8 H xH 8!@aHK`|!@B|}x|#x|+x= a)|HA<8cH8#HHH8a`<8l8P8PH8a<88P8PHi8a<8 8P8PHQ8aP<8\8P8PH9=? c(2ѡ,Ap=?9)!88<@8%D8PH8L<8cb,<8bT<8d`|fx<8=9bp9!`|jxHHl=?9)!88<@8%D8PH8L<8cb,<8bT<8d`|fx<8=9bp9!`|jxHE=? bT At=? d4 2=?9);`8 }#KxH)=? c4h$<8cb,88HHxx8PH Hp=? c4h$=?d4r,Al=?9)!88<@9 !D82H!L<8cb,<8c,<8b|fx<8|hx=?9) |jxHIHh=?9)!88<@9 !D82H!L<8cb,<8c,<8b|fx<8|hx=?9) |jxHD=? c4h$=?9);`8 }#KxH<8cb,x8HEH)xx8PH )=? d42Ѽ8!|N |HGUl!|+x|3x|;x}Cx}-Kx}QSxht#7x!x!|= a)|HA<8c8!H%H:`=? e;`7At=?`8>C0=˫e8|T:|.@ ;@H,9;})U):}) @ ;@H;@9;})ր})U):}) @ |xH49;})ցU})RU):}) @ ;H;,A,A|@9[}j}:ZU):})}J}:RU):})i}|ZUk:}kK}\RUJ:}J"h( X(2!zHl |Pl(!$*:s;{7@=`C0=?ien`aX(`$ $=?ɩer,@< <8l a!!X( $HkY2$H =?9)Θ;}#KxH=? _2ѡ<8c^88HE=? e2<8c^88H!Hx~x8PH:=?Ie Аu;7{Ax=?`8=C0=˫eW:9)|L.@ ;@H(}=U):}) @ ;@H;@R9*})}=JU):}) @ }\SxH4R9*})}=JU):}) @ ;H;,A,A|@9z}+}=JU):})}k}}ZUk:}kk9|}+}=JU):})I}k}}ZUk:}k"h( X(2!zHiu |Pl(!$Z*>Ϻ:;7{@=`C0=?ienaX(`$ $=?ɩer,@< <8la!!X( $Hh2$H =?9)ΰ;}#KxH9=? _2ѡ <8c^8 8H=? e2<8c^88HH qx~x8PHq*}s=@C0=?iem`AX(`$ $=?ɩer, @@*h<8 l,A(!(!X(-$Hg2$H=?9);}#KxH5=? _20<8c^808H=? e2(<8c^8(8HH qx~x8PHq8=?Ie;`5A;5eAx8}@=?I`8||RT:}  P@@|.P@4|:T:} i}.h(rh* X(2M*8;5k@;{5@xl<C0!=_ e!("$Hfa $=?ɩer=?9);}#KxH=? _2ѡ4<8c^848HIH -x~x8PH-8=?Ie;`4Au;5kA8}@=?I`8}||}=RU):}) P@X}=BU):}) P@@}=U):})i}=*U):})h(rh* X(2M*8;5k@;{4@Tl<C0!=_ e!("$Hd $=?ɩer=?9);}#KxH m=? _2ѡ8<8c^888HHx~x8PH=? e:`;`7Ah=?`88|T:|.@ ;@H,9;})U):}) @ ;@H;@9;})ր})U):}) @ |xH49;})ցU})RU):}) @ ;H;,A,A|@9[}j}:ZU):})}J}:RU):})i}|ZUk:}kK}\RUJ:}J:s,X(!2Bh(B2!aAHc `*;{7@= C0=_ɪen`!h(x$,@4; |8lD!@@h(!$HbHؐ=?9);}#KxH 5=?e=?e$@<8c^8@8H$<8c^88HHix~x8PH i:=?Ie Аu;7{Al=?`8W:9)|L.@ ;@H(}=U):}) @ ;@H;@R9*})}=JU):}) @ }\SxH4R9*})}=JU):}) @ ;H;,A,A|@9z}+}=JU):})}k}}ZUk:}kk9|}+}=JU):})I}k}}ZUk:}k:-(!2LX(B2!aAHa- Z*=z;7{@= C0=_ɪenL!HHh($,@4=r |8lT!PPh(!$H`QH=?9)(;}#KxH=?e=?e$P<8c^8P8HA$H<8c^8H8H!Hx~x8PH ( =? e@T=? eL@@@<8c~x8DH <8c~x8DH <8cT~x8"H *h}3=`C0=_jem \aXXX(h`$h, @8*2h<8 lda`!`!X(-$H^Hˁh=?ehh=?e$h<8cx~x81H =?9)@;}#KxH=<8c^8h8H$`<8c^8`8HHx~x8PH x<88P8PH 8a`<88P8PH =?_;a`a8!<@;@AD;PHL<8c^<8`8_|fx<8L|hxx|jxH3=?`x<8h8P8PH a8<@ADHL<8c^<8`<8_|fx<8瘸|hxx|jxH3x<88P8PHa88h<@8DHL<8c^<8f<8f|fx<8$|hxx|jxHd:`;:`9p;@;P9t?`c{=?`8x<8D8P8PH59)})p})!p8<@ADHL<8c^|dx~x|fx<8癔|hxx|jxH Qx<88P8PH29)})p})!t8<@ADHL<8c^|dx~Ex|fx<8|hxx|jxH |AD!t9)})րp})U):}) L@@0<8c~x8CH <8cX~x8%H H:`,Aat9k}+րp})U):})É}k}kUk:}këh=? e2=? e$ HZ HZ) ;`4AhU;5JAL8|=?`8?C0=?)e=? _ax|Yց!|}I|8`|"T:}` 8@Āp|Pl\XɡXH(ht|Pl\XH(a2~[xMk2k`$k*2z2$*}=:U):l}) k(i}}BUk:!p}kJ}=2U):}) (ѫH,}=:U):al})Zi}=BU):p})i;5J@;{4@8!0lH3@|!BaH|#x|+xTX\!`Ad!aAaA!Ā= a)|HA<8c8$H,A 8Hl,A 8HX,@:|HA| @ 8H,,@6|HA| @ 8><`| A$=)9)><8c,8#HH=?9)P!88Ȑ<@8D84H8 L<8cJ<8JD|ex|fx<8p|hx=?9)|jxH #xDxx}sx8xH Đ| x9)!#xDxxT8xH yĐ~x~ijxex}kx8xH IĐ| x9)!~x~ijxexX8xH ĐЁ8| A4!|HA$!|HA!|H@<8cx8AH <8cx88H <8c8x8 b1?`c{;A>:=?9)|!X=9ka\=?9)!`=9kad=?F=9kah=?K=9kal;$;(=?9)!p=9kEat=?9)!x=9ka|=?9)!a(a8,H 8a<8@xH9A$A8AU):}) (!.!aH> !hL@@,@`ѡ܁!9)!8U):}) (h(Hh@,@dѡ܁!9)!8AU):}) h(h*H`!9)!8aU):})r ;7@4;79@8adxH X8!P|N |!BaH|#x|+x|3xXAdpat!x|aA= a)|HA<8c{8H ,@,AD<8cPH5<8c.x8Hɉ<8c.Dx8HuH 8H,@X,A 8H`! ,@3|HA| @ 8H0,@/|HA| @ 8><`| A$=)9)><8c{8H 9H`=?9)d;p}#KxH=?/<8c.88HqHUxx8PH U=?9)|}#KxH<8c.88H)H xx8PH <8c{x8H <8c{~x8x8H !H,@@8ap<8{8P8PH8a<8|$8P8PH8a<8|t8P8PH8a`<8|8P8PH8a<8}8P8PH8a<8}d8P8PH}8aP<8}8P8PHe=?9)~!8<@8D8PH8%L<8c.<8.<80|fx<8~,=9/ 9!p|jxHU><`| Ad<8c{~x8x8H 88xdx~ųx~x~x}sx=?9).~JxH 8a8xHA8!!H M88!0|N |!pB|+x|3x|;x}Cx}<`| A$=)9)><8cw8!H ߉H =?9);}#KxHI=?(<8c'88HH٥xx8PH ҥ=?9)ȓ}#KxH<8c'88HyH]xx8PH ]<8cwx8H I~x~dx~ExFx8xH ؀ܐ | x9)! ~x~dx~Ex~x8xH ؀ܐ(~x~ijx~%xx8xH ؀ܐ$| x9)!$~x~ijx~%x}{x8xH q؀ܐ. | A4!$|HA$!(|HA!|H@<8cxx8AH <8cxDx88H <8cx|x8<`| A<8cx}kx8x8H 18a<8{88P8PH8a<8{8P8PH8a@<8{8P8PHܱ8a<8|(8P8PHܙ8a<8|x8P8PH܁8a0<8|8P8PHi8a<8}8P8PHQ8a<8}h8P8PH98a <8}8P8PH!8ap<8~8P8PH 8a<8~X8P8PH8a<8~8P8PH8a`<8~8P8PH8a<8H8P8PH۩8a<88P8PHۑ8aP<88P8PHy8a<888P8PHa8a<88P8PHI8a@<88P8PH18a<8(8P8PH8a0<8x8P8PH8a<88P8PH,@;?;;?;@P;`#6} HP9)})Б!6} HP9)!䓡8!<@DAHaL<8c'88|fx<8<=9(H9!|jxH 99)( A<8c|x8@H H;,@\.| P| x9)!|p} x}(HP|IT:8a8xH e|p} x}(HP|IT:8a8 xH 5T:8a8xH |p}x|PT:8a8xH ><`| @ 8 (! , a 0  48~x~x (}&Kx}g[x=?9)'A $H u},@88Ȑ<̑@!Б!DaԑaHؐLܑP!!TaaX\`dhAl!p! !t8x| p}`x| P8|  $}sx~x~ex~Ƴx}kx9 9!$9A(HߵH88Ȑ<̑@!Б!DaԑaHؐLܑP!!TaaX\`dhAl!p! !t8x| p}`x| P8|  $}sx~x~ex~Ƴx}kx9 9!$9A(H!8axH Q8a xH E8axH 98axH -9@4A(UI: }iB}) 9J4@! 0s|X@Ui:}) (|8P9K4A\=C0=k.UK: }kT :})|PPlX( h: 9J4@9@4A(UI: }iB}) 9J4@! 4 v|X@Ui:}) (} @P9K5A\H 8!|N |HT!@|+x|3x|;x}Cx}>Kx}QSx!~x= a)|HA<8cu8H H 8a`<8v8P8PHԑ;ACx<8vX8P8PHu8a<8v8P8PH]8aP<8v8P8PHE8a<8wH8P8PH-8a<8w8P8PH8a@<8w8P8PH8a<8x88P8PH=?9)x!8?;| Plaˡ(・=?)=?Ɍy=$ P!aH!u {r`P=?IZ(=?Z=$ P!aH!9 z|9$Pa H! yz$Pa H zz($>HP;7A?C0=? !X?;ތ?;{=_j?_;ZȀ|Pla{(`{|Plˁ(^<$ P!aH - rP3(9<$ P!aH |Z$Pa H z$Pa H z($$ӡ2| x}@HQA48|}+U):})r 9k5J@܀,AL2| x}@HQA88|}+U):})2r 9k5J@;7@`=?9);`}#KxH<8cd88H}Hax$x8PH a8!TH|!B|+x|3x|;x} Cx}/Kx}NSxaXCQxXxRx= a)|HA<8cw 8!H qH,@,A 8H@%, @| @ 8H &, @| @ 8= a)|HA(<8cw 8!H ;=)9);HT8::$>:sx>:T=?H?;w08Kx = a)|HA<8cs8)HX,A 8H,A 8><`| A$=)9)><8cs8(H ¹H=?9)t!8?;|<@8D84H8 L<8c d<8 |ex|fx<8t8|hx=?9)tL|jxH T:p8ap8txH }T:p8ap8xxH a#xxtxH,Ah8=?9)t!<=?9)t!@=?9)t!D=?9)t!HL8PT8X8)\cxDxxHd8=?9)tܑ!<=?9)t!@=?9)t!D=?9)t!HL8PT8X8)\cxDx~xtx=9 d} Cx*xHB8atxH 8axxH 8!|N |B}|c9`4cAL=@C0=(ɩ=(8Ui:})*m`Ah(`( 9k4c@Ѐ9`4M =@C0=(ɩ=(8Ui:})2m`Ah(`( 9k4M K|!@B||x|#x|+x|3x|;x}Cx}0Kx}WSxAa(,!0<= a)|HA<8cq8HX,A 8H,A 8><`| A$=)9)><8cq8H QH\=?9)r!8?;y<@8D84H8L<8c <8H|ex|fx<8r(|hx=?9)rD|jxH Dž,A`8<@xdx~x<8 |3xHx)x~ xH c~cx<8rx~%x8HA}{x<8rH\8<@xdx~ųx<8 |3xHx)x~ xH cI~cx<8r~%x8H}{x<8r}sx8)H̀! ! 8! ! ! ! a <8r48Hqa$<8s88HY9`4AL=@C0=?ɩ=?hUi:})m`dA``h(`( 9k4@Ѐ9`4AL=@C0=?ɩ=?hUi:})m`dA``h(`( 9k4@Ѐ8!|N |!B|}x|#x|+x|3x|;x|}=`ak| X@8a8<8$xH=xH88a<8pp8P8PH!88Ȑ<@aDAH!LPT=?9)p!X=9kؑa\8`=?9)!dah8̐l8ؐp8ܐtx|a8+8P}#Kx}d[xx~Fx}{x}kx}sxA|H!!>=`ak| X@ 8a8<8$xH5xH88a<8p8P8PH!88Ȑ<@aDAH!LPT=?9)q=`ak| XA<`| @T~HL!})ր|JT:.((=h b(.=?  LA@ X*H= (8(A9J((a9k|PPo|@|x|XP-| @| x| BN| @| x}kB||X@}`[x}%Kx|QA?C0=?ȉ =( PPl (((*|gxyA<`| A$=)9)><8cg 8H H ;|I֐x| x9)!x, @ 8x<})p})9)||X@a|H@!,@ 8;})p})9){|X@a|H@!,@ 8!|H@!A9ja9(| I֐}e[x}+Kx}GSx| @@}CxK9J%9)| HA}FSx} ZH }&Kx} *9|ZAx}*:)|J|:T<}eY}&B9)}+I|J|B| x9)!a9(| I֐|B!9)a9k})Y}*J!UJ:A8a8@xH xT:8a8DxH xT:8a8HxH ՀxT:8a8LxH xT:8a8PxH T:8a8TxH T:8a8XxH eT: 8a 8\xH IT:8a8`xH -T:8a8dxH T:8a8hxH T:8a8lxH ـT: 8a 8pxH T:$8a$8txH ><`| @ 8!<@D8xH;|L@PDTHXL\P`dCx~xxfxhl!pAtH -<8cg@x8H 12|l,<C0((=?ɩh(2ѡ!8<=?9)!@!D8H8L8P8T=?9)!XA\T`!dXhdl8plt8xt|8p88<8cx@DHP~ɳx~xHZ29)!19)|I֐,@<8cg\x84H ݀,@<8cgx8(H8!9)( A<8cgx8+H, @<8cgH, @<8chx8"H܀,@<8ch,x8FHȀ,@,<8chtx8EH !<8chx8H,@<8chx8CH <8cix8?H =?9)lH;}#KxH)r9k19)}kIր}ka0<8c808HHyxx8PH y<8ciTx8H e=?9)l`;}#KxH29)!0<8c808H519)!4<8c848HHxx8PH =?9)lx}#KxHM|l,<C0((=?ɩh( ?$Hu!8<8c888HHxx8PH <8cipx8H q2|l<<C088=?ɩh(2с!8<=?9)!@!D8H8L8P8T=?9)!X\\`d`hhl8plt8xt|8p88<8c8|@DLP~ɳx~xHVY09)!/9)|I֐,@<8cix83H %,@<8cgx8(H8!9)( A<8cgx8+H, @<8cgH, @<8chx8"H܀,@<8cix8FHȀ,@,<8chtx8EH i<8cjx8H,@<8chx8CH 5<8cjx8?H !=?9)l;}#KxHqp9k/9)}kIր}ka4<8c848HHxx8PH <8cj\x8H =?9)l;}#KxH09)!4<8c848H}/9)!0<8c808H]HAxx8PH A=?9)l}#KxH|l<<C088=?ɩh( ?$H!(<8c8(8HHxx8PH ̀,A,A8 8a=?/ ́%})=`C0=_ɪHm)!ah(=?2=?/ Ѐ(|Jlah(2=?/ <8ch8,xH ~<8ch80xH ~<8ch84xH ~m<8cl88xH ~Y<8cp8<xH ~E<8cp8@xH ~1= a)|HA<8cZDx8-H<8cZtx8HH <8cZx8HH <8c[x8HH <8c[Lx8HH <8c[x8HH <8c[x8HH <8c\$x8HH <8c\lx8HH <8c\x8HH }<8c\x8H i<8c]x8H U<8c]x8HH A<8c]\x8HH -<8c]x8"H ;D:P8<8c]<8t8D,09`x9@8H(%<8ct8D,0xH T<8:H<:L@8PD@HL8aT<8t8D,0=9ȁ!4A8H18a,xH y8a0xH y8a4xH y8a8xH y8a<xH y?;^8?/;Г<@;D83H;@AL<8c|<8||#x<8T<8^|3x=?9)^<|3xH Q8??/;9ԓ!<@D86HAL<8c|<8||#x<8T<8^p|3x=?9)^|3xH <8c^x8CH M<8c_ x8CH 9<8c^x8CH %?/;=?8<@8'D8>HAL<8cT<8T<8X|fx<8_P|hx=?9)_x|jxH E$=?X8a<@;`aD;%HAL<8cT<8T<8|fx<8_|hx=?9)_|jxH =?T8A<@aDHAL<8cT<8T<8|fx<8_|hx=?9)`|jxH ];x<8`88P8PH8a<8`8P8PH8aP<8`8P8PH8a<8a(8P8PH8=?9)\!<@8,DHAL<8cT<8|<8|fx<8ax=9x|jxH Ǒ?C0=?Hl䓡!!( ø!(l쓡((2!zHa@l!!( =(l((2!zH`l!!( !(l ((2!zHl((l((z Hm ( n( n( n $\| x9)!\U):9)!(8a(8XxH w-;\8X<@~óx~x<88P@=/9~ix=_9J\H!8<@D HLxX</8</8ƶ~gx~Hx}kx~xH˵8a@xH tA8aXxH t5<8cax8HH 8!๡HH|!B|#x|+x|;xT:|3x|28<8}e[x8|xH Mmh8!`|N |!B|~xH ĕ|@ <8c<8Rx8OH X8!P|N |ؐ!B|+x|;x}Cx}9)8<8ciH,@W$:|z<8c88Htm,@H,@;Z;97@x;@G; 7A?;i;@:,G@$;@8a<8@ex8@8PH)}>9)8<8ciH,@8W$:|r<8c88Hs,@HE,@;Z;97@x;@G3;29)I; 7A?;i;@:,G@$;@8a<8@ex8@8PH(}>9)8<8ciHE,@xW$:|j<8c88Hr,@TH,@H;Z;97@x8a<8@ex8@8PH(I8a<8@ex8@8PH(-8a<8@ex8@8PH(=?9)j8@ }#KxH,@<8c~$x8HrQ,@<8c~x8Hr5,@H,@5|HA4|H@8adxH*8HD;@G; 7A?;j;@:,G@$;@8a<8@ex8@8PH'-}>9)8<8cjH,@W$:|<8c88Hq],@H,@;Z;97@t;@G; 7A?;j4;@:,G@$;@8a<8@ex8@8PH&y}>9)8<8cj4H,@(W$:|<8c88Hp,@H1,@;Z;97@t;@G1;09)I; 7A?;jL;@:,G@$;@8a<8@ex8@8PH%}>9)8<8cjLH1,@dW$:|<8c88Ho,@<`| A$=)9)><8cN8H H<8cN(88p&xx99 H ,AD8 88<<8cx<8N8<8N@8px!9@H %,A;;ap=?;INLAa;;x88<8<8PH;xdx8P8H8a<8NP8P8PH8aP<8N8P8PH8a<8N8P8PH=?9)O@!88Đ<@;PDH8L<8c<8|ex|fxx=9,x|jxH`ـ,@Px<8OT8P8PH8a`<8O8P8PH;px<8O8P8PH8a<8PD8P8PH8a<8P8P8PH8a`<8P8P8PH!8a<@DH8L<8c<|dxx<8,|3xx=?9)=_9JH>,@pH\88<81@8D8H<8c<8Q4|ex<8QD|gx=9Qx|ix9ApH I= a)|HA8ap$x|exx89H ,A<8cQx8EH |UH\8`<d@DHLPTX8\8ap$x}sx}kx~dzx~hx~Ix~*xHр8!x !| ! ! a<8QԀ8!HՀ(8! |N |!BaX\|+x|3x|;xl!pAt́!|)!!ā4<`| A<8cM8!H H8a`<8M48P8PH!;acx<8M8P8PH?;Mԓ8?;[L<@8D;@PAH; !L<8c|dx<8x|fx<8M=9T9!`|jxH Q8a`<8N8P8PHcx<8Nd8P8PHm8a<8N8P8PHU8?;[P<@8"DAH!L<8c|dx<8x|fx<8O=9h9!`|jxH <)ց!X |Aa\ |@<8cO(~x8HH y}HD:~p~ȁ!)a+8! a !)a+8aX\<8|+x=?9)(~ xH #9!i9 !6sA,ak;7{A!8 aYւ=?ФW :})!Ё!| T:a|Z>_:R[P=?}>U):}) @9W:a|aX~$xp88~xH 3-a\lt88~xH 3 l<C0ɡ(h 2!92h!9)84AaKHP?;[P}:*9)})9)| Aal | A95YA|`P<8[P8aY8 |`i}$B9)})9)| A<| A0}hUk:}k})U):x}) h* 95J@84@8;7{@T!9)!6s@m<C0=ɫh(=?L$ѡ8aX\9!~ xH @5!94AP=`C0=?ɩ=?HU :})mah(`( 94@́! 85AP=`C0=?ɩ=?HT:})lah(`( 85@̀a<8Op8H̀a<8O8 Ha<8O8 Ha<8O8 H8!Ȑ H8!@|N |!pB|sx|+x ! }NSxA Ѓ Ԃ ؂! ܂ ! ~x~x= a)|HA<8cID8H,@,A 8H`,@,A 8H@1, @| @ 8H 0, @| @ 89<`| A$=)9)9<8cId8H uH 1|H@0|HA<8cI$x8FH s<8cI$x8H s<8cTH-<8cȜ 8Hb<8cȜ}sx8Hbm<8cȜ~$x8HbY<8cȜ~x8HbEHH88 88<<8c<8I<8I8`(x! 9@H ,A;a`=?;IIAa;;ȓ8a 88<88PH;xdx8P8H8a0<8I8P8PH8a<8JL8P8PH8a<8J8P8PH=?9)J!88D84H8L<8cȜ<8|ex|fx<8M|hx=?9)M|jxHRHl=?9)Mp!8=?9)T!D84H8L<8cȜ<8|ex|fx<8M|hx=?9)M|jxH 8a`<8M88'x99 Hm,A$<8cN$x8H o%8H;`x<8N$8282H}=x82H ea9@5cA 9`}(R ?9J5k@9a`!}+J8 @}k8 A!9)!=?9)U;`}#KxHy<8cȜ}{x8H]qHuUx82H 9@4cA,9`!}(J})R}hR ?9J4c@;`x82H |9a`}+8 @}k8 A!9)!=?9)U }#KxHy1<8cȜ 8H\Htx82H 9@4cA,9`!}(J})R}hR ?9J4c@;`x82H Հ|9a`}+8 @}k8 A!9)!=?9)U8}#KxHx}<8cȜ 8H\ Hsx82H e9@4cA,9`!}(J})R}hR ?9J4c@;`x82H !|9a`}+8 @}k8 A!9)!=?9)UP}#KxHw<8cȜ}sx8H[UHs9x82H 9@4cA,9`!}(J})R}hR ?9J4c@;`x82H m|9a`}+8 @}k8 A!9)!=?9)Uh}#KxHw<8cȜ|dx8HZHrx82H 9@4cA,9`!}(J})R}hR ?9J4c@;`x82H |9a`}+8 @}k8 A!9)!=?9)U}#KxHva<8cȜ<8T8HYHqx82H E9@4cA,9`!}(J})R}hR ?9J4c@;`x82H |9a`}+8 @}k8 A!9)!=?)T, A88!<x~x <8Ȝ|3x~(x~ x9AH B(=?ɬ h(k.=? `$=?9)U}#KxHu9<8cȜ88HXHpx82H !9@4cA,9`!}(J})R}hR ?9J4c@;`x82H ݀|9a`}+8 @}k8 A!9)!=?9)U}#KxHt<8cȜ88HXHox82H m9@4cA,9`!}(J})R}hR ?9J4c@8a`82H -|9a`}+8 @}k8 A!9)!;`x<8NX8282Hvx82H 9@4cA,9`!}(J})R}hR ?9J4c@8a`82H |9a`}+8 @!}+J8 A!}+J8 B!}+J8 C!9)!=?)T, AT!q A}+J8 @!9)!8 7A;`a 7A==?a 9k}kiց! })ZU):A })R h(rLA@*ЃH(؃Fp|8a<8888~x)xHFp|T@.|P8a<8888~x)xH! 9)! 7@$! 9)! 7@8 7A9 7A: ::;`?;{U:a?_;ZU ,@؀ ,@́! Ȉ | tA a ̈ |t 8 (A AH! , @ !H8a<8888~x)xH 8(A H! , @ !H8a<8888~x)xHUH,@L8a<88<88~x9! H ,@@ !|H@0a 9k| ց!  }IB}J |t |P }kց })B})Z |ta | P  |t  | t! A 8 (ALa , A@, A8!9)!U@ 6}`Z9kw, @9k!}>Ji?H<8cN$x8LH d{<8cUHo]<8cȜ8 8HRHj~cx$x8PH c͒z<8cUHo%<8cȜ8 8HRHj~cx$x8PH! 9)! 7@ta 8 } ց }(H})t! |ց! | | tA 9ka 7@.8 61A,9a K 7ZA:~Sx>:U:9>:V9 ;9`! 9)})ր |J }@}* | uA |J H }* |t! })9)! ;5k@ ,A<8cUHm<8cȜ8 8HQU<8cȜ8 8HQAHi%~x$x8PH b%<8cVHmy<8cȜ8 8HQHh~x$x8PH a8a~xH Ɂa 9k}kց! })Z) }) ,A;`H ;`a 9k}kց! })Z) }) ,A!9)!;{a 9k}kց! })Z) }) ,A!9)!;{a 9k}kց! })Z) }) ,A!9)!;{a 9k}kց! })Z) }) ,A!9)!;{a 9k}kց! })Z) }) ,A!9) !;{a 9k}kց! })Z) }) ,A!9)@!;{a 9k}kց! })Z) }) ,A;{;8a<888x~x)xH,@H 8|) |  |8a<888x~x)xH;;~\x! 9)})  ` }%Z})}) ,A@;{,@4||Z|8a<8888~x)xHY;7@! 9)! 7Z@,! 9)! 61@,@l8a<88<88~x9! HU,@ !|HA(<8cN$x8#H ^8a~xHH8a~xHq,AH=?9)V(;}#KxHi<8cȜ~x8HMUHe9x$x8PH ^9H88a`8H a <8cN8 8`~x'x99 H } 8! |N |!!B|yx|+x|3x|;x}Cx};Kx&| @`|3x<8Ʊ9!@H,@!@| A(<8c7dx8#H ]a#xDxHAH$8>9)>}) x8!p|!N |!B|}x|#x|+x|3x|;x}Cx}3Kx}RSxA8<@AD!HLPTX\`h= a)|H@ ,A 8H|,A 8Hh<, @$w, @ | A | @ 8H4:, @$t, @| A | @ 8><`| A$=)9)><8c78 H hiH<8c70x8:H [<8c<87l<8 <8>D8x9 9@PH ν,@<,@$<8c>H a,@ Ha<8c>Ha,@ Hݐa,AX<8c7tx8BH [=?9)>;@}#KxHfi<8c88HIHaxx8PH Z<8c>Hma,@ H]a<8c>HMa,@ H=a<8c>H-a,@<8cdx8HIua,@l<8c$x8HIUa,@L<8cx8HI5a,@,<8c~ijx8HIa,@ Ha<8c?Ha,@ H}a<8c?$Hma,@ H]a<8c?8HMa,@<8c~x8HHa,@p=?鱤;<8cx8HH]a,@8<8cx8HH1a,@ Ha<8c?LHa,@ Ha<8c?`Ha,@ Hya<8c?tHia,@L<8cx8HGa,@,<8cDx8HGa,@ Ha<8c?H a,@P;7A8W:|<8c88HG9a,@;7@Ha<8c?Ha,@P;7A8W:|<8c88HFՐa,@;7@HQa<8c?HAa,@`<;:9)I;7A8W:|z<8c88HFaa,@;7@Hݐa<8c?H͐a,@ Ha<8c?Ha,@ Ha<8c?Ha,@L<8c~x8HEՐa,@,<8c~x8HEa,@ H=a<8c@H-a,@P;7A8W:|r<8c88HE]a,@;7@Hِa<8c@Hɐa,@P;7A8W:|j<8c88HDa,@;7@Hua<8c@(Hea,@d7;49)I;7AU):(}) @t}>U):,}) xp,Apr9k39)}kI֑a`9!t!8<@D~Cx~Dx@~fx~gxD9!`AHH =}~Uk:}k}>U):0Hlu9k49)}kI֑a`9!t!8<@D~x~xT~x~xX9!`A\H }~Uk:}k}>U):4})|h( H}>U):});7@;Z79@X8!t !x ! !| !$ ! p,Aa<80Ha<808H_!|i;5kAD=@C0=?ɩW:h})olAhhh( ;5k@Ё!i;@5kAD=@C0=?ɩWI:l})o@lAhhh( ;Z5k@Ѐ8!|N |a̐!pB|+x|3x|;x}Cx}5Kx}XSxȃC[x\xYx= a)|H@,A 8HT,A 8H@%, @| @ 8H &, @| @ 8><`| A$=)9)><8c,8 H \H<8c,x8H O<8c<8,<8<84(8@x9 9@PH @,@<8c4xHE<8c~x8H><8cx8H>H<8c4H H 8H7AH:`aD7A <8c4H<8c8D8H>)<8c8H8H>H8|!T:|DT:|<8c88H=ခH8|!T:|DT:|<8c88H=H8|!T:|DT:|<8c88H=yH8|!T:|DT:|<8c88H=EHف!D9)!D7@!H9)!H7@<8c4H8!|aN |!B|ux|#x|+x|3x|;x}Cx}0Kx}OSxAa!= a)|HA<8c)8H,@,A 8H`,@,A 8H@9, @| @ 8H 7, @| @ 8><`| A$=)9)><8c)8H YQH=?h(!9)}| H@}+Kx8 8a8xH 6I8a8xH 6-T:8a8xH 6<8c8xH 5><`| A8Hh8l<p@tDxH|LPATX\8Ԑ`=?9)!dhal!pt̐xА|ĐȐ~x~x~ųx~fx~Gx~(x~ x}{xHI8axH 28axH 28axH 28axH 288!0|N |H5L!p!AăaA (K~Qx~^x= a)|HA<8c'8H! ,@ ,A 8Hh! ,@ ,A 8HD=, @ | @ 8H$(, @ | @ 85<`| A$=)9)5<8c'$8H VIHl}Ui:})(9k<C0=Ɉxmka`(*$!iUi:A})R (9kmka`(*$9`aa=9)!h=U):9)!PT:XU :8a8H~xH 2XT:8a8L~xH 28aP8T~xH 28aX8\~xH 2}5<`| @Dh;`5 A$W`:|.(|.;{5)@ahUk:!}kJ=U):}) * <8c'D~x89H H%8pt8a`8d~xH  9 !AJ!5JAA=9ka<`=Qa=?9).đ!=_ʊx=k|@APA*}(HP9)a l|H@!ll9@5`A8U@:}*BU):})B (! | .9J5k@Ё!lU+:A }kR})U):})B * !i9kA*9)}kI֑a aȑa8:֞>:x::s`V:}iz})réVi:}iz})rÉx*с*a|ӡ*ѡ*xh(h$@ h(rXHxh(h$@h(r|H($j @x`(rHh|`(`$@xh(rH4|`(`$@$xh(r`(rH($j @,h(r|h(rHx`@(h@ @`H(x H8h@Axa| hHDxh@@ha|!HAa!x|P(X(rP(h$ *(ѡ r2h(h$@ h(rH8h(h$@$h(rH<($j @,`(r(H`(`$@$h(rH<`(`$@(h(r`(H@($j @,h(rh(rHh@0`@@ha `H0 H8h@Aa hHDh@@ha!HAa!P(X(rP(h$ *(ѡ r2x h(`cn h(`[n h(`[n| h(cn h(cn h(cn LA@X(A,HX(A,9J LA@`(,H`(,98 (A(9 !a9k}k};j})ZIHH, @$a9k}k};j})Z9`iH a9k}k};j})Z8 8(A$a9k}kր};})Z HT9 !,@$a9k}kր};})Z9`H a9k}kր};})Z9`ih*@tm@<C0ɡ(hxh(xh(h(h(mɡ(h|h(|h(h(h(9`899@Ui:})BIL9k4@h*$08<@DHL9!p!P9AtAT9aaX\8ax8|88899!09AH h*$48<@DHL8pP9tT9!!X\8a888899!49AH 89`9@8=h=?= xUi:})* L`LA@h*(,Hh(8<|!9)})) }):})B})Z 9k5J@,A,A ,@99`89AUi:})R Lh@ }h[x9k4@,@(a8c|~c |c |c|cBHDa8c|~c |c |c|cBH,A ,@,`LA@9;H9;9`89AUi:})R Lh@h}Cx}h[xH Ui:})R L`@ }|[x9k4@,@La8c|~c |c |c|cB8cH )a8c|~c |c|c|cH0a8c|~c |c |c|cB8cH a8c|~c |c|c|cHX,A ,@T LA@daXLA@9;Ht`LA@9;H9;a;@Hh LA@< LA@9;`;@H09;H9;a;@9`89AUi:})R Lh@ ``xh}Cx}h[xHHUi:})R L`@``x}|[xH Ui:})R LX@ ``x9k4@,@ta8c|~c |c |c|cB8cH a8c|~c |c|c|c8cH a8c|~c |c|c|c8cHa8c|~c |c |c|cB8cH Հa8c|~c |c|c|c8cH a8c|~c |c|c|c8cH H,@a8c|~c |c |c8cH 5a8c|~c |c|c8cH a8c|~c |c|c8cHa8c|~c |c|c8cH,@a8c|~c |c |c8cHa8c|~c |c|c8cHa8c|~c |c|c8cHia8c|~c |c|c8cHIa8c|~c |c|c8cH)Hl,AL;#,AT[ a8c|~c |c|c|c8cH;7A K,@;;HL!9)})i { }#Z})}) ,A;|c|cZ|c8cH;8,A8,AK9`8x[ 8!9)})) })R})B})Z9k4@؁!9)})};J) })8 9`8x[ 8!9)})) })R})B})Z9k4@؁!9)| | }` ,@\ ,@P ,@D})|j} Ji}`t,~A 8  !9)})) { })Z}) !9)})) })Z}) !9)})) })Z})9 !9)})) })Z}) !9)})) })Z}) !9)})) })Z}) !9)})) })Z}) !9)})) })Z}) !9)})) })Z}) !9)| | }` ,@d ,@X ,@L})ցA|R} Ji}`t,~A 8  !9)})) { })Z}) !9)})) })Z}) !9)})) })Z})8 !9)})) })Z}) !9)})) })Z}) !9)})) })Z})9 !9)})) })Z}) !9)})) })Z}) !9)})) })Z}) ;{6@H!|H@aA| P|6p}ip| P| @8a̐ <8c.H= <8c88H l<C0ɡ(hlD= C0!@@($h8<$<8c8$8H %H8 8a~x8PH 1 !9)!4@X8a8~xH h=?9).;}#KxH<-`h(4<8c848HH7x~x8PH 0=?9).}#KxH;dh(0<8c808H]H7Ax~x8PH 0A,Ah<8c'~x8FH 0!<8c'~x8DH 0 <8c( ~x8EH /<8c(T~x8EH /<8c(~x8H /р,Ah<8c(~x8FH /<8c'~x8DH /<8c( ~x8EH /<8c(T~x8EH /u<8c(~x8H /ap,@X=?9)/ ;}#KxH:<8c8p8H1H6x~x8PH /<8c(~x8EH /t,@X=?9)/$;}#KxH:E<8c8t8HH5x~x8PH .<8c)@~x8EH .8aH~xH 8aT~xH  8aL~xH 8a\~xH = a)|H@8!$ 8!LHj| uA 9)H| t9)#N | uA 9)H| t9)#N |!B|+x|3x|;x}Cx}0Kx}OSxahCYxXxSx= a)|HA<8c |8 H :H,@,A 8H@%, @| @ 8H &, @| @ 8= a)|HA(<8c |8 H 9;=)9);Hx8::!9=?>_:R0H8?; 8: 9:&:@=?9) !=?9) !Ē8,A!| @ 8!!88@C0=? s=lX=?‰m=?il=Kl\8!~Io`A((h(aprn-r26zzr!h$Hp  !a@Hq 2$9`W:}) hL@@dW:}) h@P|P,@ 9`H`W:}) h@ ;HDW:|.hL@@0;H(W:}) hL@@ ;H;|A|@|x|x9`, @<|@$/9)})}=JU):})éH`W:})IP(o9k}k}<`| A$=)9)><8cL8H H2qP;8 }+HP!?;l8; <@; !D;@+AH;`aL<8c]<8](8|fx<8|hx=?9)|jxH ;ԓ8;<@!DAHaL<8c]<8](8|fx<8|hx=?9)|jxH ! 9)a9k})YU):!8a8xH 9ؐ8<`| A$=)9)><8c8H =H %| P| x9)!(} HP9)|I֐8(|x|HQA\|P|+x|;yA88}a}*})B ,A!9)!9J5k@84@=?9)Ԡ;@}#KxHQ<8cB88HHxx8PH =?9)Ը}#KxH<8cB88HۡHxx8PH =?9)Г}#KxHـ!| P<8cB88HUH9xx8PH 9=?9)蓩}#KxH= C0=ɋIl!ɡ`(hl!`($=? C02ѡ<8cB88HHxx8PH 륀8!|N |Ԑ! B|{x|3x|;x}Cx}7Kx}\Sxx= a)|H@,A 8H\,A 8HH(| A| @ 8H$7| A| @ 8><`| A$=)9)><8c8"H )H<8cx8GH <8cLx8EH q<8cx8?H ]<8cx8EH I<8cx8DH 5,@|<8c`x8H <8cdx8DH <8cx8AH <8cx8AH <8c0x8#H <8c`x8H 8a`<8T8P8PH8a<88P8PH8a<88P8PH8aP<8D8P8PH,Ap=?9)ꔑ!8=?9)!<@8D8PH8L<8c?<8?@|ex|fx<8=9?\9!`|jxH˹Hl=?9)ꔑ!8=?9)!<@8D8PH8L<8c?<8?@|ex|fx<8=9?\9!`|jxH ,At=?9)꼑!8=?9) !<@8D8-H8L<8c?@<8?@|#x<8?<8|3x=?9)|3xHkUHp=?9)꼑!8=?9) !<@8D8-H8L<8c?@<8?@|#x<8?<8|3x=?9)|3xH = a)|H@,A`8a888xH)88<<8c?@<8?|#x<8 899!9AHexH9=?), A7|x|HQA:| x}@HQAP8|=9 |8}+:U):}) @}+})9k5J@84AK7|x|HQAp:| x}@HQAP8|=9 |8}+:U):}) @}+})9k5J@84@8!|N |!B|xx|#x|+x|3x|;x}Cx}/Kx}PSx!XA\p!ta= a)|H@L,A 8H,A 8;<`| A$=)9);<8c8#H H;7AW:}= ,A8|}8c<89exH {-,@P}}+=)9)B@H8W:|}8c<89exH z,@}}+=)9)+;7@x;px<88P8PHa88<8#@8D8PH<8c9l<8$|ex<84|gx=9X|ixxH cxH N9<`|Ax8xfx8P9PH _,A<8cldx8EHP8adxH x9`}k=?9)d8p i}#KxH+y,A<8cdx8H uHcxH `,A8a`<8H8a`<888Hy8<8c9<8<88gx9 9 H wq<8c9<88`8gx9 9 H wI<8c9<8<88gx99 H w8;ȓ<`| A$=)9)><8c8H H8a<8$8P8PH80=?9)!8;<@8 D9 P!H8"L8P!T<8c1<8t<82<<88|gx=9|+x9A0H x<88P8PH1,@Ȓ8<@DHaL!P!$!TX\`dhAlDpHtLxP|TX\`!@!|!!Cx$xxfxā!AH>5HL8a<8$8P8PHM,@,Đ8Ȑ<̐@АDؐHܐLPTXa\`dhl!!ptx|Aa!!$!dlptxā!|!Ȁ<8c2Hx)xAK8!@ 8!|N |!B|{x|#xptx|!AA!؃= a)|H@,@,A 8H|,A 8Hh!p ,@ ax+|HA| @ 8H4!t ,@ a|+|HA| @ 8><`| A$=)9)><8c8&H H $=?9);}#KxH<8c.}kx8H-<8c.8HHxx8PH =?9)(}#KxHQ=?/p<8c.8p8Ht<8c.8t8HǩHߍxx8PH ؍=?9)@}#KxH=?.rx<8c.8x8HYH=xx8PH ==?9)X}#KxH㑁! =/=?.$|<8c.8|8HHxx8PH =?9)p}#KxH1! $<8c.88HƩHލxx8PH ׍=?9)D!8?;<@8%D8*H8L<8c.<8.8|ex|fx<8X|hx=?9)ހ|jxH Q,A`<8c.8}kxxHE<8c.8~$x~xxH>)<8c.8}{xxH@<8c.8xH:axH@Q8a<8ެ8P8PH8a<88P8PH8a@<8L8P8PH8a<8ߜ8P8PH8a<88P8PHq8a0<8<8P8PHY8a<88P8PHA8a<88P8PH)8a <8,8P8PH=?9)D!8?;<@8D8PH8L<8c.<8.8|ex|fx<8|=9.@9!|jxH ꕀ,A1!*=?.X!O!aAH8U =? /!2=? .!$<=.!2=? .8LA@@*l<C0=ɫ5h(`$HL=? .X(l<C0=ɫ5h(=? .$Ѽ8a<88P8PH8a<88P8PHm8a@<8<8P8PHU=?9)⌑!8<@8)D8PH8L<8c.<8/<8.|fx<8=9.x9!|jxH E=? .2=? /$ѼHh*=.Xr=?/8a<88P8PH8a<8$8P8PHu8a@<8t8P8PH]=?9)⌑!8<@8D8PH8L<8c.<8/<8.|fx<8=9.x9!|jxH M$8a<88P8PH8a<808P8PH8a@<88P8PH=?9)D!8?;<@8"D8PH8L<8c.<8.8|ex|fx<8=9.x9!|jxH )T:8a8xH ,AĀ8!!u=?), A 8a<88P8PH]8a<8D8P8PHE8a@<88P8PH-8a<88P8PH=?9)D!8?; <@81D8PH8L<8c.<8.8|ex|fx<84=9.T9!|jxH 䙀,A88<`| A$=)9)><8cT8H H <8cpx8H 9<8ctx88H %<8c٬x89H <8cpx8H =?9);}#KxHM<8c 8H<8c 8HHЩxx8PH ɩ=?9)}#KxH! =? $p<8c 8p8Hq! t<8c 8t8HMH1xx8PH 1=?9)ؓ}#KxHԅ! =_rx<8c 8x8HHxx8PH =?9)}#KxH1! =_ =? $|<8c 8|8HH}xx8PH }=?9)}#KxHс! $<8c 88HIH-xx8PH -=?9)!8?;<@8%D8*H8L<8c <8H|ex|fx<8|hx=?9)$|jxH ,A`<8cHxH6u<8cHxH.<8cHxH1Q<8cHxH+AaxH0=?9) ,AT8 8A|*at } HP9)=`C0=_ɪ&m)!a!!h( =?h!A*Ax } HP9)m)!ah(2!zH)a =? HLA@*H=_ h(l<C0=ɫ&h(!r=?. ?.; AJ!aAH) =8a<8P8P8PH ;ACx<8ڠ8P8PH;@x<88P8PH;acx<8@8P8PHӹ8a<8ې8P8PHӡ8a0<88P8PHӉ8a<808P8PHq8a<8܀8P8PHY8a <88P8PHA=?9)!8?;<@8D; P!H8L<8c <8H|ex|fx<8 =9P9!|jxH 8a<8@8P8PHCx<8ݐ8P8PHҩx<88P8PHґcx<808P8PHy?;ހ8<@8D!H;`aL<8c |dx}kx|fx<8ޜ=9d9!|jxH Հ,A@8<@8D!HaL<8c |dxp|fx<8޴HL=?9)ހ!8<@8D8PH8L<8c |dxp|fx<8=9d9!|3xH 1=?), A?.;=? =? $8a<88P8PH-8a<8@8P8PH=?9)ހ!8<@8D8PH8L<8c <8H<8 |fx<8ߐ=9t9!|jxH $H,=?.9) Ah$ 8a<8߰8P8PHm8a<8@8P8PHUA*ax } HP9iA|*At } HP9)| X@}i[xm <C0=ɫ&h(=?9)ހ!8?.;츓<@8D8PH8L<8c <8l8|fx<8=9t9!|jxH !r=`C0=_Ɋ&la`(=?$!ѩ=?), A4la`(=?.$ѮH<l<C0ɡ= &(h=?. h$8a<8 8P8PHΩ;x<8p8P8PH΍;@x<88P8PHq8a<88P8PHYx<8`8P8PHAx<88P8PH)8a<88P8PH8a<8P8P8PH8a0<88P8PH=?9)!8?;<@8D8PH8L<8c <8H|ex|fx<8=99!|jxH e/|IT:8a8xH 퓡8?;<@!!DAAHaaL!!PAATaaX\!!`AAd=?.9)촑!h=?.9)츑!lpaatx|А̐}kxptx|!AHBi8axH ,Ao9@5kA=C0=?ɉ&=?)h=?I =?i UI:})m@`(H(rX$ 9J5kAxKo9@5kAd=C0=?ɉ&=?Ih=?iUI:})m@`(P(r 9J5k@x9@5kA|=C0=?ɉ&=?Ih=?i UI:})m@ɡ`(hP(l`($ѩ9J5k@=?), A:ahH |tx=?:iAhAaa88<8tHa<8$8Hʁa<888H|:ahH |vx=?:)PhȒ!̀a88<8tH a<8$8Ha<8l8HX8!P|N |! B|+x|3x|;x}Cx}4Kx}:Kx= a)|HA<8cx8H H88a`<8Ӕ8P8PHU=99`:`=9Υ(>:s@>?:1X>:p=?9)!H ;@8<`| A$=)9)><8c 8!H H=?9)D!8?;X<@8D8BH8L<8c<8 |ex|fx<8X|hx=?9)p|jxH ,A0|HA$=?)X, @,0|H@<8cٴx87H H=?)X, AhHhlh!l| x|HQA,89UI:}i}) 9J4@=?)X, A2|x|HQA6|x|HQAd8||`}(})2 ,@8U :}K*9)*}k}(U):}) h* 94@84AK2|x|`HQA6|x}`HQAd9$|ɡT:|}@|}(})2 ,@,'9)'}(*U):}) h* 95k@84c@h!l| x}HQAle ,@<`Hl=? h$ h$ =?h$ =?h$  =? 2=?h$ 2h$<8c4Dx8 x8 H q<8c@$x8 x8 H U<8cLx8 x8 H 9<8cX~x8 x8H <8ch~ijx8 x8 H <8cx~x8 x8 H <8c؈~x8 x8 H <8cؘ~dx8 x8 H ʭ 8! |aN |a!B|{x|#x|+x|3x= a)|HA<8c48%H aH=? 2=? $Ѥ8a`<8\8P8PH8a<8Ҭ8P8PH8a<88P8PH8aP<8L8P8PH8a<8Ӝ8P8PHy8a<88P8PHa8a@<8<8P8PHI8a<8Ԍ8P8PH18a<88P8PH,Al=?9),!8<@8#D8PH8,L<8c<8<8|fx<8X=99!`|jxHHh=?9),!8<@8#D8PH8,L<8c<8<8|fx<8X=99!`|jxH ҕ=?2=?h$r`$,Al=?9),!8<@8D8PH8,L<8c<8<8|fx<8|=99!`|jxHHh=?9),!8<@8D8PH8,L<8c<8<8|fx<8|=99!`|jxH э=? 2=? $ѼX8!P|aN |a!pB|{x|#x|+x|3x= a)|HA<8c@8#H H<=? P2Ѥ,Al=?9)d!8<@8 D83H8L<8cL<8L<8|fx<8Ҁ|hx=?9)Ҡ|jxHMHh=?9)d!8<@8 D83H8L<8cL<8L<8|fx<8Ҁ|hx=?9)Ҡ|jxH =? L2Ѿ=? P2ѽ,Al=?9)d!8<@8 D83H8L<8cL<8L<8|fx<8|hx=?9)|jxHMHh=?9)d!8<@8 D83H8L<8cL<8L<8|fx<8|hx=?9)|jxH =?Lr<8c(x8`x8 H <8c4x8`x8 H ĵ8!|aN |!PB||x|#x|+x= a)|HA<8cФ8'H mHd=?Hr8a`<88P8PH8a<88P8PH8a<8l8P8PH8aP<8Ѽ8P8PH,Al=?9) !8<@8)D8PH8,L<8c<8d<8|fx<88=99!`|jxHUHh=?9) !8<@8)D8PH8,L<8c<8d<8|fx<88=99!`|jxH %=?Hh$8!|N |Hе\!|+x|3x|;x}Cx}4Kx}MSxH!X\hlc= a)|HA<8cа8"H HĀ,A 8H,A 8H'| A| @ 8Hd(| A| @ 8H@=?$hL@A$hL@A hL@@ 8= a)|HA$<8cа8"H 79)N 7H!`P H@ H `!T)!PaPTH!PÉ2r!d HY H r x*rr=|x@HQAD>@C0=?=?©Do`DA@@((!Lh(r.|xHQA? C0=?=? D=?é8oD!@!@!( !(!(!2r;r:22z!h| Hq !( !$!HL@@8W:8aH<8~xH . !z=;7@L;{7Z@8!\H|!!B|+x|3x= a)|HA<8c͐8#H yH|,A?;ʹ8<@;@!AD;`'aH;L<8c<8|#x<8<8|3x=?9)|3xHՓ8!<@ADaHL<8c<8|#x<8<8|3x=?9)@|3xHH?;ʹ8<@;@!AD;`'aH;L<8c<8|#x<8<8|3x=?9)|3xH U8!<@ADaHL<8c<8|#x<8<8|3x=?9)@|3xH 8!|!N |Hž!`|zx|#x|+x|3x|;x}Cx}8Kx}WSx!)<`| A<8c̠8H H˃22&H=?||<Hi|>HY|*r>zHirۘ2=Hr$2<Hyr$!2>HUr$!<H>Hr=H(<H>H r$@a@D HY!)>Hm=Har<HU(>H=Hr$@a@D H!)=H<Hr>H(=H]<HQr$@a@D H!)8!H|Hq!P|zx|#x|+x|3x|;x}Cx}8Kx}WSx!)<`| A<8ct8$H AHˆg*H*=? 2ˣ*22 H>(Hur>(Hir>(H]?rH r۸2 H9r$2 ؐHr$!2>Hr$!<Hi>H]r=HQ(<H>Hr$@a@D H!)>H =Hr<H(>HY=HMr$@a@D H흁!)=H<Hr>H(=H<Hr$@a@D HA!)8!Hh|A!0B|zx|#x|+x|3x= a)|HA<8c,8!H H,A|#x<8P|3x8H,@8a`<8THx<8Ȥex8H,@8a`<8ȨHx<8ex8HU,@8a`<8HPx<8Lex8H%,A$x<8Pex8H,@8a`<8T8P8PH=?9)Ƒ!8;`<@8D9 P!H8&L8P!TCx<8ɤ<8x<8ƊF<88=9=?9)x|+xH x<88P8PHU,A8a`<8T8P8PH5,A8a`<88P8PH,A8a`<8T8P8PH,@x<8PH8a`<8Ȩ8P8PH,@x<8ȤH`8a`<888P8PH,@x<8H08a`<8ʈ8P8PHe,@x<8Lex8H 8!|AN |!B||x|#x|+x|3x|;x}Cx}5Kx}TSxhAlax؀= a)|H@L,A 8H,A 8><`| A$=)9)><8c8H H88a<88P8PH8a<8P8P8PH8a@<8Ƞ8P8PH8a<88P8PH8a<8@8P8PH8a0<8ɐ8P8PHp88<@ADaH|LP!!T=?9)!X=?9)ԑ!\8`=?9)h!d=?9)ۨ!h8l8p8txܐ|!!808P<8ch<8@xfx~Gx~(x~ x}{xH><`| @<`H= a)|H@x~xx88xH @cx~xEx88xH ?x~xx88xH ?cx~xEx88xH ?x~xx88xH ?cx~xEx88xH ?;Г88Ԑ<@8a888899!9AH *8Ȑ88̐<8ܐ@D=?9)h!H!!LP8ؐTX\!!`dhxdxpt899!9AH $-~cxH Q|yx; !~wx=?:a88<8۔Hɀa<88Hŀa<8$8 HaȀH<8c0x8-H E! ,A<8ch<8@H<8ch|dxxH9AA8<@D!!HȐLP!!TX!!\x<8@|#x|#x}kx!H8!̐ ! ! ! ! ! ! ! ! ! ! 88!0|N |!Bahl|+x|3x|;x} Cx!AaA!= a)|HA<8c8H =H8<8c<8 <8<8xH~88<8cո|dx<8<8 8=96x9@H1;;@; P?`c{;8a<88P8PHQ8A<`| A$=)9)><8cŒ8H 5H<8c¬x8H }8a88 8xHeQ888<`| @<`H= a)|H@x~xex8 80xH 7 x~xEx8(84xH 6x~xex8$88xH 6x~xEx8,8<xH 6!80!(<4h(2!zHi !@=?9)p;}#KxH<8c8@8HjyH]xx8PH {]!80!(! !2<4h(!r2!zH !@=?9)}#KxHm@=?xr<8c88HiHxx8PH z<8c¬x8H z8!|N |!B|~x|#x|+x|3x|;x}Cx}2Kx}QSx A = a)|H@,A 8Hl,A 8HX,@'|HA| @ 8H,,@(|HA| @ 8:<`| A$=)9):<8c48 H H ,8a h8 l8 p8 tGxHa8a x8 |8 8 GxHa58 8a<8T8P8PH}8a<88P8PHe8aP<88P8PHM88 $H! 0<8c 8 08H`EHx)=?9)8 }#KxH|<8c 8 8H` 2ɡ h$ <8c 8 8H_Hw=?9)80 }#KxH|1?; l < 8 8(ɝɡ k< @<8c 8 @8H_Hwq=?9)8 }#KxH{р l < 8! 8!(ɽ !| H! H<8c 8 H8H_-Hw8 H8 <8cH8a8PH m|ex<8c 8H^H ;`7AP;<8cHaP;x8PH |ex<8c xH^H1;{7@ t=? Ѐ(h. l=?h*`( `. P8a h8 l8 p8 PGxHa<8cΌ8 8Fx8PH_A8; <;@D<8c<88 8 8 9 9! 9A H 5A8<@D<8c<88 8 8 9 9! 9A H   TA88<@D<8c<88 8 8 T9 9! 9A H A8<@D<8c<88 8 8 9 9! 9A H q?`C0=? l La H! H!(>$Hб ! XA88<@D<8c<88 8 8 X9 9! 9A H   \A8;<@D<8c<88 8 8 \9 9! 9A H   `A8<@D<8c<88 8 8 `9 9! 9A H i?; l La H H(ɜɡ k< dA88<@D<8c<88 8 8 d9 9! 9A H 8a DxH T8a DxH T  8a h8 l8 p8 tGxHቀ x8! p|N |H!9`9aaaa99ȑ̑Б|sx||+x|;x!Aa= a)|H@,A 8Hl!| ,A 8HT'| A| @ 8H0A*a| | A | @ 8;<`| A4=)9);<8c8H wH (<`H 8a4888<8@gxHR8d=?9)đ!h=_9J@Al=9kap=9ܑt<`x= a)!|=_9J~A=9k~ؑa=9,=?9)!=?é4=?É8=_j(9`aH8ap<88P8PHxe8a<8(8P8PHxM8a<8x8P8PHx58a`<88P8PHx8a<88P8PHx89!D!?:1>:=9ﴐ=9δh=a>b=?9)s!=9ksđa=?9)sܑ!=9ksa=?ɻ\=9kt a=?É=9kt$a=?éd=?9)t<`| A$=)9)><8c8H cH<8<`| @T:8a8xH @<8cP|dx<8(x8.H0xHTE8<8@9!!D=?9)x!H!!Lh*=?r8ԐPT8XA\`!!dhlp~xx~x}{x}sx}kx~)xAH 8axH <x~dxH }||x;`aؓx=?;)X!Aa88<8ƫHIa<8h8HcEa<8p 8 Hc-aHc<8c|x8.H TŁ! ,A<8cx<8PH<8cx|dxxHo19AA8<@ԐD!ؑ!HLP!!TX!!\~x<8P|#x|#x~Gx!Hjm8! ! !Đ !Ȑ !̐ ! !А ! ! X8!P|N |ؐ!B|}x|#x|+x|3x|;x}Cx}7Kx}^Sx = a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c8H _YH`8a888xH;8a888xH:q8a888xHǥ=?9)!8=?9)gD!<@8D8'H8L<8ch<8h|#x<8Ƨ@<8|3x=?9)|3xHq;Г8<xdx~x&x~dzxHx x=_9JgDH ]=?9)gH;`}#KxH]1<8c@x8H@HX<8c@|dxxx8PHB xx8PH Q8a888xHƑ8!|N |!B|}x|#x|+x|3x|;x}Cx}-KxAaAȃ= a)|H@L,A 8H,A 8><`| A$=)9)><8c8H ]%H8a888xH8U8Ԁ88А<`| @<`H= a)|H@xx}kxex88xH xEx88xH x}kxex88xH xEx88xH =?9)!8!!<@8DHL!đ!PTXxx899!9AH u~x}sxH v|yx; !~x=?:ɝ a88<8ƥ4 HUa<8,8H\Qa<848 H\9a老H\%<8c@x8)H Mс! ,A<8c<8H<8c|dxxHh=9AБA8<@ܐD!!HLP! !TX!!\x<8|#x|#x}{x!Hcy8! ! !̐ !А !Ԑ ! !ؐ ! ! ! ! X8!P|N |H!!`a|+x|3xȑ}3Kx}RSx؁܂!<p= a)|H@,A 8Hl,A 8HXw, @6| A | H@ 8H,u, @4| A | H@ 8><`| A$=)9)><8c8H X)H8 08! a` 9t:;;;@=?9)!x=9ka|=9P=?9)4!=9kxa=9\=?9)P!=9kpa=9x=?D=9ka=9P=?9)Б!=9kxaD̀H=?9)!=9kPa=90=?9)x!=9k\a=9P=?9)x!=9kxa=?ɣ=9H=?9)P!}cx},Kx!}i[xa}cx},Kx!}i[xa}cx},Kx!a=a,Ax8<@DHL!!PTaaX\`!!d<8cPdx%x}sx ~hx~Ix~xHܹ,A`<8cx<8<8|+xxHFA8<8cP|dx<8<8Ơ80=9`px9@H:;8A,@x1, @lU+:@}+ ,@聁L}+b9)!81U):D})9)!<1U):aH})Z9)!@1U):T})b ,8,D1U):aX})Z (9(H1U):P})9)!L!!PaaTX\cx$x~x~x~dzx~x~ix~JxH -HdT:@}= ,@a}=Z)4 !(}= !8h(2!zHuL}=9)!81U):a})Z9)!<1U):})b9)!@!4!Da8aH1U):T})b $8$L1U):aX})Z $ 9 P!!TaH(8a<888H<`| A$=)9)><8cu8H 0qH|8 ;! ! | 04:=?9)x!8=?9)x!<>b>b0,A`8A<@ȐDHLPTaXA\!`d<8cxxex!*xHe4,A<8cx<8x<8x<8yxH i8a<8u8P8PH188<8cx<8x8<8y8 =9<,x9@PH048a<8v 8P8PH088<9 P!@<8cy8 <8<,<8x8$99!(9A,H!$,AL,@8!ȑ!<@DH8(L9!,!PؐT!ܑ!X80\9!4!`dahAl!ptxdx%x~xGxx!AKeH$,@8a<8v 8P8PH.|cy@a0a4H8a<8vp8P8PH.,@48xdx%x~xGxx=?9)xAH ϕH48a<8v8P8PH.y,@;04H8a<8w8P8PH.I,@(<8cy8 <8<x8PHH8a<8w`8P8PH.,@<8cxxH=H8a<8w8P8PH-,@(a%x~xGxxxHHH8a<8x8P8PH-,@8A<@!8H48a<8xP8P8PH-Y,@p8A<@!<`| A$=)9)><8cr8H )H8a888xH88a<8r8P8PH+a8a<8s 8P8PH+I8aP<8s\8P8PH+18a<8s8P8PH+8a<8s8P8PH+!8a<`| @<`HL= a)|H@8x~xex88xH ]xxEx88xH Ax~xex88xH %xxEx88xH x~xex88xH xxEx88xH 888<@8a888899!9AH ̀,A<8ct|x8(H H4=?9)t!8=?9)8!<@8D8/H8 L<8cq<8r0<8s|fx<8t|hx=?9)t|jxHy!!(AB(!aAH}`!!(AB(!aAH|!!(AB(!aAH|=? r@=? r{*=? r@=? r*88a888899!9A H 쩀 ,@ؐ`~ &V1A=? r{(!H(&BnaX( A`(S.h(+nFJ.X(@^gb h(`j=? rL@@$LA@h*(M=? rL@@LAA ,A,=? uLL@@h*(m=? rL@@LAA ,A,=? txL@@h((-.=? uPL@@LAA ,A,=? rL@@h(((.=? 8=?r0r(r`* 2 *!9)|H@}_:R8=?‰r0~Vx:!9)w| H@}+Kx<!9)|H@} Kx|xXQA$?@C0=?x=?ér0o`̓A((=?r=?r, &8:oēA((@h(?(rLA@L@@x!aAHx @!*LA@L@A(8 A,!(LA@L@@}=}) ;7@8;{7@|8!`HQ|!B|px < @ D|;x}Cx}<`| A$=)9)><8cht8 H -H8a(8,8084xH]888a<8h8P8PH8a<8h8P8PH8aP<8i48P8PHu8a<8i8P8PH]8a<8i8P8PHE8A<`| @<`H= a)|H@8,@8a<8@8D8HxH88%<<8cdP<8d(|#x<8jH8<9@9!D9AHHxH !8U):8}) 0!8U):}) P!89)! ;;8L88P<8T@8a <8d(8`<8g8@=9dxxH ;aXa8<<8cd<8d(x|#x|#x98|#x9A\H q;`8<<8cd<8d(x|#x|#x98|#x9AdH 9Cxx~ex8\8hxH[yCxx~exfx8lxH[]#x~x~%x8d8pxH[A#x~x~%xx8txH[%p!t|xHQA WI:}) |h!l|xHQA?;{d:::L;P;!T=?dP8~99W:}) x!89)!$a8<@DH!L8ax8|88$<8d(9`=?9)g9A@H ͹LA@, ,A}=})H}=});7@`;Z7@8!|N |!B|vx|#x8<`| A$=)9)><8cd8H YH8a8xH 8a8xHAh15| |x;; ;@;`?c,Al!8H:$:||c8p88H,@ 8;7@8a8xH qxH~x|A;@,@ac=?9)$9)(|cJ8H /ma=?9)$9)(<8ce8|J8x9 9 H &m8!|N |!B|wx|#x|;x}Cx}3Kx}RSx!āȃ܀= a)|HA<8c`8H H8a888 xH|8,AD<8c&P8cP<8a88H-<8c&8c@<8a,8P8PH ,AD<8c&P8cd<8a|88H<8c&8c<8a8P8PH,AD<8c&P8cx<8a88H<8c&8c<8a8P8PHu ,AD<8c&P8c<8bD88HI<8c&8c0<8bX8P8PH);8 $;@;`;; P<`(= a)!, ,A8a888 xHzА8A`C0=K<E>:H8|9֐}>}) ,@Doa((!4h(a$`rn-r22zzr!h$HL] `LA@ȀHL@@! ,@((`(a|h$*`(h$H,@|<(!a@HL1 ç!(!|$<*!a@HK !($H,@!0= F,2<G\$<(!a@HK !HJ] >x|ç$<*!a@HKA !HJ x$HЀ,@ā!0é= E2<*!a@HJ !HI !*$(|$=? E2<(!a@HJy !HIM !*$($ﯠ(h@h@<DHX А@ؐ!aAHJ !Ѐ<(=? D @<E*@!<h( L@@$lh(ax s$,h*1$q(\,A:$=? E*-h*HH `!2=? E(@Ā}>U):}): $Ha}>ZU):})8x89A8B!X|@|Dx}cx, @8|x| QA=`C0}i=?K= E/|`@(l| 8((H0|@08l})!8((`$Hh$ @(`Z.|+x|@| x|;x@8|x}`HQA<`C0=?)K=?IE8}}@|8@$oaH((H,|(@,8laH(($H$ P(b}=BU):})2j }=RU):})  ;5k@`84@;7@a+})P9)| 8|.p}+p| P,| @9aP!i<8c$H р'})P9)!<8cD88H I'})P9)m)!ɡp(h=? E2 'a } HP9)m)!p($h<8cD88H ѹH 8aP}sx8PH ;{6@\,Al<8c]|}sx8H m=?9)<;P}#KxH <8cD88H IH -x}sx8PH -<8c]}sx84H ! ,@pX85Ao;5kAl8}@=?F|8}=RU):}) `@ }=U):}) h$ H}=U):});5k@85@!d ,@ȁa+9)( A;7A?C0<K=?E8l!!( a !zHC r!2$X84A09&})}=JU):}) 2 84@;7@xa+9)( A؀H\,@L8<8cDȀhl|fx|gx}{x!X xH |P܁! 8!๡$H|AȐ!B|xx|#x|+x|3x|;x}Cx}>Kx}YSx = a)|HA<8cL8#H AH8;ACx<8L8F8FH 8a<8L8F8FH 8a<8M<88H 8a<8MP88H 8a<8Md88H m8a<8Mx88H U8a<8M88H =8a<8M88H %9 !9`a!8!a8,=? 5=? 7;a cx<8M8<8<`| A$=)9)><8cM8"H H 8Cx$x~Ex xhx! A K8Q= a)|H@ ܀?C0=?6Tl ! !( !(!2l  (h(r2!zH=l ! !( !(!2l  (h(r2!zH<l ! !( !(!2l  (h(r2!zH<`| A$=)9)><8cG8H iH 0=?9)X ,A8 3})9)=`C0=_ɪ+`m)! a  h(=?$2=?- 1})9)m)! a  h(2=?- 8  8a<8G8F8FH a8a6<8H88F8FH I;ACx<8H88H -8a<8H88H 8a<8H88H 8a,<8H88H 8a@<8H88H 8aT<8H88H ܵ8ah<8H88H ܝ8a|<8I 88H ܅8a<8I 88H m8a<8I488H U8a<8IH88H =8  Đ Ȑ ̐ А Ԑ ; ܓ 䓡 ;acx<8I\8<8<`| @8! 8!  8! |N |ۡ!Ba(,|+x|3x|;x}Cx!@ADHLTX\`halAp!tx= a)|H@L,A 8H,A 8><`| A$=)9)><8cD8"H IH <8cE <8@84x8H ݁!@ 9| P<| x9)!<`| A0xH 1<8c|dx<8E$x8#H/5HT;x<8EH8P8PH 8a`<8E8P8PH 8a<8E8P8PH =?9)F8!8=?9)@!<@83D8PH8L<8c<8<8d|fx<8FX=9|x|jxHG8 D8H;@AXA\Ad=?9)!h=9kF8al=?9)@!p}+Kx!t=?ax=?=9k@a|=?é=9k@aaa=?9)!=9k8ii| Ȗ|.p}ip| Pd}`XP| @<8~xH Q=|}x|~8c<8~xH Q! W:}> |~8c<8~xH P |~8c<8~xH P,@<|~8c<8~xH P |~8c<8~xH P;{7@,@lPT=? h(k.X h(k.8<~#x~x~x889=?9)=_9JDH H<,@dPT=? h(k.X h(k.8~#x~x~x889=?9)D~ xH H,@xPT=? h(k.X h(k.\ h(k.8<~#x~x~x8899!=_9JlH HX,@4} HP9)!4} HP9)!T :})9)!85U):})9)!<@<8cD<89P9!9AH H, @dPT=? h(k.X h(k.8~#x~x~x889=?9)l~ xH Hh,@`PT=? h(k.X h(k.8~#x~x~x889=?9)l~ xH X8!P|N |!B|~x|#xH |@x,AP8a@xHM<8c `xH<8c|dx<8x82H8a@xHH <8c<8x82H h8!`|N |!B|~x|#xH 1|@x,AP8a@xH<8c xH<8c |dx<8x8+H8a@xHH <8c <8x8+H h8!`|N |H UD!`Đȑ̑!БAԃA$=_ = =?é W|:}<8i)| Ж|.p}+p| Pd|HP|@p| |fp| P'|HP} Ж}).p|p~HP<8 <~xH F ||8c<8 ~xH F||8c<8 ~xH F|cy@W:})0}| H,@$W:})Wk:A0}kR 2H,@`W:}kWi:0})A ld<C0`ɡ`В(h h(* HX,@(W:})Wk:0}k $H(,@$W:})Wk:A0}kR  ;{7@\,@0a+9)+U):})jrH4,@4A*9)*U):})jr2 Hx,@pa+9)+@ U):})jrH0@,A*U):})jr2 Ht=+H9 !2$<8c888~xH A*U):})j2$ѩa;AJ!!*W:j2 rrzj2k2rkh:2[zJ2J`:!P:!ЀaЀ!ЀЀ@ȐH =;96@(=?9)X\ }#KxH H E=?9)pA\|  }#KxH H !8=?9)V@ H,@Wi:A0})R 2H,@DWi:a0})ZA ld!`ɡ`(h h(*HD,@ Wi:a0})Z r$H ,@Wi:0}) ;A}=Qցa })U):h}) 18 }2IցA\}*J:<8cH <8c ! ||H e<8c 88H QH 5;{7@8!8 !;`7A?;18 }2IցA\}*J<<8cH M8|!<8c !D|"H W}:|j<8c 88H H A *};J9)a})YցA })U):ah})Zj ;{7@L=?9);; }#KxH <8c H8H -H x~x8PH =?9)蓩}#KxH a<8c 88H H x~x8PH ;=? a A*|x}@HQAXa}<`| A$=)9)><8c+(8!H )H\!x9'|H@!9&|H@!9'|H@!9&|H@!8`=?I=?)|?;=h:@A!!| x|@HQA}HP}Cx}KSyA`8 |!}=U):})* @ѡx}cx}=U):})* `(k.;5k@94B@!| x|HQAPA샡9l}k!}"ZU):})* h(k.}}ZUk:}k* h(k.94@!|x|HQAX!9)}!ց!9)}i!}=bU):})* h(k.}=ZU):})* h(k.;4@  @8`uH!| A4!| A$!| A!| @x!9)|H@} Kx!9)|H@} Kx!9)|H@} Kx!9)|H@} KxH 8`U,@!, @9I9H,a9+ |HA9K},KxH [!, @8I8 H,a9+ |HA8K} KxH Z=? }]Sx}j`QAT}BP|Lx}@SyA89,})!}=JU):})* @ѡ94@;5k@,A<8c+Lx8CHth(Ԁ|0P|p} x}(HP}*Kx|8P|p} x}hXP|8P|p}x|P|X@}`[x|P@}@Sx|H@} Kx=`C0=?i lđaX(=?r=?r8lɁX(`=t h(lđaX(h(=?|c|ȁ!̀|H@!l<C0ɡ=  (h=|k<ȁ!̀|H@!l<C0ɡ=?  (h=|k:ȁ!9)|H@!l<C0ɡ= (h=?|k:ȁ!9)|H@!a88Ԑ<8ؐ@8ܐD8H8LP8TX#xx8899!~xHD,@ 8=?9) ;p}#KxH Y<8c,~x8H H xx8PH =?9)8}#KxH <8c,~dx8H H xx8PH =?9)P}#KxH <8c,88H mH Qxx8PH Q=?9)h}#KxH =$2=? $ѡ<8c,88H H xx8PH =?9)}#KxH I<8c,88H H xx8PH =?9)}#KxH <8c,88H H }xx8PH }=?9)}#KxH <8c,88H ]H Axx8PH AH8!@|AN |Đ!B|#x|+x|3x|;x}Cx}8Kx}USx= a)|H@X,A 8H $, @| @ 87<`| A$=)9)7<8c"8H H8;4A(}) (2!zHM !*8;7@l<C0=?ɩh($Ѹ;4A@=?l9 @W:}K:}+ }+B}k ;4@9`899@=? $Ui:})BIѩ9k4@8d=? <BȐ=? 8T:8a8~xH %9AA8A<=9ka@aDHaLaP8T8X8\8`ad8h8l=?9)!p!t8x8А|a=?9)ԑ!88 88}#Kx<h}%Kx}&Kx}'Kx~ȳx}i[xH 9 ,@<8c"0~x8#H M8a~xH l<C0=?ɩh(!!$H 5h8!`|N |Ԑ!B|#x|+x|3x|;x}Cx}9Kx}VSx= a)|H@X,A 8H $, @| @ 8><`| A$=)9)><8c8H H8dxExxx~x)x~xK=? 2Ѷ894A@=?ɑ8 @U :}K2}+ }+:}k 94@9`899@=? x$Ui:})BIѩ<9k4@=? 8d(=? h,<BȐ0=? h488T:8a8 xH 9A$A8A<=9kXa@aDaHaLaP8(T8,X80\84`ad88h8<l=?9)켑!p!t8x8|aa=?9)쀑!8А 8@8D8H}#Kx<}%Kx}&Kx}'Kxhx}i[xH ¹@,@<8c x8$H 8a xH }EH=? @\,@@8l<C0!=? L!( -$H 5H=? H 8h@ Ѷ=?$h*=? $ @,=?8`(hLABA@Kh=? ( @$=?i8 X*hA8!|N |H ͽ|!0a|#x|+x|3x} Cx}9Kx}OSx Aa a$(4A@!D= a)|H@L,A 8H,A 8><`| A$=)9)><8c8H 5Hȑ8A<@!DH:LP!!TXa\a`d8h9!!lp8t!(!(\2!zH *r!$l<C0=?ɩh( =? P!*( 2$*Ӂ4(2${*a8x}sx}kx84,xH e~óxDx%x880xH eq<8c,0xK !, r !0 r 8axH t8axH t}8axH tq8axH te8!й|H Ɉ|B|h|%| x}@HQM =C0=#ɉ\=#iUi:}):m``(X( (h* 9k5JM K|!B|~x|#xH Ľ|@x,AP8a@xH!<8c4xH<8c$|dx<8|x8?H|U8a@xHqH <8c$<8|x8?H h8!`|N |H !P9`9aaa aaa $a(,a04a|#x|+xԐܑؑ!Aa !$lp= a)|H@,A 8H|,A 8HhԀ,@ ܁(|HA| @ 8H4!؀ ,@ A*|HA| @ 8><`| A$=)9)><8c8H H<8c<8xx8 H <8c<8xx8 H -=? @=? *H,=?  @=? (H @=? *H=?9)븀 ,A8 h@\=-9kh(<,2=? $=\ LA@=? | *H=_ | (H\=-9k=? *(= ,2=? $<\ LA@ =| *x|H=? | (pt,@8 =?-9)m(A h(cnk$= \ LA@ = | *x|H<| (pt,@8 8cx!(A,K%= a)|H@| ,@9H4! ,@9@AH<8cx8:>-:s>_-:R>:>:=?é=Ë\>:988<8@9 D9!!H9AAL9a@aP9T8АX8\90`9! !d9AAhlptx9`a|9<8 <8c߈|dx8 <8ߘ|3x9=?9)ߴ9AH!5,A \ $$$(r,rLPD H\LABA(=?i=? X(`AL@BA(=?i=? X*`A hh(L@BA,=?I<g\P*h H(XAѡ@h`h(hLABA$=?`(`h P(`Aѡ<8c<8xx8 H <8c<8xx8 H 1,A9 H9@! I L@@(<8c4|dx<8\x80HH 8,@; x<88<8<`| A$=)9)><8c8H |HP8a888xH8a888xHa<8cxHxdx<8xH<8cxHrr8A<@!DH!đ!LȐP!̑!TX\?;蓡`8d8h8l8p8t8x8|!!xxEx&x!AKWh$h$<8c|dxxfxxH88a<88P8PH |8a<8 8P8PH |8a@<8\8P8PH |8a<88P8PH |8a<88P8PH |m8a0<8L8P8PH |U8!!<@!!DH!đ!LȐP!̑!T=?9)!X=?9)|!\8`=?9)!dh8Đl;ȓp;̓tx|!!8%8P<8c|dxEx&x~x~Hx~x~*xHു><`| A @<`| @ 0<8c<84<8xH,@dxdxxxxHa!!(AB(!aAH 08H`89 !<8cxH=?Ȕh*xdx8fxxH<8cxHI<8c|dxxfxxH 88a<88P8PH z-8a<8 8P8PH z8a@<8\8P8PH y8a<88P8PH y8a<88P8PH ỳ8!!<@!!DH!đ!LȐP!̑!T=?9)d!X=?9)L!\8`=?9)!d=?9)!h8Đl;Гp;ԓtx|!!8*8P<8c|dxEx&x~x~Hx~x~*xH%><`| A<`| @<8c<8xfxxH],@|<8c<84<8xHxdxxxxH!!(AB(!aAH /H=?Ũh*8=?9)!=?9)|!=?9)!=?9)!?c<`=?9)`!=?=?9)!=?9)<`| A$=)9)><8c8#H mH\<8c8$<8xx99 H n8a`<8,8P8PH oE8a<8|8P8PH o-;x<88P8PH o8aP<88P8PH n8a<8l8P8PH n8a<88P8PH n8a@<8 8P8PH n8a<8\8P8PH n8a<88P8PH n8a0<88P8PH ni8a<8L8P8PH nQ8a<88P8PH n98=?9)!<@8PDH8L<8c|dx8`<8Ƶ|3xx=?9)T=_9J|H!y,AxH]H<8cdxx&xGxx9 H9`4A,=?\Ui:}) r 9k4@<8c8H a <8c8 <8xx99 H ~X8!P|!N |ۡȐ!@B|}x|#x|;x}Cx}:Kx}XSx= a)|HA<8c8H kHDh$Ph$T H$ H9$ @!paptApptH% !`?=zH !X=? * Ha$ H$?=zHM !\<8cT<8xxH88aP8T8X8\8`=9T=?9)|=_9JH8!|ˡN |!Bax|#x|+x|3x}Cx!A!AĂȃ܃<;x:x3x= a)|H@P,@,A 8H ,A 8H,@(|HA| @ 8H́! ,@ a+|HA| @ 8H7, @| @H8<8c$H q<8c~x8H J<8cx8H JH EH@=? 8L@A = L@@ 8><`| A$=)9)><8cL8H gH*`*=?2h$| x9)!} Kx!7|IT:8a8xH D7|IT:8a8xH D}><`| @8!x ,A<8clx8H Zm,@8,A<8cpx89HH<8cx8@H4,A<8cx88H<8c$x8?H Y87At=988<@!!DaUj:}*9)!H!LPATX9!!\8`dh}J9JAl9k|YT:!|Jp|YT:!|Jt|YT:!|Jx}sYUk:}ka|x~ijx}{x}sx!AHA!x ,A`9am<8c8H d9<8c88H GŀT:|<8c88H GH _8ax8PH X!9)!7@8axH ?8axH ?h8!`|N |!B|ox|#x|+x|3xHL}>KxAT`dh!lptAxa|Aa= a)|H@8,A 8;<`| A$=)9);<8c8!H dH8<@!DHLAPaTAXa\}{xx~x~xHL!XA\H,A;7AL;!pW:}))!*?$!aH !*=;7@Ēa8A<T@aD}{xx~x~Ƴx~x~x9!pJxH8<@!DHLAPaTAXa\}{xx~x~xHL!XA\Hhj=? LABA<`=?I X@ P(H P*bXA؀(8! |N |!B|ux|+x|;x}Cx= a)|H@,A 88<`| A=)9)8H8؁V85JA8=? N aUi:})B)|J9ka5J@؀,A8<8cTx8(H T<`Կ<8c|8$H aiHV87ZA=?N 8`w!U):});7A??=?ɪ\=?D;cޣX<8cH <8cd88H Ca!)h})U):}) \$<8cd88H C)h|T:N |<8cd|8H BH ;7@p!9)!7Z@$8,=? t<BȐ=? t8v=?)N0i;;8=? T:8a8xH =9AԑA8A<=9kda@aD9ؑHaLaP8ܐT8X8\8`ad8h8l=?9)!p!tx8|a=?9)!А888<8c<N,}%Kx}&Kx}'Kx}i[xH 5,@<8cx80H RIH 8axH 9X8!P|N |!Đ!pB|tx|#x}Cx}6Kx}WSxAȂe~rx= a)|H@l,A 8H4,A 8H ', @| @ 8:<`| A$=)9):<8c8 H ]H';79AW :});7Al8`}=U):}) h$@}=U):}) h$D8a@8D<8FxHe;7@;79@xCxHNՀ8!|!N |!PB|ux|#x|+x|3x|;x}Cx}2Kx}QSxaA! = a)|H@8,A 8><`| A$=)9)><8c8H \iH$a8A<`| A$=)9)><8c8 H YH8a(8,8084xH5)!ȑ!8<`| A 8H8,@ Hx8,Al!ȑ!8<`| @́!a !D!x!aHk82!zH !):H8,@a 88aHx)x=_9JK8@8a<88P8PH W8a<88P8PH W8aP<8T8P8PH W8a<88P8PH W8a<88P8PH Wu8a@<8D8P8PH W]8a<88P8PH WE8a<88P8PH W-8a0<848P8PH W8a<88P8PH V8a<88P8PH V8<@aDAH!LPT8(X8,\80`84d=?9)$!h=?9)!l;p=?9)T!t=?9),!x8@|8D8H$!(!8"8P<8c,|dxxfxx~xAHGف><`| @(!a !D!x!aHk82!zH5 ! !( a+! ,A<8cHx8H G1=?9)}#KxH R! =r <8c,8 8H 5H Mxx8PH F=?9)}#KxH R1! ah$$<8c,8$8H 5H Mxx8PH F8!|N |!B|qx|#x|+x|3x|;x|}4Kx}SSx!AaAȂ̃Ѐ= a)|H@\!Ā ,A 8H =?  L@@ 8<<`| A$=)9)<<8c8H RH8a888xH-I8~x$xx~xGxxix=_9J\Kqh(h(ē8~x$xx~x89ix=_9JHK%h*h*̓8~x$xx~x89ix=_9JHK88a<848P8PH R8a<88P8PH R8aP<88P8PH R8a<8$8P8PH R8a<@DHLPT8ԐX8ؐ\8ܐ`8d=?9)t!h=?9)8!l8p=?9)!t=?9)!x8|8@8Ԑؐܐ8+8P<8c|dx~%x~x}{x}sx}kxA|HCY<<`| @@a85kAT8!U):}) 2 !U):}) r ́!9)!5k@87AT;aW:}=)!( (2!zH= |=.!9)!7@!9)2! ,AT<8cx8H B-87A?;{;=?隌<8cH M]<8c88H 0!U):}) <8c88H 0H Hxx8PH A!9)!7@87A?;{;<8cH L<8c88H 0Q!U):}) h$<8c88H 0!H Hxx8PH A!9)!7@X8!P|N |H }$!`a|#x|;x}>Kx}]SxA܃A(!,a0a4  = a)|H@\ ,@! ,A 8H! ,A 8 +<`| A 8 N <8c8H LyH <!(!2OB( B2!aAH=? 4 @=? H(H =? 8 @=? H*>-(H2 H HE`|p~s;4A(9@W:}iK})I;4@-*=? 92 h(cn`( . `( .,@; h(k.`( `. `( `.;!)| @x}>Kx9@88@88U@:}`2 }zh}. hA0} |.`(X(h$ ,c| H4U@:} |. A} 2 HUI:})29J4@x(a 2( 2a @H Ha @HY Hx~QA4=\a+9)m)!<C0x(8o x(=?iX(9@9U@:}  LA@|. L@A,U@:}  L@@|. LA@UI:8@}i ,A ,A})zIH8U@:9a@} Z,j=kX@ `(hP@h$9`H@UI:8@})  (=?iX@ 9`H9`H9`! i! ,@U@:} z LA@|.L@A,U@:} z L@@|.LA@|@|x|@|xHa ,@U@:} z|.a |@|x|X@}g[xU@:} |.a |@|x|X@}f[x9J5@́L(! Z2a|0@|3x|;yA8|xQAD8~@A>C0=? \=따=(`=? H=?ɕ́! ,Aa}=Z}) ,@o((h(rr`mr2l`h$,@ (!h$*h$H,@|;(!a@HU !$!r$;*!a@H !$!r$Ht,@=? $;(!a@H !H >rè$;*!a@Hu !HI r$HȀ,@=? d2;*!a@H !H !*$È$=? d2;(!a@H !H !*$$(nn`(**](,@8|@|x|+x|@|x|3x|8QA<`C0=(\=?i8a|Y|T:| 0@(8 laH((H,| (@,8 laH((P$HP$ X(bUK:}+} h: }+ * ,A}+2k: 9J4@@;7@;96@܁u;5kA<=W:}  `@}  h$ ;5k@Ԁ,@u;5kA=@C0=?ɉ\=h=?IW:$})|PlA`(X(r ;5kAtKu;5kA`=@C0=?ɉ\=hW:$})|PlA`(X(r ;5k@!؀ ,Ad,AX;7AH=?ɕ=?éH=Ë`=?i=?I=蔴,@H 8a@8D8H8LgxH8,@ =?9)֤!=?9)!=?9)!=?9)ԑ!=?9)!=?9)!=?9)!<`=?9)!=?9)!=?9)!=?9)!~x~qx=?9)(!ā!< ,A`a@D<8fxHF)<8c|dx@DgxHoI8P8a<8@8P8PH ?m8a<8א8P8PH ?U8<@DpH!t!LxP!|!T8@X9!D!\8H`9!L!d!!h!!l8p!!t!!x8P|9!X!8`a!!!!9 -!8Pa8<8Ex&x~x}{x x~xH0A<8c<8؀@DgxHnXp`t!@ph((ѡh!Dth((ѡl<8c<8<8fxHU98ah8l8p8tgxH%Cxx~ųx8h|3xhxHa#x~x~x8l|3xhxHECxx~ųx8p|3xhxH)#x~x~x8t|3xH8P8a<88P8PH =E8a<808P8PH =-8aP<8؀8P8PH =8<@DpH!t!LxP!|!T8@X9!D!\8H`9!L!d!!h!!l8p!!t!!x8P|9!X!8`a!!!!9 /!8Pa8<8Ex&x~x}{x x~xH.Cxx~ųx8X8hhxH#x~x~x8`8lhxHCxx~ųx8\8phxH#x~x~x8d8thxHe|@(9 !P8a<88P8PH ;8a<8 8P8PH ;q8aP<8p8P8PH ;Y8a<88P8PH ;A8a<88P8PH ;)8<@DpH!t!LxP!|!T8@X9!D!\8H`9!L!d!!h!!l8p!!t!!x8P|;X;`a!!!!9 !!8Pa8<8Ex&x~x}{x x~xH,|@Cxx~ųxx8xhxH#x~x~xx8|hxHCxx~ųx8\8hxH#x~x~x8d8hxHma88ah8l8p8t8x9|9!9AH }x(|(h *l *p *t *a88ah8l8p8t899!9AH  ((p *t *h * l * ;;W:|8Cxx~ųx|;xhxH ;#x~x~xxxhxH a;7@<8c<8<8fxHO<8c~x~exfxHkI;;W:|8Cxx~ųx|;xhxH;#x~x~xxxhxH;7@8a<8`8P8PH 78a<8ڰ8P8PH 78aP<88P8PH 78a<8P8P8PH 7!đ!88<`| A$=)9)><8c8H 3H $88a888899!9AKU8 ;8;<8ca=9{=?9){ԑ!=_9J| A>`bs=`aka<8ca=9{=?9){ԑ!=_9J| A!,Ax8<`| A$=)9)><8cX8$H !H8a8xH MT:T:T:8a8xH T:8a8xH 8a8xH 8a8xH u><`|@L{9k:9)}kI֑a8<@DHLPTX8\8`dhlptx<8cidxexGxHx!9AH ^ |@8a 8xH K h(=?9){4;}#KxH <8ci88H H qxx8PH q8axH 8axH 8axH 8axH ŀX8!P|N |Ȑ!0B|zx|#x|+x|3x|;x}Cx}8Kx}[Sx = a)|HA<8c8 H UHA8<8f|+xxx=?9)f xHi?C0=?mld``(=?frhld`(rl8l8ld`(rp8p<`(rt8t@=?9)fԑ!D=?9)h!H=?9)f!LPaTCx$x}%Kx}&Kxxx=?9)f9AhH 둓a8Cx$xx<8f|3xxx9AH <|Ild``(r=?f$xa8Cx$x<8f|+xxx9!x xH݀<|Ild``($P|a8Cx$x<8f|+xxx9!| xH㱀8!|N |!B|xx|#x $(,!0}USxa8<@DHALPTaA!{}h[x= a)|H@ ,@( ,@,@,A 8HȀ,@(,@,@,A 8H G, @ ('| A | H@ 8H\!$I, @ ,'| A | H@ 8H(!X ,@A` ,A 8><`| A 8 N <8c8H eH !h !l !p !t U`:!x |.U:!| |.8a8<@DHALPTXX!\!\A`A`adad=?9)dD!halptx8|A!x~$x $(,!0~xH%!9)!a8<@DHALPTXX!\!\A`A`adad=?9)d!halptx8|A!x~$x $(,!0~xH!9)!a8<@DHALPTXX!\!\A`A`adad=?9)dp!halptx|A!x~$x $(,!0~xHa8<@DHALPTXX!\!\A`A`adad=?9)d!halptx|A!x~$x $(,!0~xHQ7| @<8c0x8H !|J! A*}`JgA*| A| @ <8cPx8)H 8H@A*a })9)|H@(<8c|x8+H I8Hp8! a8<@DHALPTAXAXa\a\``!d!dAAhalp9aat8x|A!x~$x $(,!0~xHa8<@DHALPTXX!\!\A`A`adadhalp!!t9AAx|A!x~$x $(,!0~xHa8<@DHALPTXX!\!\A`A`adadhalp9!!tAAx|A!x~$x $(,!0~xHUa8<@DHALPTXX!\!\A`A`adadhalp!!tAAx|A!x~$x $(,!0~xH̀8!|N |aĐ!B|{x|#x|+x|3x|;x}Cx}3Kx8X`dht= a)|H@؀,@ ,A 8H,@,A 8Hxe, @7| A | H@ 8HLf, @4| A | H@ 8H ,@,A 8><`| A 8 N <8c8H H| x9)!| x9)!?C0=?c0lɡ(hh(lɡ(hh(l(h*l(h*8<<@@DD8H8L8P8T8X8\`cxDx%x~Ƴx~x~x~ixH q<|I֐<})p})| P<|I֐<})p})| PL8P<T@DH\LPT8X8\l`pdhcxDx%x~Ƴx~x~x~ixAHH ylɡ(hl($TU):}) @TW:||aȀЀ88~HxH م|àԀ88~HxH aH}>U):});7@:7@8!|N |!B|vx|#x|+x|3x|;x}Cx}3Kx}WSxxA|!= a)|HA<8ct8#H H \8a888xH9|9}+J})p})|p|} HP| H@}+Kxa{8}+J})p})|p|} HP| H@}+Kxa<y})Z})p})|p|})| H@}+Kxa;x})Z})p})|p|})| H@}+Kxa88AC0=?iQ=?IL>?:1\H>_:R\L~3x~Tx5x|T:r@Ø(}<U):})z(=r>HV$$o!!( !(n(h(2!zHU rr@0r*$ ($$h(ѝ@@2*$}<U):})z ($$`(ѩ;7@:6@X8!0|H .|a̐!B|~x|#x|+x|3x|;x}Cx}U):9)!8a T:@U :8a80ExH ̀@T: 8a 84ExH ѱ8a88<ExH ѡ8a@8DExH ё:<`| @P;5`A8LGW:}8RU):}) (!| .;5k@؁aPUk:A}kR>U):}) * <8c,Dx85H %8`d8aH8LExH P'A }`HP9kap}4KxX!l})Q!tAt=_9J=Ax=`aka|<ç== ba)Mӑ!=_9JOA=ˋD<g>ā!l| ADAX*}4HP9)a T|H@!TT9@5`A0U@:}*U):})j (|.9J5k@؁!TU+:A}kR})U):})j * \g9kA`*9)}kI֑aala8a<@!!DAAHaxaLaP8PT8TX9!8!\9A@A`aad0h4l<pDtAx<8c=\|#xd`|;x!h9AH /Ypg9kAt*9)}kI֑aaa8a<@!!DAAHaxaLaP8PT8TX9!8!\9A@A`d0h4l<pDtAx<8c=p|#xxt|;x!|9AH .||8@ ! Ap}J9JAp~:l!p}i8P9k9+})U):| T:A}T.| . *L'U):}) z(P;6A H!l8 || 8 }@}H|֐=?=Ah|Q֐lT:} j!}kQ֑a=_==ȋD<g=́!Li}xZ}I}+RU):})i@@|}8:U):A|RT:}<.|.*Uk:}k z *!|JT:} z }.h*Aaz (a|ZT:} z|.*az*P(H(P!8IH!;@!9ih!9I|X@ H|XP,@8l@<C0 (P(`$(H|XP,@Dl@JU):})P 2\k: 9%})}lJUk:}kL 2`k: }>JU):})P 2`H,@`9)})},JU):})UJ:8}J:LrT:}k:\ :ѩ9%})},JU):}) LH,@9)})| JT:}UJ:9a}JZLrT:8}k:\:Ѩ P 2\}.k:|.}>JU):}) T 2\k: 9%})| JT:} L 2`k: P 2`}.k:|.}>JU):}) T 2`H}cx} QA8 |8aT:}@8|}'"U):})}b8PUk:}k P 2\k: }'U):}) P 2`k: 85A`K,@,@d9)})}lJUk:}kUH:9A}RLrT:8}J\ :ѫ}>JU):})P 2\H,@H9i}k}lZUk:}kUI:8}):LrT:}):\ :ѫH,@9)})| JT:}UJ:9a}JZLrT:8}k:\:Ѩ P 2\}.k:|.}>JU):}) T 2\k: H}cx} QA8 |8T:}@"}g*Uk:}k}"8PU):})" P 2\k: 85AK}&Kx|(QA/U@::}/,@d9&})}lJUk:}kLr}]0PUJ:}J` :ѫ}>JU):})P 2`k: H @@9f}k}lZUk:}kLr}=0PU):})` :ѫH@|9f}k| ZT:}@Lr}=0PU):})` :ѪP 2`}.k:|.}~ZUk:}kT 2`k: Hd}cx}LQAX8|`;|0PT:|}gUk:}k}"8PU):}) P 2`k: 85J@84@x;6@(AP*al})XP9)| 8|.p}+p| P| @9A!I<8cOH 䵀P'Al})PP9)!<8c=88H )P'Al})PP9)m)!=`C0aɡ(hX'AP } HP9)m)!$a  ($h<8c=88H ǙH }8aDx8PH }l8l!t5)!t@8aX8\ExH Y=?9)O;}#KxH XHh((<8c=8(8H H xDx8PH =?9)O}#KxH U\Lh(,<8c=8,8H H ޵xDx8PH ׵`,@T=?9)P}#KxH <8c=8`8H ƉH mxDx8PH m<8cdDx8DH Yd,@X=?9)P;}#KxH <8c=8d8H )H xDx8PH <8cDx8DH 8a0DxH q8a4DxH e8a<DxH Y8aDDxH M8! H x|H |!X}Cx!`}[SxAA!!Ăx= a)|HA<8c8#H,A 8Hl,A 8HX,@%|HA| @ 8H,,@&|HA| @ 8<<`| A$=)9)<<8c8"H HT :}kCUI:}) (| P=C0=?ɉ1Dl`(*$T :}kDUI:}) (| Pl`(*$/| P8| x9)!8;U):9)! T:(U :8a8xH y(T:8a8xH ]8a 8$xH M8a(8,xH =<<`| @t8;5`A0OW:}>RU):}) (|.;5k@܁a8Uk:}k;U):}) * <8cx85H 8@D8a084xH ɁA`* }`HP9ka};Kx!h a|}[QAA =9k*Pa<`= Qa)!=_9JJa})ZU):});:PHTLW:}i P}) TdXh\V:}i d}) h!X LA@PHP0(D)X@(@.AdP(@L!TH(`:na\X(mh`(m.1n@(AP(QIX( X.`( `.!9)v| H@}+Kx4A8|x}XQA0!8:| 0@|3x4A8| x}`HQA48!x|I}*U):}) * 9J5k@85AKHPh(h$@ Xh(`2`TH8HXh(h$@$Ph(`2`\LH<PX($j @,H`(`2`\T(`HLT`(`$@$PHh(`2`\H<L\`(`$@(XHh(`2`T`(H@T\($j @,XPh(`2`Lh(rHHX`@(Ph@ @`H(HP H8PXh@AHaL hT\HDHPh@@haL!X\THAXa\!PTHLP(X(rP(h$ *(ѡ` 2`2``dPh(h$@ Xh(l2lTH8dXh(h$@$Ph(l2l\hH<PX($j @,d`(l2l\T(lHhT`(`$@$Pdh(l2l\H<h\`(`$@(Xdh(l2lT`(H@T\($j @,XPh(l2lhh(rHXd`@(Ph@ @`H(Pd H8PXh@Adah hT\HDPdh@@hah!X\THAXa\!PTdhP(X(rP(h$ *(ѡl 2l2ll`lh*@$A8H8, ;;;@||! }#J ?8c888H ;7@Ё! 9)! 8a@<8w88H ,A<8cwH8aO8 ~xfx8H 5;;;@||! }#J ?8c888H ȁ;7@Ё! 9)! 8a@<8w88H lj,A<8cwdx8$H8aO8 ~ųxfx8H ;;;@||! }#J ?8c888H ;7@Ё! 9)! 8a@<8x8 8 H ,A<8cxH8aK8 }kxfx8 H ;;;@||! }#J ?8c888H Y;7@Ё! 9)! 8a@<8x<8 8 H a,A<8cxHdx8 H8aK8 ~Exfx8 H ];;!;@||! }#J ?8c888H ;7@Ё! 9)$! 8a@<8xh88H ,A<8cxdx8-H8aV8 8 fx8 H ŀ ,A<8cxdx8/H;;;@||! }#J ?8c888H ;7@Ё! 9)! 8a@<8x88H ,A<8cxdx8)H49 T,tA ,T@9 ., A4;;;@||! }#J ?8c888H a;7@Ё! 9)! 8a@<8y 8 8 H i,A<8cy,dx8!H8aL8 8 fx8H };;;@||! }#J ?8c888H ;7@Ё! 9)! 8a@<8yP8 8 H ,A<8cy\dx8"H8aM8 8 fx8H ;;;@||! }#J ?8c888H 1;7@Ё! 9)!! 8a@<8y88H 9,A@<8cydx8#H <8c$H 9<8c8@8H H !H8 8|HA/|H@0<8cydx8;H I8a~xH])8H 8! ,A0! q+A 8  97A ;7A8~>C0=?8a<888 ~x9ixH -|uA |xH!})t;8a<888 ~x9ixH|uA | xH!})t9)W@.|J}8U):a })Zl( h$ h* ;7@,97@97At;7A4,~`&;8~~,@~x @x8a<8x8 ~x9ixH|t 8a<8x8 ~x9ixHш|t  ! 0H8a<888 ~x9ixH|u@!})t8 | &p})9iU) 6})P8 ! })Z! a }ka }8})  }8})i;7@8} }1H})t! |||t 97@RA 952! AT;6A08a |Y@ 8a<888 ~x9ixH|u@: ;H: |t;TA;TA;TA;TA;TA;TA;pA;;,@d8a<888 ~x9ixH8 }:J}) ;|uA |xH(|t;H8 }:J})8 ,A,@h8a<888 ~x9ixHa;8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A,@h8a<888 ~x9ixH;8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A,@h8a<888 ~x9ixH ;8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A,@h8a<888 ~x9ixH];8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A,@h8a<888 ~x9ixH;8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A,@h8a<888 ~x9ixH;8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A,@d8a<888 ~x9ixHY8 }:J}) |uA HP|t;H<#,@;8 }:J})H8 }:J})8 ,A(#,@;8 }:J})H8 }:J})9`i;6@9 4 @8a~xHS,AH=?9)$;}#KxH =<8c~x8H H xdx8PH H8!  8! |N |!B|+x|3x}Cx&| @(|#x<849@xHL8H&9)&>}) h8!`|N |ۡ!0B|{x|#x|3x}9Kxa= a)|H@ ,A@8<8cg8"H Ht<8cgx8DH q<8ch@H8$=? X$PT|@|x;yA?@C0=?lo\AXX(r H !2!h H !2!lh*`8ah8l8`<88p9t9!xxH p,Ah(d88at8x8d8|899!9AH )|,A$,A<8chpx80H %H;7@8!|ˡN |H ]!@|yx|#x|+x|3x|;x}Cx};Kx}CSx(a4 = a)|HA<8cf8H !H88<@ D8`H8dLaP! AH`r`dr=?`L@@=? LA@g|`h<`*=? 2!$ ,AP=?)L@@=? LA@=|?=? LA@H = 8$2$2P H  H M r8h$h*!, 2z$*!08!H |a̐!B|zx|#x|+x|3x|;x}Cx}4Kx}SSxX= a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8cd8!H Hy}`XP9k5| P| x9)!}kI֑aU):9)!8a8xH T:8a8xH eT:8a8xH IT:8a8xH -><`| @,(8,<;aa@;D;HLPTXCxx~x~x'x~ȳx~x~jxHՀ88<0@4D8H<L@PDTHXL\P`Tdh<8c|dxxxixAH 8axH 8axH 8axH 8axH 8!|aN a|+x|;x}9Kx}ZSxa8<HLaPTXx98(|x|`HQA9`'U):})i5|x|HQA8||@}(})" ,@T9gUk:}k+9)+U:}KU :}) }k}(U):}) 9`94@, A,gUk:}kT:}) '9)'84c@$'9)'aN |H !|px|#x|+x|3x|;x}Cx}5Kx}QSxa!AЀ ~`Ё<<`| @,@x%|HAh | p} x| P+|HALA | p}@x| P|HA0,@<&|HA,5|H@ 8Hh1|H@ 8HP,@ ,A 8H0,A 8H a+|H@ 8 <<`| A =)9)<<8c`8HP88a|888899!9AK=|,@$<`<8c`8?H qH!)YP(p! `(r>Hi $$!$!aH@ A*|xHQA4=k@:;?;{Dot<C0pp(!A zPa H H <r!|88<@D8a~x~Ex&xGx99!9AKs5|PT:!|J8<@!DAHAALaaPaTX!̑!\`~x}sx~ųx}{x~x~(x!āAH %;7@ A*|xHQAL=k@:;9x?;{Dot<C0pp(!A zPa H HI <r P!|88<@D8a~x~Ex&xGx99!9AKq}3PU):| .!rx8<@!DAHAALaaPaTX!̑!\`~x}sx~ųx}{x~x~(x!āAH $Y;7@8!PH x|!B||x|#x|+x|3x|;x}Cx}7Kx}SSx!Aa= a)|HA<8c\$8#H H;x<8\H8P8PH qa88<8,@8D8PH<8cH<8\|ex<8\|gx=9\|ixxH };<`| AXx8xfx8P9PH ـ,@88adxH 19`}k=?9)ܓi}#KxH UH8`,A<8c\dx8HH<8cx<8] 88`gx9 9 PH_,A<8c]dx8IH H<8cx<8]d88`gx9 9 PH_8a`<8]p8P8PH 5 cxH x p} x| P |А T a88 <<8cx<8]xFx8(x x~xHV,@L<8c]dx8;H -a8xDx<8H|+xxHx=?9)p~xHIuH$,@<8c^dx8:H <8cx<8^D8~xgx9 HU5<8cx<8^P8gx9HU<8cx<8^`8~xgx9HT<8cx<8^p8gx9HT<8cx<8^x8gx9HT<8cx<8^8gx9 H\,AP<8c^dx8H <8c^dx8EH <8c^dx8H <`H<<8cx<8^8gx9 H\)<8cx<8^8gx9 H\<8cx<8^8gx9 H[<8cx<8^8gx9 HS<8cx<8_ 8gx9H[<8cx<8_8gx9H[u<8cx<8_$8gx9 HS-<8cx<8_08gx9HS <8cx<8_D8gx9 HR<8cx<8_P8gx9HR<8cx<8_`8gx9 HZa8a<;@<8cx8 <8_l~Ƴx<8H9~x9AHV!8a<8@<8cx8 <8_|~Ƴx<8H9~x9AHN8a<@<8cx8 <8_~Ƴx<8H9~x9AHVq8<8cx<8_~ųx8~xix9@HJ,@L8<8cx<8_~x8~xix9@ HJ,@ 8<8cH Ճ;7A@W:|c8c<8exH ,hc |`};7@8! h8!`|N |Ԑ!pB|}x|#x|+x|3x= a)|H@(@$<`<8cX\8%H H;x<8X8P8PH ;ACx<8X8P8PH : ~x<8Y$8P8PH ;px<8Yt8P8PH ;acx<8Y8P8PH =?9)Z!8)!r!$Hy r!2$}> 2 ,A}> 2r ;7@8!|ˡN |!B|tx|#x|+x|3x|;x}Cx}/Kx}NSx= a)|H@,@ ,A 8Hl,A 8HXe, @'| A | H@ 8H,f, @(| A | H@ 8><`| A$=)9)><8cZ8H H l8dT:8a8LxH y T:8a8PxH xT:8a8TxH xрT:8a8XxH x!U):9)a9k})Y֑! 8a 8\xH x!U):9)a9k})Y֑!$8a$8`xH x]><`| @;d88h<8l@8pD8tH8xLLPTT\X8|\8`PdXh`lp8 t<8c888899!9AKA=?9) ;}#KxH =?l(<8c8(8H |H yxx8PH y=?9)$}#KxH p,<8c8,8H |MH 1xx8PH 1<8cZx8H ~x~x}{x88xHG04| x9)!~x~x}{x88xHG04~Cx~dx}sx88xHG04| x9)!~Cx~dx}sxx8xHGE041| A4!|HA$!|HA!|H@<8cZx8AH <8cZx88H <8c[ x8<`| @L8T<\@8|D8HPLXP`TXA\!`dhalpthxl|!đ!ptx|8ĀȀ̀ЀԀ؀ܓ8a8888l9p9!t9AxH8axH m8axH m8axH m}8axH mq88!0|N |H $!@!}QSxA(,08@C0=?\=_jٰ>:sh=ٴ!~I}=}) ,@oA((Ah(a r2o82:-r22zzr!h$H !$ ,Ah=(!ЀaЀЀЀ@H a$=*!ЀaЀЀЀ@H A$:(H(`h$*@h$! ,AA @x @!ЀaЀAЀЀHu z$x*!*H ! !2(!!@!H =_*ٴ}=U):a})Z $H}=U):}))ؐ8А8|0@|3x|3x|@| x|;x}GPQA:t=K}9=9}8}) ,@8oC0=ȫh=?|G P|@$o(((H,|@,8l(((`$Hf$ 0(`Y|;x|HyA=C0= h=?I8||| 8@$m@@(8(H,| @,8 l@((H$HH$ P(b}`PP| A$, A}jA}kH}KSx}+*U):})k: }+2U):}) : 9J5@0;4c@;6@a+})P9)| 8|.p}+p| P,| @9a@!ȑi<8cH ~q'})P9)!<8ct88H a'})P9)m)!= C0!ɡx(h= Д2'a } HP9)m)!<C0x($h<8ct88H aQH y58a@P8PH r5:s61@,Al<8cN䀁P8H r=?9) ;@}#KxH }U<8ct88H `H xxP8PH q<8cN老P84H q! ,@@<;7A,?`C0=?h=|9@5kAl8}=?p|8}*BU):}) `@ }*U):}) h$ H}*U):})9J5k@$,@! ,At8la( H] r!2$|9@5kA08|}*U):}) 2 9J5k@;7@8!$H |H !P|qx|#x|+x|3xؑ}3Kx}RSx!A 0~Ё6<`| @ā!؀ ,@H%|HA8A܀ ,@D&|HA4a؀ 3|H@ 8HD!܀ 2|H@ 8H(,A 8H,A 86<`| A$=)9)6<8cC8!H {H Ԓ88aЀ  8899!9AK!,@8<=?9)C!@=?9)C!D=?9)C!H=?9)Cȑ!L!PTX8\`8d8 h<8c}{x}sx؀~hx~IxAKM88aЀ  8899!9AKe8|А?;Cԓ8A<@8 D;H83L<8c8%x|fx<8D|hx=?9)D|jxH ~8 ! 8!<@8 D8H9@3AL<8cDx%x|fx<8D0|hx=?9)D@|jxH ~YsUk:}kjA؁*U):})j h*=4r! rUk:}kA܁*U):}) =?É`o:=_ǜra  ?;D`8! !<@D9@3AH;`aL<8c<8|#x<8<8Dx|3x=?9)D|3xH 8! !<@D9@3AHaL<8c<8|#x<8<8D|3x=?9)D|3xH ! A  (2a ë!  (2=r>HΩ! Ӊ;acx<8E8P8PH y8a<8Eh8P8PH y?;E8! !<@8D9@PAH;L<8c<8<8|fx<8E=9@ix|jxH с!  =?i=_J$a  <A蓡88<@8D8HL<8c<8<8<|fx<8E|hx=?9)F|jxH E!!zHer$!  <A쓡88<@8D87HL<8c<8<8<|fx<8F|hx=?9)F4|jxH r$!  <?A cx<8Fl8P8PH x%8a<8F8P8PH x 8! !<@:D9@PAHL<8c<8<8<|fx<8G =9@ix|jxH <@ ! $ 8!<@D9@3AHL<8c<8<8<|fx<8G(|hx=?9)GD|jxH =? Ġ! ( cx<8Gx8P8PH w)8a<8G8P8PH w8! (!<@D9@PAHL<8c<8<8<|fx<8H=9@ix|jxH ! ( $ $P$P$ a $ Hʁ ` =? LAA`PA *HQA?`C0=K:=?9)ذ!=_9JȑAla(a !  zPA  Hɕ H rӡ<88<9!!@D8a~$x~x  99!9AK:}{x~dx}kx88~ȳxH!}sx~Dxx88 ~ȳxH!a, @9`!9)|H@}=Kx a,@8` !9)|H@}$Kx=?| P5@@| P5 @|fx|yAH|P}h[x|+yA,8|}(U):}) *95J@84@āA}TPPUJ:}kP9k}# P9)}kImkaaɡ(hh$ ȁ!})ր|JT:|.(a ,}].H9A !I<8cذH p<8c88H TaH lE8a<8H488H s}9A!I9ai <8cH p<8c88H TH k8a<8H8P8PH s-8p8|PT:! ,|J<@9@PADAHAL<8c<8<8<|fx8 =9@9!|jxH !9)!7@:A !}iQA,A ,|HPT:| .P| .9)5k@!=?9)!8!<`| A$=)9)><8c; 8!H mH|8X88*<8/@<8c;D<8<8;p<8ƶ,<8X9X9!`9AhH8ap8txHb9!`` h(cnx h(k.hl(h.np,@\Ax<`@$8=?)(AHí !xA<`@$8=?)(AHÁ !t,@T@<`@$8=?)(AHI@<`@$8=?)(AH!6|HA xdx~x8x8|xHxdx~x88xH|PTP!T9)4A8|H@}%Kx|x}@(QA8899i}+}(JU):}) LA@HL@@<,A| }(})Hy9k}k}(})Z95JA KCx~x~Ex8x8xHCx~x~Ex88xHPTP!T9)4A8|H@}&Kx| x}`0QA888}'ց})BU):}) LA@HL@@<,A|}(})H8 |ց6})})9J5k@8!|N |!B|~x|#xH =|@x,AP8a@xH<8cxH<8c|dx<8Jx8,HM8a@xHH <8c<8Jx8,H Rh8!`|N |!B|~x|#xH |@x,AP8a@xH<8cxHe<8c`|dx<8Bx8)HM8a@xH9H <8c`<8Bx8)H QMh8!`|N |!B|~x|#xH ̀|@x,AP8a@xH1<8cDxH<8c|dx<8%x80HLe8a@xHH <8c<8%x80H Ph8!`|N |!Đ!PB}Cx}VSx!Aa!!8~x<88}Cx|#x}GSx|#x=?9)` xH=?)S؃8`7A=?S;IS;ZiS;{ =?S;,8@D!<)H !*=?X(nH!@=?iHX$=? `(cnL!DX$ `(cnP=? dT!L)H =? !2(nX8,x=? |<BȐ=? 81| P| x9)!0| P| x9)!|IT:`8a`8pexH B;<`| @4;;!t?; ?;ޮL9?_;Z4:a ::>!8!Kx = a)|H@8,A 8><`| A$=)9)><8c,p8"H _H<})9)m)!<C0=?ɩh(=?r<@9`a8,=? <BȐ=? БaԑaT:8a8xH ;a88<@=?9)!DAH!L!P8ĐT8ȐX8̐\8А`!d8Ԑh8ؐl!p!t8ܐx8|!!88888a<K`}%Kx<8Ʀ|3xx*xH}̀,@<8c,x8,H P8axH 8Y(8! |N ||@&H 彡$A!p! A Ă ȂA ЁA  a   ! ia = a)|H@,@ ,A 8HЀ,A 8H,@'|HA| @ 8H,@(|HA| @ 8Hd $, @ | @ 8H@=? p 8L@A$A <p L@@ 8 +<`| A$=)9)+<8c*|8H [H ! ! m(*(h$  | @| x (! h$  |@|x*h$ ! 9)|H@}5KxA *a h$ ! 9)|H@}=Kx=? h<h$ ! 9)E|H@}:Kx =? hQA<F<=?餐}Po =@C0A  (x(a k82}kx}{yA~p}>C0<ƫ<=?I=_*p=? 8a ~ Y|A|A A@8o  ((@k8LA@L@@ ! a A H)@ր*p$ ! ;i |@|x }=2}) ,AWi:9A@})R9`iHl HM((-$*$H ! 9 @ ! 8|;x $|H@} Kx} Cx}hQA<`C0<F<=?i9;|8 |1|T: |2 || @@$m@ a  P(H(H,| 8@,8 l a  P(($H$ X(b}*"U):}) h: }*2U):}) * 9J5k@`Wk:8@}k"+9)+;7@;79@$! ;`4A8@Wi:})" ,AA j9@5kA8! |I=?p}Wi:8@|8=?i}*:U):}) `@ }*BU):}) h$ H}*BU):})i9J5k@;{4@L8A a ;`7A;@<d?@C0<˦<=?Ép; >?W`:}  ,A< , @0a K, @l9;})U :}`|.h*h*$})RU):}) h*h*$<@(8 l HD9;})U :}. f})ZU):}) =?@(9kmka A  ($=_jpX d9@5kA8 }1 X8<@DHLPT8X9!!\`dhlApAtAx!|pa!<8c0;|ex|fx|gxx=?9)xHl,@<8c$x8+H ?7{@88ap$xH '- !X $A\ (aP ,!T 0A` 4ad =?9);}#KxH J<8c88H .=H F!x$x8PH ?!=?9)0}#KxH Ju<8c88H .H Ex$x8PH >!8 ,A08`=?);|).A< !$Hu=?ɗ0A0*;`79Ax=? ;8`XWi:});7A@ha<}<U):}))\!$H !$*;7@;{79@!x=`C0=_Ɋm lahh`($=_ 0 @, @>-$9@| HPllh`(!$HT=? 0 @hx,@H9@| Pll<C0h!h= !( -$H !h)H$=? Ah H8ah 8!|ˡN |H y]t!aX`|3x|;x}Cx}-Kx|a= a)|H@8,A 80<`| A$=)9)0<8cd8!H IH\P H He!x H r HA@:!`;6A =?5@8`~W:}=j)!aH ra2x*rz;7A=?I5@;Z<8hi5@;{T>|T:}=)\!(}=\(2hx2>`z r2~!hzH !(r@ }=\;7@;6@8!`;4A=?5@`}9@W :}): ;4AHxh=?`}+U):})B \h@!9)!H9J;4@W :}):I;4@!X ,AD=?9);@}#KxH E<8c88H )5H Ax~x8PH :8!@tH v|H vm!!@!!$É ;=?)2l:6Ax`2>?>`bsQ2H8`~8`>@C0=?I12H})V:}+J :$}k;`7Ap=? *Uhh(=?é;W:}=)\!*H <r!!rW:9)\$|M.;{7@V:}) P=?4A ;W:9)|L.*4@V:}) lDA@@($ P4A$;W:9)|L.h(|M.4@:6@8! 8!!H t|ۡ!PB|+xԐ}&Kx!= a)|H@Ԁ,A 89<`| A=)9)9H=?)0 Ԁ a 8w;`5kA0=?0dWi:}):)|J;{5k@,A8<8c$x8(H 71<`Կ<8c8H CH`79)!4P! Ta X\! `=? |=? =? =? !`|  |!| ! |  !@| ;`4A@99@=?Wi:}iB}): K`ѫ;{4@8, =? <BȐ=? 8,A 8H80T:8a8%xH i;`;?;;99 ?;9:!:?_;Z:aP:A$:(:,>8<@DHLP8 T8X9\9!!`dhlp79)!t!x|AaA!8a00<8|+x|+xx=?9)xHaY$,@<8c$x8+H 4m7{@$8a$xH PTX! \A `a ;`4A,9AWi:}i:})R ;{4@=?9);}#KxH ?5<8c8(8H "H :x$x8PH 3=?9),}#KxH ><8c8,8H "H :ix$x8PH 3iԀ,A(8`=?)0d|).!$H<Nj7;`79Ax=? 0d8`XWi:});7A@h}<U):}))\!$H !$*;7@;{79@!=`C0<ɇm a`($,= @A4| P@ $| HPl!!`( $HP,=_ @da4|X@@| Pl<C0!<!(-$H 'H$=? `H8! 8!|ˡN |!B|~x|#xH i|@x,AP8a@xH^]<8cpxH^<8c|dx<8¤x8/H!8a@xH^H <8c<8¤x8/H %h8!`|N |H m9|!ax|#x|;x}Cx!AA!ăԃa}kx}kx!$ = a)|H@D,@$,@! ,A 8HHa ,@,A8$H!x (@8A$ Ha ,A8$HxA*|HA 8 HṔ$} HP9)|H@8&!$ H$A 2|H@8&a$ $$<`| A$=)9)$<8c 8H ;H<́$HP;Ё'} HP9)|H@}4Kx! |l<C0=_ɪdh( 89 9@!A!A84A,:!})9ix|@| x5JA8 }|88`!})8}'BU):}),Aa}'Z})2 ,@ @$a9k}kց!})})ZHLa9k}kց!})})Zi!9)!`h*2h*!9)!5J@8!9)!4@a| @= C0<Ɇdm`!`(ɡ$2ɡo<8 l!!!`( $H`z|@:H:,@=?D=C0<˧dHd9 !4A8x|@|x5A8xA}jZ9k}kց9} J})ZU):})9J}J|} R ,@< @4`h(2h(!9)!!9)!5@l!9)!4@4A !| @dm ɡ(h$2<8 l!!(-$H`zH:(l( <$HAh,@̀@84A8x|@|x5At8xA}jZ9k}kց9} J})ZU):})9J}J|} R ,@ @!9)!5@!9)!4@`x|@|x84A08888`!U)8})!U)8})!U):})~x|@|xa5Aa9k}kցA}*})Z ,@|UK:}k+9)+a}k9k}kց9A}*J})ZU):})UJ8}J`ɪh* !U)8}) 2ɩh* !9)!5@T!9)!4@9 9@!A!A8x|@|x85A\AUI:}))|JUK8}+ɩh*}kɫh*9JA5@!| @=`C0<ɇdm a`(ɡ$2ɡo<=_ | LA@D8 l!!`(-$Hz|@H<8cȔH _-H ])<8cȨH _<8cp88H q<8cp88H ]<8cp88H I<8cp88H 5H \H8 H D:28 P7At9<|y!}iZ8U):})!U)8})!U)8})9 !5Ap/A|R888`!})9i9K}*}'JU):})A8,A}*}%J ,@l LAA|HX,A9+})}%J ,@4 @$a9k}kց!})})ZiH @$a9k}kց!})})ZHpa9k}kց!})})ZaUk:}k+9)+!U)8})`ɩh* !U)8}) 2ɩh* !9)!5@!} HP5)A9 }(Kx}IQATU :}))|JU 8}+ɩh*}kɫh*95J@!a | @=`C0<Ʉdm a`(ɡ$2ɡo<LA@D8 l!!`( $Hz|@Ht<8cȼH [H Y<8cH [<8cp88H <8cp88H <8cp88H <8cp88H H YI:H:!9)!7@!؀ !܁)~`HQA!} HP:)99)̀| P!7AL8~>:~x=C0<d<DŽ=?˩9a})XP9 }(}) ,@A8 || T:} |. @  @| | T:}  @ @|. @|  @p8 || T:}` @P @D|. @8  @,888|99`}1:9)})}DJ}*B ,@895k@84@! |A9aKC0=_˪k=kd9 f<=?9) !́Ё(X)|K|I|P}`}=ZU):}) @؁(T }=})})P8 } ZU):}) @9^}*} JU):}) @ (h*(T }=})})P9)}J}IRUJ:}JhXk|[|Y|P|}}Uk:}k})U):}) h(h*ā(@ l ɡ(hr!9)!(@ l,(ɡ((hr0!49)!AA8aa<@DH!!LA (|I֐@9a@aP (|I֐D8DT9X9!!\9AA`9aad!h~xl~x}{x~Gx|!}sxHl\XɡX(haЁ+@ ld``($+@ TC0=?˩`=_jY=9k[La=94́AЁ*X)|K|I|P||T:}  @ @9~}+};JU):}) @d`(h*}k}{ZUk:}k*X }>})})P})};JU):}) h(h*ā*@ l ɡ(hr!9)!*@ l,(ɡ((hr0!49)!!!8AAC0=˨Ú=?iO$=_9JP|A=9k|áЁ(T }>})})P8 9\}*} JU):}) @8}g} ZU):}) @}>ZU):}) @ph(`*(T }>})})P9)}J}IRUJ:}J|}~Uk:}k})U):}) h(h*ā(@ l ɡ(hr!9)!(@ l,(ɡ((hr0!49)!8!!JU):}) }k}~ZUk:}k 9r}+}7JU):})a (n($}k}wZUk:}kh($~X*a`*сxx:H`:`:9r}+}7JU):})n(h:ѡ}k}wZUk:}kh:;59)=`C0=ɈUm)!a`( Ala`( At.9)m)!a`( AH!| lܑa`( A A |Paā+|H@|;:x:9|| T:} }{.A h@D h@8(| T:} }. (X*|.*H(aȀ |A<8cd$x8BH :59)=`C0=ɈUm)!a`( LA@la`( L@@t.9)m)!a`( LA@D!| la`( L@@AȀ |A:,AdЁhA*| K|I| @D8a̐ <8c|H )<8cN؀8H ߵH 8a$x8PH ,@|8!PH -@|H ,齡!8h|px|#x|+x|3x|;x|!Aaaԃ؃!܃x9<`| @$,@,! ,@,@ ,A 8HȀ,@4A ,@$a ,@! ,A 8He, @'| A | H@ 8HXf, @ A|*| A | H@ 8H(! ,@a ,A 89<`| A88 N <8c8H uH<8c$x8BH H;;::`((W:|.*W@:|.*: :69)=`C0=_ɊK m)!ܑa`( LA@la`( L@@/9)m)!a`( LA@T!| la`( L@@(AĀ |AaȀ |A:,A=?ÉE>C0=?˩K =_jDd=9kEa=?9)ԑ!9}}+}})p})U):}iP9k lTAPɡP(h}I}i.mka\AXX(2ѡd;9)!`8U):})d }>U):})h ;7@$8!|AN |H t!|yx|#x|3x|;x}Cx}>Kx}USxa,A04!@)<`| A<8cX8H iHP H@m  H@] H? H?@ H@5` H@% H? H?}!( H? H? H?M H?A`?C0=?8lD@!@!( !2!lLHH(r2!zlTPP(r zlTɡP(h2lLH(222lD@(2or!hzH> !8)lTPɡP(h2lLHH(2r:lD@@(2m!< 8!tH  |H $!|txl|+xtx|!AA!ԂaA$(a,0 <@DH= a)|H@Ā ,@,A 8H|,A 8Hh!i, @ !) | A | H@ 8H4!i, @ A*| A | H@ 87<`| A$=)9)7<8c8!H H 8x|*=? /\2=?)6H< r*$!P HU):9)!! T:T:8a8~xH T:8a8 ~xH 8a8~xH q8a8~xH a7<`| @ @a(;5kA0TW:}=RU):}) |.;5k@<8c~x8CH %<8c~x8GH 8a 8$~xH  l' }@HP9JAL}6Kx=? 0d8at+|x}HQA<8/P=aT= Na)!X=_9JsA\=6<04|A(t(}6HP9)A ,|H@!,a,9@5kA0U@:}*U):}): |.9J5k@؁!i9kA*9)}kI֑aaa8<@! !DAAHaPaLaP8(T8,X9\9!!`AAdh lptx<8c/|#x|;x!9AH ug9k(9)}kI֑a!!8AAKx}PSxa`tx!d‹+K =?! h( k. h(k.  H/]` H.!l ,A; :@H# "@!H)|xHQAP>`C0=?i'=? !o@Da@@(((0|xHQA>C0=?I'=?©!=?$}:9)ioD@@(((o:2$j $( .L@@`W: $H8aH<8 ~xHhL8aL<8 ~xHh zH}>})U):}) ;7@4;Z7@8!p 8!@H |B||3x|;x}Cx}'Kx}[Sxd|3x!TI!PI;@=?;|x|@HQA?C0=?)%=? 9g9k}k!}%})Z ,@LlēH(@( (*`ȁ!9i8k, @|A'9)}!}+})b ,@}#})b ,@9k8c'9)})1}+JU):})l`ēɡH(h`(i'9)})1}#JU):})m`ԓH( (2g9k}+1}%JU):}) h(}kQ}eZUk:}k ;Z*H '9)})Q}%JU):}) 84B@to@<C0=?ɩ%h($;|x}HQA?C0=?i%=?)܁g9k}k!}%})Z ,@lԓX(H( ((`ȁ!9i8k, @D|A8'9)|!}+})2 ,@}#})2 ,A '9)})Q}%JU):})ѩ85@88!` N |H 8!!pa©i 8`=?)|).=?)( !$H*1=? 8LABA(A=? <L@BA=?8h*A=? 8LABA(A=? <L@BA=?8h(AP H)m` H( H)Q r H( !r;@=?)(:6A>:@bR\*@r08`~0})V:}=J)!*/$!@a@DH( !*!@a@DH(I rr18R2;7A=? ;<h);9T=?i(;{=?;Z|T :}+\패(}+ \(2k82:,AL}+)\!$H(1$W]:;>9r:=zH( x.H0W]:;>9r:=zH' !(!|3.;7@D:6@8! 8! 8H h|H !L!pAa   =?)< :4A,9@V8}kBV:})R  :4@8`?<=?)|).!$H& P H&` H&! H&!r H& Ar;@:6AT:!@*`r=?I8`~V8}))!aH%rr28S2V:});7A=? ;<h);9T=?i<;{;Z|T :}+\(}+ \(2k82:,AL}+)\!$H%$W]:;>9r:=zH%x.H,W]:;>9r:=zH%y!( |3.;7@H:6@8! 8!!LH |!`B|+x|3x|;x}Cx}9KxAAa aa$ = a)|H@h,@ ,A 8H$,@! ,A 8 +<`| A$=)9)+<8cP8"H H8! 6}`HP9k;=?= [ |p||  |@|x|p||XQA8| x}@QAL<8[UI:})2 UI8}i*ɫh*}) !*9J5@ā! |@=?9)[=`C0=_ɊoDa@ɡ@`( h$ 2<= LA@0?;[ 8lDa@!@!`(-$H#=?;[ ?C0=oD@!@!( H" ɽ$! |lD@@(r;83})|H@}$Kx8| P1| @| x}%Kx| QA!܃6}<(P8r| @x8| P7| @| x}*Kx} XQA`8|8|`}&PP9i}+}): ,@$;}*U):})h*9J5@84@\! 2oD<C0@@=ɨh(=?)[ ?r!`zH!E ! )=? [h<=$@ @3})|H@}(Kx8| P|@|x|3x}@QA<`C0=?ȩ=_D6|lDa@@((@ (r| @|#x8| P7| @| x}*Kx}iXQAt<`| A$=)9) ><8cX8H AH8=?9)L!8=?9)L!<@8 D9 P!H8LP!T<8c<8t<8<8O6|gx=9|+x9AH I<8cL<88P8PH ,@`8<`| A$=)9) ><8c8H IH%<88F8FH 8a <88F8FH 8a <8(8F8FH 8a <8p8F8FH }8a V<88F8FH e8a <88F8FH M8a <8H8F8FH 58a (<88F8FH 8a n<88F8FH 8a <8 8F8FH 8a <8h8F8FH 8a@<88F8FH 8a<88F8FH 8a<88F8FH 8a<8@8F8FH u8aX<88F8FH ]8a<88F8FH E8a<88F8FH -8a*<88F8FH 8ap<8`8F8FH 808<@PD8FHALxdx<8(|3xx=?9),=_9JTHYEa0,@;}kxxxFx8PH /A;`x8Px8PH 1U;xx8P8PH Qa48dx<88P8PH e,@P}kxDxH M;;}kxDxH 5|Px<888H ,@h?;R}kxDxH 8c} 84<8cRH Y4,A}kxDxH 8}kx}kxExH }H}kxDxH |fx8a}kx8H Y?;S; }kxDxH u|}x|xx!;a=?:8|xȒcx88<88H |; 84<8cSH 牀4,@h8a8H /,AT8a8H /u,A@8a8H /a,A,}kx80xFxH0,@ 8d4,A<+8cp<8H܀d,@D8a<8L8P8PH ],A$8a<88P8PH =,@<+8cp<8H|8a<8<8P8PH ,@<+8cp<8HH;x<88P8PH ,A@x<8,8P8PH ,A x<8|8P8PH ,Ax<88P8PH q,Ax<88P8PH Q,A8a<8l8P8PH 1,@<+8cp<8Hp8a<8 8P8PH ,@<+8cp<8\H<8a<88P8PH ,@L}kx80xFxHϭ0,@<+8cp<8H<+8cp<8LH8a<88P8PH a,A\8a<88P8PH A,@<+8cp<8b>b,AhaD<8cT<8p<8d<8xH9!8<8c,|dx<8d<88D=9KHx9@&H};;8!<`| A$=)9) ><8c\8H QH`8ax8PH>=`ak| XA<`| @,~H$?<8c|88x8 H <8c88x8H 8a<h@lDpHtLxP|TX\8`8dhl8p8tx|8P8x8<8Fx'x~x~ɳx~xH88!0|N |! Ba|#x|3x !A a$(A,!048a<HPX!\`Adh= a)|H@P,A 8H! ,A 8=<`| A$=)9) =<8c|8H H 8!T x<8x8H ,@a8Ab?@cZ,Ad<8c<8<8,<8(gxHj!8<8c|dx<8L<88P=9$ ix9@HI;;x<8h8P8PH zyx<8h8P8PH zaa8!<@<8c8P<8$ 8T8Xx9!\9A`HG̀X,@ ;H@X,A0X,A$x<8h8P8PH y,@;;Hx<88P8PH x,@(<8c8P<8%fx8PH[H4x<88P8PH x,@ <8cdxH;;H,x<8X8P8PH xq,@ ;|A;,@8!|N |!B||x|#x@|3x|;x}Cx}>Kx}]Sx = a)|H@,A$<`!<8c,8"H vH 4}DSxH ,@xxxH j!<8c@<8P<8<8'8x9 9@H ,A<8cTx8.H cx<8'X8H w<8cx8"H i:@8HX<8c8`x8H exH ә,@xH ju:@H8a`x8H iI!9)!9 ,@,A9 , @<8c(H ;@A;x<888H w);`x<888H w ;acx<88P8PH v8a<8 8P8PH v8a`<8\8P8PH v8<@8D8PH8L8PT<8c@<8<8fx|gx=9|+x9AH 1=?9)!8?;(<@8D82H8L<8c@<8h<8h|fx<8|hx=?9)|jxH xA7A0<8c8`x8H u!9)!7@?;8=?9)(!<@8D8?H;`aL<8c@<8h<8H|fx<8L|hx=?9)l|jxH w=?8 (;x<88P8PH u!8a<88P8PH u 8a`<8L8P8PH t8!@!<@8D8PHaL<8c@<8h%x|fx<8焜=9x|jxH wM!@ ,@  =?(87A??;9(:;`9?_;Z:a ;:@O:[x: P:5<8c(H qI<8c@88H TH l~óxx8PH e!U):}) A8!U):}3J9)!<@DAHL<8c@<8h<8h|fx<8焴|hx=?9)|jxH v=!, @4U):})9I i 9k) 9)| X@}i[x*H(!U):})9i 4A8 a8!U):}5J9)!<@DHL<8c@|dx<8h|fx<8$|hx=?9)D|jxH u!9)!7@8:@=?)(9)!=?9)(!=_9J(A=9k(aH8a`<8|88H r]<8c8`x8H xH %,@:@xH d8a`8H Q,@,!9)!A*9a`|iZ<8h888x!)9@H с!9@A7A;a`>:(;9 ;9>:(=C0=4>:):a P>:)!U):})) | @<8c(H`!U):})i ,@c|nT:|8c88x8H ,@<8c(H n<8c@88H QT:|"<8c@88H QH iexx8PH be!U):}) H,T :})l( !U):})) | @\<8c)H me<8c@88H PT:|"<8c@88H PH hxx8PH;!!U):;A`})i c|yT:|8c88x8H 1,@<8c)H l<8c@88H PIT:|"<8c@88H P)H h xx8PH a <8c|x8H `!U):})i c|y8cx8H `с!U):}) !9)!7@x!9)!9`,@(! A@*|J!| A9`, @8a@ !| @H+=?9))4;}#KxH k<8c@88H O-H gxx8PH `(8! |N |B!$|#x|+x|3x8I(@ 8H0, A ,@</@$, A ,@</A 8H, @=8HH,@ =?8IbBaBA@H / 8rA, @ 8w@8@H|cyA,A /@,<9Xh?g<H<,A ,@,=_8*Xd9<<_i8H8h8!`N }H!A|+x!BD|3x|;x}Cx|}>KxA0<f|@<,A=?x V8Hč/|{x@$=8l|HU9`8zHАz8|(A?_dx8zH8,@4Wy~9)U<9}[}]񮛛BHh/@`Wb9|IU:9|g|𮈣|BH ?8~HÅ8H8h8!`!}N |HA|3x!B|;x}Cx}<HԀcx8H,@<8H|| @ >H 9`~/@4Tl~9}U<9:خٮ8BHT,@LT}9U:9|Cخ|ٮ^BH 8ah8!`hN |HBA=!|#x|+xh|3x|@<,A|<SxH8,A8xH/@ 9 =xHɁ\8c|P@<8@|]8c||XAH =8lH8H8X8!PN }HaA|+x!BD|dx}Cx|;x|}/ A$=KPbH9H 8X8!PN |AȐ!`B|xx|#x|+x|3x|;x}Cx}7Kx}\Sx= a)|HA$<8cs08H cH8H ;@:@ :? c9:`,AP8A<@DH<8c<8sP|ex<8s\|gx=9sp=?9)pjxH g-xH |AxcxxexxxxH э,@Pcx~xx~Ƴxxx~xHY,A(,A <8csx8)H VH ~;@,@8!|AN |А!pB|zx|#x|+x|3x|;x}Cx}7Kx= a)|HA<8cr(8H bHP}CxH },A <8cr(8H a<`AH8@X;Cx$xH }|}xHL;X[xaPT8a@8P8H<8Ʃ8H -~óx<8rH~x8H ba8,A~óx<8rL~x8H b=8,Al~óx<8rT~x8 H b8,AH~óx<8r`~x8 H a8,A$<8cr(8H `<`1H \8a@8\~x~x8KA8!|N |ۡĐ!B|yx|#x|+x|3x}Cx}7Kx}XSxH= a)|H@X,A 8H (, @| @ 8><`| A$=)9) ><8cp8H _H;9)m)!<C0ɡ=? (h:<8cpx8H S<8c<8p<8<88x9 9@PH ,@<8cH i,@0xLH {)|ex<8cxH A,@H 5<8cH ),@H <8c0H ,@=?ér=?ɨ|$<8c88H A=,@\r$<8c88H A,@0r$<8c88H @,@H u;H <8cDH a,@`;; =?騼}<U):}) h$<8c88H @},@;7@H <8cXH ,@;; =?é=?ɧ=?}<U):}) rLA@*H(Đ<8c88H ?,@;7@H U; |P9 , A9 , @Ȁ|@;8 9@9@9`W:})BI,i;4@|P;4A9@=?i=?I=?W:}JB}|Uk:}+ h$ ,9J}k PLA@`*!H`(!*;4@<8clH A,@D;; ;pW:|"<8c88H >y,@;7@H <8cH ,@D;; ;@W:|"<8c88H >%,@;7@H <8cH ,@H <8cH ,@H u<8cH Հ8!|ˡN |AȐ!B|kx|#x|+x|3x|;x}Cx}*Kx= a)|H@8,A 8=<`| A$=)9) =<8ckx8H ZH<8cX<8k}e[xfx8x9 K,A<8ckx8#H MH|:8a@<8k88H [:A>:slH8a<8<ex8@8K,@xH N:H؁<9)<8a@<8d888@x9 9@H m,A<8clx8%H;@T:|x88x8H ,@Px~yx!A;:&~Cx88<8Ƣ8DH ~Cxx8DH L9`5|H@,@9`, @8adxKI8X8!P|AN |AȐ!B|ux|+x|3x|;x}Cx}>KxHx = a)|HA<8cj8!H XqH8A8<<88899!xH,Ad,a@X=?9)   }#KxH 1;<8cx8H H 8 ||0P8a888H Yy8a8H 8||0P8a888H YI8a8H 汐a8|0P8a888"H Y8a8H }aĀ|A$|A8AH8=?9) ;P}#KxH U<8c88H 9m<8c88H 9YH Q=xx8PH J=A|@x!|H@} Kx;!;i:7Aԃ;7A??;9 :P8|~;,@<y<8c H e<8c88H H Q;;{|A(}4 O|w8c888H W;7@:7A$KP,A 8H88!|AN |AȐ!B|ux|#x|+x|3x|;x}Cx}8Kx}ZSxa8<= a)|HA<8cg8!H U9H9 !@8!<<88899!xH,A,a@=?9)   }#KxH ;<8cx8H H ݀8 ||0P8a888H V=8a8H 㥀8||0P8a888H V 8a8H ua8|0P8a888"H U8a8H Aa<|HA(|A8H8=?9) ;P}#KxH R<8c88H 6)<8c88H 6H Mxx8PH F|@|x!|H@} Kx9@!;Z:7ZA;7A?;{ 48 :P9J, @<8c 4H <8c88H H ,AD99@8PU :}):iL O LiOiN M NiM95J@9@;|A }>U):})UK:}k L ;7@@:7ZA$K ,A 8H88!|AN |!B|~x|+x|3x|;x= a)|HA<8cd<8"H QH8X8<<8 8P8T9X9!\HMP,AxT,i@l=?9) X }#KxH <8c 8P8H 1H u8a`8P\|88H R8a`8H E|H P,A 8H88!|N |!pB|qx|+x|3x|;x}Cx}9Kx}OSxȂ= a)|HA<8cc48"H PH9 !(̐8!<<88 8$9(9!,~ʳxH ,A$,a@=?9) ( }#KxH A;<8cx8H H ),8 ||0P8a0888H Q8a08H ,8||0P8a0888H QY8a08H a8,8|0P8a0888"H Q%8a08H ލa<>8|HA(|A88::a 8:P;,@d;;{,@<W<8cH Q<8c8 8H H =;`;ZWc:|s8c8~ųxH р|A}>z})W:}k O ;7@h:R79A$K0 ,A 8H88!|N |AȐ!B|ux|#x|+x|3x|;x}Cx}8Kx}ZSxa8<= a)|HA<8c_8!H MH9 !@8!<<8x8899!xH~,A,a@=?9)x  }#KxH ;<8cxx8H uH 8 ||0P8a888H N8a8H ہ8||0P8a888H M8a8H Qa8|0P8a888"H M8a8H a<|HA(|A8H8=?9);P}#KxH Jy<8cx88H .<8cx88H -H Exx8PH >Հ|@|x!|H@} Kx9@!;Z:7ZA;7A?;{8 :P9J, @<8cH <8c88H H ,AD99@8PU :}):iL O LiOiN M NiM95J@9@;|A }>U):})UK:}k L ;7@@:7ZA$K ,A 8H88!|AN |!B|~x|+x|3x|;x= a)|HA<8c\8H IH8X8<<88P8T9X9!\H{)P,A|T,r@p=?9)( X }#KxH e<8c8P8H H Q8a`8P\|88H J8a`8H ! <H P,A 8H88!|N |A!pB|~x|+x|3x|;x}<`| A$=)9) ><8cY8H FEH<8c<8Y<8!~'xx9 A"(H ,A,<8cYx8.H 9eHxH :mqH?;Z$8?;X<@;@AD89H;`aL<8c|dx<8|fx<8Z<|hx=?9)ZL|jxH Iݓ8?;\<@AD84HaL<8c|dx<8|fx<8Z|hx=?9)Z|jxH I<| A0|H@<8cZx8CH 8]<8c[x8"H 8I;8!8HX<8c8`x8 H xH A,@xH 9;H8a`x8 H 7!!89)!!89 ,@!8,A9 , @<8c`H Q=?9)[4!8?;T<@8D82H8L<8c<8<8|fx<8[P|hx=?9)[l|jxH H=><`| @8!87A0<8c8`x8 H !!89)!!87@=?)X=k\})Y֑!!@8!0;`=?)T!!8}n[x| @|x9!D5AL=?9)X!!Ha!Hk:6sA!D9!L}(y֑!!P=9k\a!T<`!X=baMӑ!\=?9)|!!`==ȏ 9 !!,8,@t?*;\;9 x>_:R[!0|@8a`<8[8 8 H D<8c8`x8 H Э;`!!89)!!8xH ,AD8a`8 H ^ ,@08a`<88!,8!0<*8\x9 9@H |}8!,8!4x8H !,,@~~Ux!!;:$!! }kx8!8!<8Ǝ@8BH i)}kxx8BH 4<8chH l<8c8!88H #H ji8a `x8PH 4;{!,,A|A !P}4U):" })B!4 !!L!!p}ip| P| @8 `a!` <8c|H ?y<8c8!<8H #!r|=.;7@!84AAj;5kA8|=,9(=zd=?z}>:U):A})R9I `LA@h*PTHh(X\T:|. ;5k@84@da ,A|84AhF;5JAH8!}I|}~BUk:}kb}>U):})2 ;5J@84@!i;5kAP=@C0=ɬ0<zW:})boLAHHh(`( ;5k@̀F85JAP=`C0=?ɩ0=zT:})lLaHHh(`( 85J@~óxex~xH a<8t䀡8H !a<8t쀡8H !ɀa<8t8 H !8!pH P |!pB|rx|#x|+x|3xO}Cx}7Kx}QSxaOԂO܁OO䁡O胁OaOOOOAP= a)|H@L,A 8H,A 8><`| A$=)9) ><8ca8H !H =9k ,A$=?0 =?0 8 <8ca<88Ox8 H <8ca<8ּ8Ox8 H m<8ca<8ָ8Ox8 H <8ca8O<8֤8Ox99 H ,A,@=?8 ָ88<8"@8DH<8cf<8b|ex<8b|gx=9b8|ix~ʳxH "~óx~x~ųxx~x~xH q,@ 48O 88O$<=?9)ּ!@=?9)đ!DHaLPTAXP\!P!`P d~óx~x}{x}sx}kx=09=?09)9AO(HaeO$,@<8c֤<8bLH O$,@ <8c֤<8b`88H ?;bt8?0;<@;`aD89H8L<8cf|dx<8k|fx<8b|hx=?9)b|jxH 8?0;<@aD84H8L<8cf|dx<8k|fx<8b|hx=?9)b|jxH <| A8|H@<8ccx8CH u8O,=?9)ȑ!8=?9)֤!<@8 D8PH8)L8PT<8cf<8c`<8g0<8|gx=9cl|+x9AO,H ' <8c֤<8b`88H Q,A(<8c֤<8bL88H -,@?;c8=?9)ּ!<@8D8+H;L<8cf<8g|ex|fx<8c|hx=?9)c|jxH #q8=?9)đ!<@8 D83HL<8cf<8g|ex|fx<8c|hx=?9)c|jxH #H؀,A8O 88O$<=?9)ּ!@=?9)đ!DHaLPTAXP\!P!`P d~óx~x}{x}sx}kx=09=?09)9AO(H^ 88<#xx<08<08<8֤=9=?9)ּ=_9JָHX= a)|H@xH  8H= a)|HA8H<8ca<88Ox8 H <`| A, *@xH 88aO08O4KqO4,AH=?9)X;}#KxH <8cf8O48H UH 9xx8PH 9H4,@(Q9`5JAP=C0=?ɩm=?g4Ui:O})m`OOOh(`( 9k5J@́!Oȁi9@5kAP=C0=?ɩm=?g4UI:O})m@OOOh(`( 9J5k@~x~ijxEx~xH }{x<8dP8H }sx<8dP8H i}kx<8dP 8 H Q8!O O8!O|N |!B|#x|+x|3x|;x}Cx}2Kx}QSx!H!L!P!t!x= a)|H@L,A 8H,A 8<<`| A$=)9) <<8cVT8H H,@; :%::;?`c{:8<@DH<8cXx<8Vt|ex<8V|gx=9V|ixxH mxH m|A4xDxxxxxH ~̀,@,x<8V8 8 xx9 KH  ,A<8cVx8)H EH; ,A`K$x<8VEx8 xx9 K5,A,<8cH :<8cXxxxH H 8}HT8a 8 8 8 8 9 IxxHgIxH a  ,@=?9)Xx!8 4|H@} Kx 8 < 3|H@} Kx 8 @=?9)Xx!D!H8 L=?9)\!P8TXa\A`!dhl8a <8X|#x<8Xx|#x9 9! |3xHHH ,@=?9)Xx!8!< 4|H@} Kx 8 @ 3|H@} Kx 8 D=?9)Xx!H!L8 P=?9)[!T8X\a`Ad!hlp8a 8 <8X|+x<8Xx|+x9! 9A HB=HЀ ,@=?9)Xx!8!< 4|H@} Kx 8 @ 3|H@} Kx 8 D=?9)Xx!H!L8 P=?9)\!T8X\a`Ad!hlp8a 8 <8Xx<8X|+x|3x9! 9A HZŀ ,@X ! |Iց! |Iց! |J !8<`| A$=)9) ><8cP8H IH P,@88<8@8DH<8cQ<8P|ex<8P|gx=9Q|ix~jxH ~cxx~exx~x~xH xm,@ Ȁ= a)|H@<`8H = a)|HA 8H <8cR$<8Q~exx8x9 ~xKa,A,<8cQ x8IH<8cQlx8?H8a<8Vx88K8a<8Vx88K8̐,@=?9)Ü!8a<8V888K,@;`8a<8R088xx9 9@PH J,A`x88x8PH (e,A`8a88x8PH (A,AH8a88x8PH (,A0!9)!9a!i<8cÜH <8cQ88H 9<8cQ88H %<8cQ88H <8cQ88H H 8ax8PH8aP88x8PH 'q,A8a88x8PH 'M,A8a<8V888KH<8cQx81Hd,A(=9kÔ+9)+| @ 8 ,Al=?9)Q!8=?9)Ô!<@8D8-H8L<8cQ|dx8|fx<8Q|hx=?9)R|jxHr-Hh=?9)Q!8=?9)Ô!<@8D8-H8L<8cQ|dx8|fx<8Q|hx=?9)R|jxH M8a<8R$<8U,|#x|#x99!9A K==?Ô,AD8a<8V888K8a<8V888Ky7@;`8a<8R088xx9 9@PH Fx88x8PH %A8a88x8PH %)8a88x8PH %8aP88x8PH $8a88x8PH $;|HA!| @<8cRDx8CH=9kØ+9)+| @ 8 ,A(,A ,A<8cRx8/H,Al=?9)Q!8=?9)Ø!<@8 D8=H8L<8cQ|dx8|fx<8R|hx=?9)R|jxHoHh=?9)Q!8=?9)Ø!<@8 D8=H8L<8cQ|dx8|fx<8R|hx=?9)R|jxH 8axK;~cxxx~x8H x8H ,@L;x8H |wx8a|vxx88<8RP8H *}! | xH s|x| p} x| P|АT;ACx<8Sx8x99 K ,AP<8cSx8,H=?9)ô;}#KxH Cx8H |ex<8cQDxH =?)Ø9)!a؁!}+Iր|I֐T :9)!,@=?9)Q!8}i[x| @| x!8<܁9|H@} Kx8@=?9)Q!D!H8L=?9)U,!P8 TaX!\!`dAhl8a8<8R$|+x|+x99!=_9JQHT}H!8 (Ai !`| =?9)Q!8!<؁;|H@} Kx8@܁9|H@} Kx8D=?9)Q!H!L8P=?9)V!T8 Xa\!`!dhAlp8a88<8R$|3x|3x9!9AH48a8K,A=?9);}#KxH <8cQ88H uH Yxx8PHYH<8cS4H,<8cS`H <8cSx8%H(<8cSx8+H<8cSx8"H<8cTx8"H88axKHlq9@5kAL=C0=?ɩX=?RDUI:})zm@đh(`( 9J5k@Ёp9@5kAL=C0=?ɩX=?RDUI:})rm@đh(`( 9J5k@Ѐa88H Qa<8T(8H 9a<8T08H !a<8T48 H ,A;HVk>;;,A,, A~Z, @p|Z"Hd;9H@,@}p[x;HL,@H,@ , A0, A}9U` 6H}9U` 6})9)~H;9H,@a;H,@a;H,@a; H, @,@$!, @A, @ , Al, A0U` 6a~ZV 6!~JV 6A|R~HX!U 6A~RV 6A|R~U``&~:~H$;9;H<8cH<8H];@,@~}4rU):A})Rn=`C0a( :6@8 !|IT:A| .LA@*ȂH(Ђ9a5ka@<8cH !i:5kAP=@C0=?ɩK=?EV:})nđAh(`( :5k@́!i95kAP=@C0=?ɩK=?EU:})mđAh(`( 95k@̀a<88PH a<8HT8H a<8H\8H a<8H`8 H Ɂ! ,ADAA8<`| A$=)9) ><8c?88HH! | 8a<8?Xx8x9 A0K,A<8c?dx8#H1H= a)|H@8a84x4K8a88x 8K}8a8<x$:֪>:lv<8cH AɃ;7A0;`W<|"<8c788H =?i;L=?;PW<}): ,A0}=BU):})lh( H<}}BUk:}kW<}): lh(b ;5J@;{7Z@u;5kAL=@C0=?ɩ> =?7`W:})zoAh(`( ;5k@Ёp;`5kAL=@C0=?ɩ> =?7`Wi:})ro`Ah(`( ;{5k@Ѐa<88PH =a<8=؀8H %a<8=8H a<8=䀡8 H <8cH  ,A<`| A$=)9) ><8c88H!HP,@88<8"@8DH<8c1<88|ex<88|gx=99|ixxHxH GQ<`|AxdxxxxxH X-,@H 8,@<8axH r 8!|K=?9)t }#KxH $H8`,A$<8c90x8H܁8H4;<8c2<89P8xx9 9 PKx<89\8P8PH xH Ymxp} x| P|АT<8c2<898܀xx9!K<8c2<898܀|x9 !K}<8c2<898܀x9 !KU<8c2<898܀x9 !K-<8c2<898~Ƴxx9 Kـ,A=? 3T<8c2<898~xx9 K,A=? 3T<8c2<8988`x99 K,@ 8a`8~xx8H +UH=? 6p8<8 @<8c28<8:Fx'x9 x~xKY,@$<8c: x8H%8H$,@<8c:,x8+Ha8<8@<8c28<8:XFx<819 x9AK̀,A\x9@5kAL=C0=?ɩ8=?2 UI:})m@ԑh(`( 9J5k@ВA8<8@<8c28<8:`&x<819~x9AK),A\w9@5kAL=C0=?ɩ8=?2 UI:})m@ԑh(`( 9J5k@Ѐ,AXt8<8@<8c28<8:hFx'x9 x~xKy,@ 8<8cH Q88!0|!N |!pBa|#x}Cx!Aă= a)|H@P,A 8H! ,A 8<<`| A$=)9) <<8c4p8HHԁ! ,@;@;a::P;; ?ccx<848P8PH y8a<848P8PH a8<@D!H<8c+<850<8, fx|gx=95H|ix=_9JHy<8c+<85\<8+<8Ɵxx9 9@H Ì|A,A0<8c5`x8IHu<8c5x8?HaH;@,A<8c5x8CH=<8c60x8DH)<8c6tx8DH<8c6x8DH<8c6x8EH<8c7Dx8/HHX<8c+<85\<8+xx9 AH Hр,@ 8a888 xHY;`;;;<8cH a ,@,<8c+88H Ma ,@ H %a  ,Al ,A`8a<87t88H y,@ 0H<8a<8788H Q,@!08 |@ ;`;,@@ ,@T<8c7x8FHԑ! ,A ;x<878P8PH 8a<884H ؀ ,@T<8c8x8>H5! ,A x;x<878P8PH I8a<88H |,@T<8c9x8/H݁! ,A ;x<878P8PH 8a<89DH $<8cH a ,@,<8c+88H }a ,@ H Ua <8cH ya ,@,<8c+8H =a ,@ H a <8cH 9a ,@,<8c+8H a ,@ H Րa <8cH a ,@,<8c+88H a ,@ H a ,@ =?9)8 }#KxH H0=?9)8 }#KxH <8c+88H U<8c+8H A<8c+8H -H ;xx8PH =?9)(}#KxH a<8c+88H H xx8PH<8c@H сa+ | A!Ā a+|H@H<8c9x8AHх! ,A <8c+|dx<89x8!H! ,AD:aH|txВ=?:)9ؒ!8a88HH:`<8c8He|rxAa=?99=?9ɟ8a88<8, 8H 8a8x8H p݁a+|Iցaā+|Iց!|I|p|=9k!} HP8, A8 ! ,@;x<8:8P8PH a8a<8:P8P8PH I8a@<8:8P8PH 18a<8:8P8PH 8a<8;@8P8PH 8a0<8;8P8PH 8a<8;8P8PH =?9)<0!8=?9)!<@8D8PH8L<8c+<8+|ex|fx<8x8/HY=?9)p;}#KxH ש<8c+8 8H 5H xx8PH! ,A\x<8>D8P8PH 18a<8>8P8PH <8c, |dxxHd,@! (aĀ ,=?), A@=?)U)<9)!$} Kx!(|I֐$!,|I֐$| x9)H<=?)U)<9)!$} Kx!(|I֐$!,|I֐$| x9)!$=?9)+!8(-|H@} Kx8<,a+|H@} Kx8@=?9)+!D!H=?9)/ȑ!L8$P=?9)/đ!T8АX\`!!daah!đ!laБapt<8c+<8<8<8+|3x9(9!,=_9J+H kaH؀, @T!đ!8aБa<@<8c+<8<8<8Ơ<8砌}kx!AH31H|<8c>x87Hɹ! ,A;x<878P8PH 8a<8?8P8PH ׵<8c, |dxxx8PH3H!i9@5kAP=C0=?ɩ2=?,UI:})m@h(`( 9J5k@́!āi9@5kAP=C0=?ɩ2=?,UI:})m@h(`( 9J5k@́! ,A axH ?Ha<88H ֑a<8?l8H ya<8?t8H aa<8?x8 H I<8cH ! ,A@aa8Ԑ<@}kx}d[x<8+|3x!}kxHy=8!|N |!B|#x|+x|;x}Cx}/Kx}MSxaAD~Nx= a)|H@L,A 8H,A 8><`| A$=)9) ><8c.8!HqH,@;;; ;`?c:8<`| A$=)9) ><8c($8HH;;; /;@;`P?c8<`| @8a8xH98a~x~ųx~x~x9!H)8a8xH 8a8Kd,AD=?9) ;`}#KxH 9<8c88H H éxx8PH=?9)8;`}#KxH h(<8c88H uH Yxx8PHY=?9)P}#KxH ǭh(<8c88H )H xx8PH ~x~ijx~x~x~xxHy8axHeu9@5kAL=C0=?ɩ=?UI:})m@đh(`( 9J5k@Ёt9@5kAL=C0=?ɩ=?UI:})m@đh(`( 9J5k@Ѐal<8Ѐ8PH Yap<8(Ȁ8H Aat<8(Ѐ8H )ax<8(Ԁ8 H ,A<8h<@~x~ijx~x<8|3x~x~x~xHl88!0|N |B||+x|;x}Cxx8`4A\85JA8|@}=C0=?ɩ}$U)<})*i, A}$bU):}):m`H}$bU):}):< lh( 85J@8c4@lN |!`B|tx|#x |;x}Cx! }PSx! ؂! ܁   ܀= a)|H@L,A 8H,A 8><`| A$=)9) ><8c#p8HmH;::":?c;`;@,@8<@DH<8c (<8#|ex<8#|gx=9#|ix~ xH xH "|A ~x$x~xx}{x}{xH 3m,@Hy,@,~x<8#8 8 x}{x9 Kb!HA  ,A(,@ <8c#x8)HH;,@8a <8 (8 8 8 xHAq ,AL,A(<8c (|dx<8$x8!H!H <8c$(x8*HEH p=?9)׈;}#KxH ‘<8c (8 8H <8c (8 8H H xx8PH,A T8 <8x <8ׄ =?9)t! >:׀=_9JpA |#x <8| <8ׄ ;a ;@F}v[x}USx=?9)t! ~x=_9J$TA ! ; <8$t  =_9JׄA A  $=?9)t! (=_9J$tA , 0<8ׄ 4 8=?9)|! <=@aJA @,A8a =9kp ́8|H@} Kx =9k| Ё2|H@} Kx ; 쓦A *a } HP9)1 $ } HP9)})֑.9 ! 8a<8$8F8FH M8a<8$8F8FH 58a&<8%$8F8FH 8al<8%l8F8FH 8a<8%8F8FH 8a<8%8F8FH 8a><8&D8F8FH ½8a<8&8F8FH ¥8a<8&8F8FH 8a<8'8F8FH u8aV<8'd8F8FH ]8a<8'88H E8a<8'88H -8a<8'88H 8a,<8'88H 8a@<8'88H 8aT<8(88H ͓ @ D H L P T8a<8($8<88a8088@H q8a<8 88H ,A8a<8 88H q,A<8c!$$x8IH<8c!pH8a<8!8@8@H 1,@8ap8@88H >8a8p88@H 8a<8!88H ,A$8a<8"\88H ,@$8@9 !<8 DH8a<8"88H ,@$8@9 !<8 DH8a<8#d88H I|cy@ 8@a<9 !DӱH`8a<8#88H ,@$8@9 !<8 DӑH 8a<8$l88H ,AD8a<8$88H ,A$8a<8%t88H ,@8@9 !DqH<8c%$x8JH<8c&D$x8'HD8a<8&l8@8@H -,@8a88 H 8a<8&8@8@H ,@8a88$H8a<8&8@8@H ,@`8a8@88H ;8a888@H e8a<8',88H |c8c 88(&x8Hh8a<8'08@8@H Q,@8a88,H08a<8'p8@8@H !,@ 8a880&x8H1H88a<8'8@8@H ,@}kx8\8H ,@<8c'$x8(H18P!P <8cHH <8c88@H H 8aP$x8PH8P!T <8c`H A<8c88H H 8aP$x8PH,@(!X !,| @8LH0,@H8P!\ <8cxH <8c8,8H YH =8aP$x8PH=H<8c($x8FH%<8c(`$x8CH<8c($x8 H<8c($x8H8P!` <8cƐH 9<8c8,8H H 8aP$x8PH L,@X#xH H|xa8|ip} x| P8|А8T8D, @=?9)̑!8 3|H@} Kx8<$2|H@} Kx8@=?9)̑!D!H84L=?9)ؑ!P8TaXA\`dh!l8a88<8|+x|+x9 9!$=_9JHHD, @؁!@, @=?9)̑!8!< 3|H@} Kx8@$2|H@} Kx8D=?9)̑!H!L84P=?9)ܑ!T8Xa\A`dhl!p8a888<<8|3x|3x9! 9A$HH <8c($x8:H(<8c)$x8!H<8c)($x8#HH @,@=?9)̑!8!< 3|H@} Kx8@$2|H@} Kx8D=?9)̑!H!L84P=?9)ؑ!T8Xa\A`dhl!p8a888<<8|3x|3x9! 9A$HA8a~xK@p9@5kAP=C0=?ɩ=?UI:(})m@ h(`( 9J5k@́o9@5kAP=C0=?ɩ=?UI:,})m@ h(`( 9J5k@̀a<<8)L`8H !a@<8)Td8H aD<8)Xh8 H ! ,A<`| A$=)9) ><8ct8HH̃,@x88<8 @8DH<8c<8|ex<8|gx=9|ixjxHс><`| AHL~xdx~xxH 9cxDxexxxxH  ,@cx<88h8lxx9 K?Հh,A@8alDxK=<8cx87HcxxxHq8H8al<8 |#x<8Gx9p)xK6ɀ,@p,A(<8cx8'H8alDxK<`| A$=)9) ><8c8HHL! | 8a<8<8hgxx9 A@H ><`| A 8H<8ch,xDH ,<8ch8@x8H ,<8ch8@x8H ,q; 8a@<8l88xx9 9@Hߕ,@x88x8H,@,<8cx8H8<8cH8a>88x8Hᩀ,@,<8c x8H8<8c Ht8a\88x8H],@X<8c8x8H}8<8c,H(<8cPx8*HU8<8c8H MHh($=? ` LA@ =? *!H=? (!9):| @ <8c|x8=H:H<8cDH H m<8cXH Э|cy@H;; |T:|<8c888H ~]|cy@;7@H -,AxHA:H!9) !9`!| @,@9`, @P!| @H:=?9)l;Г}#KxH -<8c888H }H xx8PH8<8cH 85A\<C0=?i,!U+:}k9)m)!X(k: !9)!5@a0<8H8H Ea4<8ԀL8 H -!8 88!|N |!B|rx|#x|+x |;x}Cx}1Kx}OSx ! ~x= a)|H@L,A 8H,A 8><`| A$=)9) ><8c8$HH,@;;;@ ;`?c8<`| A$=)9) ><8c 8!H-H,@;; ;@ ;`?c:8!:s>_:R?C0=?l=_ê=Ë?;{>:֗88!<@DH<8cx<8|ex<8|gx=9$|ix=_9J8H5|A<8c88|ex~x8P9PH,@<8c88~x8PH ,@<8c8~x8)Hv!H܀,A,@<8cd~x8Hu8<8cH I<8cx88H dH |8a~x8PHua8A<@8D9 0!H9@ AL<8cx<8˼8|fx<8h|hx=?9)|jxHU A*|I|p||@|x=`|X@>|Plԓ(r$؂n( !aH ׵<`@8=?)tH ם $؂~x9 9`,AL,@$9@}jK, @4r@,}kH$9`p A}kI|qA })IK}u[x, A:nԓ( !aH <`@8=?)tH $؀ܐ$9 9`4AL,@$9@}jK, @4p @,}kH$9`p A}kI|qA })IKa$8a~xH !8 |K֒<8cH 9|}xH;,A<8c~x8)Hs)H; ,@@~Np~$|Vp{; 7{A?;|<8cH ӕ,@<;;;<8cx|8H ),@;7@H Y;9`9W*H,Kx5kA9 W:}:.;5k@=_ɪ҄`h$;| p})A W:|.*`X:;5)@胡$p= C0=_Ɋloԑ!`($r[|8l!!!`( $H =?ɩ҄`h;p;7A W:|.*`X:;7@胡$p})=`C0=_Ɋlm a`($r[|9)m)!ԑa!!`( $H U=?ɩ҄`h;pA W:|.*`X:;7@胡$p})=`C0=_Ɋlm a`($١0r[|9)m)!ԑa!!`( $H ҽ!P=?ɩ҄`hp;p;7A W:|.*`X:;7@胡$p})=`C0=_Ɋlm a`($١8r[|9)m)!ԑa!!`( $H !X=?ɩ҄`hp;p;7A W:|.*`X:;7@胡$p})=`C0=_Ɋlm a`($١@r[|9)m)!ԑa!!`( $H m!`=?ɩ҄`hp;p;7A W:|.*`X:;7@胡$p})=`C0=_Ɋlm a`($١Hr[|9)m)!ԑa!!`( $H !hW88a8 ~xHW7<`| @$T<8a8<80 ~xHfm A*|I֐$T<8a8$8 <8xHx~xHh22$| p}k;5kA49@W8} }. 2z}.I;5k@؀ A*|I֐$T<8a8$8 <8xHx~xHk8(=?ˠ;9 9`W:|.h@ x;5)@a(<8cd~x8Hle=?9);}#KxH w<8cx8(8H [AH s%x~x8PHl%(,@ H((,@<8c~x8DHk<8c$~x8(Hk=?9);}#KxH w-<8cx808H ZH rx~x8PHk=?9)}#KxH v<8cx888H Z}H rax~x8PHka=?9)(}#KxH v<8cx8@8H ZAH r%x~x8PHk%=?9)@}#KxH vy<8cx8H8H ZH qx~x8PHj=?9)X}#KxH v=<8cx8P8H YH qx~x8PHj=?9)p}#KxH v<8cx8X8H YH qqx~x8PHjq=?9)}#KxH u<8cx8`8H YQH q5x~x8PHj5=?9)}#KxH u<8cx8h8H YH px~x8PHiɡPh @4<8cL~x8AHi<8c~x82Hi;H<8c~x8>Hi<8c~x82Hi;Hd=?9);}#KxH t<8cx8(8H XeH pIx~x8PHiI<8c~x8'Hi5<8cH~xHmxa||ip} x| P||А|T|(,A ,@ (,@l~Np~$|Np; 7Ax?;|<8cH U,@<;;;a<8cx|8H ,@;7@H |,A4;9@9W<})BiP Q PiQ;5J@;9@8W(@.Kx5kA9 W:}:.;5k@ A*|I֐$T<8a8$8 <8xHx~xHa8=?)U)8, @9 $| p}k| H@}+Kx;5kA9 W:}:.;5k@22$| p}k;5kA49@W8} }. 2z}.I;5k@؀ A*|I֐ $T<8a 8$8 <8xHx~xHcH@(,A4<8c,~x8Hd<8cH 8a ~xHLH8a ~xHL=?ˠ8p~p|=?)9)| P}>Kx4A09`W:| .h@ x;4@ap=?9);}#KxH oq<8cx8p8H RH jx~x8PHcapA(| Qց!| ֐t|Y|Q} HP!x9)!x, @T=?9)(}#KxH n<8cx8p8H R<8cx8t8H RuH jYx~x8PHt=?9)@;}#KxH n<8cx8t8H R5!x9)!<8cx88H RH ix~x8PHb<8cH~x8Hb=?9)\!8?;<@8 D8H8L<8cx<8ˠ|ex|fx<8p|hx=?9)||jxHw,A$(,@8p89t<=?9)x!@!D=?9)ψ!H8xL!P8АTX!!\A$A`a(adAhl<8c̸<8ˠ|#x|#x=?9)x}*KxH eHĀ(,@=9kxa89p<9!t!@aDaH=9kψaL8xP=9kτaT8АX\`AAda$ahA(AlApt<8c̸8|<8ˠ|+x|+x=_9JxH aH(,@ =9kxa89p<9!t!@aDaH=9kψaL8xP=9kόaT8АX\`AAda$ahA(AlApt<8c̸8|<8ˠ|+x|+x=_9JxH Hl<8c~x80H<8c~x8;H`UHl !$|H@} Kx!$ !$| ,@8A( <8cXH !$;4AP=`C0=_ɪl=?W:A,})Roah(`( ;4@́a(;4AP=`C0=?ɩl=_W:0})oah(`( ;4@̀a<<88P8PH mqa@<8T8H mYaD<8 X8H mAaH<8\8 H m)8!H |AȐ!PB|wx|3x|;x}Cx}2Kx}USx= a)|H@L,A 8H,A 8><`| A$=)9) ><8c 8HjH@<8c(x8H^%<8c,x8CH^<8cpx8+H]8h;`?;;; P;@(?cH!h9)!h8U):})9)!<@D!HAL<8c<8|#x|fx<8=9=?9)P=_9JdH|@!h9)!hxH^Y;`9`,A!h| @9`, @L<8c(x8H]h;a<8Ԁ8H ka<8耡8 H ka<88 H ja<8 8 H jՁvh5kAX=@C0=?ɩX=?hT :})ldA``h(`( !h9)!h5k@<?;`8h?; :h;;$; "?_;Z0::`8<@DH!L<8cd<8~ųx|fx<8H|hx=?9)h|jxHlh,@ ;`HA8!hU):})9)!<@DHaL<8c<8|#x<8Ʋd<8|3x=?9)|3xHɁ!h9)!h6h|H@} Kx, @8h,@ 8!|AN |!B|ox(( |3x|;x(,!(0}XSx(L#!'= a)|H@P,A 8H!( ,A 8=<`| A$=)9) =<8c8HfH: 99 ?;?;}::;:?;{}?@cZ>:s}>:}L8<@8D9 P!H<8cp<8$|ex<84|gx=9T|ix=_9J}LHj98<@DHL<8cp|dx<8|fx<8h|hx=?9)||jxHj=8a<@DHL<8cp|dx<8|fx<8|hx=?9)|jxHixH|Al<8c}L8'|exx8P9PH',@<8a'xH<'})9)})֒3<8c}H uH8`,A<8cx8)HXiH: ,@t8'>:s}>:}?;;'9;`>:4?_;Z}:-9 >:}> b19 !''!''8<@D8(HaL<8cp|dx<8}|fx<8T|hx=?9)d|jxHh88'<@D9 (!HaL<8cp|dx<8}|fx<8|hx=?9)|jxHh988'<@9 !D8&HaL<8cpx<8}|fx<8|hx=?9)|jxHgᓁ88'<@9 !D8&HaL<8cp8'<8}|fx<8|hx=?9) |jxHg!''} HP9)7!''} HP9)28A<@8DHL<8cp|dx~x|fx<84|hx=?9)D|jxHg8<@8DHL<8cp|dx~Ex|fx<8t|hx=?9)|jxHfɁ!''} HP9)})֑7!''} HP9)}i֑r7| A!( | @0<8cx8AHUi<8cx80HUUH 8'|@!', A08}{x(<8p|+x~x~Hx=?9) xH̀=?)}@Iփa'7ZA4>:}>:}>:}t<8c}H u;7A,;`|<8cp88H ;7@H =6}@Iփ'5JA8`<`| A$=)9)><8c8H]IH<8cx8HP<8c<8<8p<8tp8|x9 9@PHÝ|,@d=?9) !8?;tȓ<@8 D80H8L<8c<8|ex|fx<8 |hx=?9),|jxHe),A=?)tĀ| A| @=? t=?9)\!8=?9)tđ!<@8D8(H8#L<8cdx%x|fx<8|hx=?9)H=?)t| A| @=? t=?9)\!8=?9)t!<@8D8+H8#L<8cxEx|fx<8|hx=?9)} CxH_<8ctH i~x(Hw1|ex<8c~xH =H E<8ctH 9H 5=?)t, A0<}iP9kU):}) T :})H,;}iP9kU):}) T :}) h(8 ld<C0``=?ɩh($ѡ<8ctH y<8c88H <<8c88H <<8c88H <`| A$=)9) ><8cޤ8HWHt8I2| P| x9)!4|I֐8=?9)p;}#KxH V%1} HP9)!<8cp88H 9/} HP9)!<8cp88H 9uH QYxx8PHJY,A 8a888xH2 8 88P<<8cx<8<8<8ox!9@H 88<~x~dx}kx~Fx}sx~(x}{x9AH=?9)p(;}#KxH U<8cp88H 8H Pxx8PHI=?9)p@}#KxH T<8cp88H 8aH PExx8PHIE=?hLA@ ѡH =?hL@@ ѡH 8;x<88F8FH W8a<88F8FH V:~x<8d8<8<`| A$=)9) ><8c,8HFuHd5| P | x9)! 6| P$| x9)!$,A@;=?9H|#xa;;`ax88<8Ǝl8H m8 8;<<8c@x<8P<8T<8_0x9 9@H5A8=?9)_0!<@8D8&HL<8c|dx<8`|fx|gx=9=?9)|jxH,A0,A(<8c@<8<8<8_0Gxx9 9@H,@Ht<8cx8BH8Q<8cx8BH8=<8c8x8.H8)<8c<8<8<8_0Gxx9 9@H!,@h<8c_0<8<8@Fx8x9 9@Hh-,A8<8chx8CH7<8cx8&H7<8c`0H8a8`x88PH<8c`9)})ր})U):})=?  LA@ = 4 *ȁaH=? 4 (Ёa9!`})iP}`Fp Q}`p R}`p S;c;@:~9+})ր})U):})}q[x}QAHa+|x~HQA8~=?ɇ=ë4:A`8`= a)!=9Zt}8U):}) (LA@*ЁaH(ȁa}8U):})Uf}`p| Zx}@PP, @, A<9J9`,A; ;@HlU`&6P6}2)O;{;@HP, AP9J9`8Uh 68`,A}y[x;@HQ6}')O;{;@4@UK~H, A9J9`8Uh 68`,A}y[x;@HQ6}')O;{;@4@UK>,A}y[x;@HU`&6P6}2)O;{;@UK~HH!| HAx9Jl9`8Uh 68`,A}y[x;@HQ6}')O;{;@4@9`,A; ;@HU`&6P6}2)O;{;@9`,A; ;@HU`&6P6}2)O;{;@UK>,A}y[x;@HU`&6P6}2)O;{;@UK>,A}y[x;@HU`&6P6}2)O;{;@UK>,A}y[x;@HU`&6P6}2)O;{;@UK~,Aak,A}y[x;@HTU`&6P6}2)O;{;@H8a| XA<8cZ`H dyH buH<8c۸~ijx8+H,,@ <8cZtH u;;;|<8c88H ;7@H 1:;{,@,;5{A 9A`}* O O;5k@;6@<91})ր})U):}):15@,@}!);{,@L=?9)Z }#KxH ;;;|<8c88H %;7@H a<8cZH ]h8!`|ˡN |!@B}Cx}9Kx}WSx ! $(a,@frx= a)|H@,A 8H,A 8><`| A=)9) >H:|H@=?8H9|H@=?8 R=?)R| A| @=? R=?)R| A| @=? R,A,@8 8<<8c$<8<8xx}i[x9@H8<Cx$x~x~Ƴxx=9R=?9)R=_9JRH><`| @<`8H <8c$<8<8|xxx9 xHm,@H:` a8<<8c$<8<8xx}i[x9@H<8c x8H(<8c~<8<8|xxx9 xH,@8=?9)(!8?;R<@aD80H8L<8c~<8$|ex|fx<8<|hx=?9)H|jxH=q,Ad=?9)x!8=?9)R!<@8D8(H8#L<8c~$x~ųx|fx<8Ԝ|hx=?9)ԴH`=?9)x!8=?9)R!<@8D8+H8#L<8c~Dx~x|fx<8|hx=?9)} CxH8i,@<8cRH ^|cy@0~x0HO|ex<8c~~xH =|cy@H \,A<8cRH=?)R, A8<8cRH ^,@d}{x4HOY|ex<8c~}{xH4<8cRH ^e,@0~#x8HO%|ex<8c~~$xH ,@H \1<8cS H ^%,@0}sxx=?;\;;`ax88<8v8PH U-;x<8J|8P8H /%8a <8`8P8PH / 8ap<8̰8P8PH .8a<88P8PH .=?9)P!88:D̓<8cDH a<8cn$8H8H 퀚8P|!T:!|JW:|<8cn$88H H ,@8a`x8P8 H H@::a`a04: W88<~cx8088<8nx8PH Fy, ;@h9<8cDH qaD,@,<8cn$8`8PH maD,@ H naD;8a`<8d8P8PH ;7@=9kD Ht7|xHQAX??;9D;?_;ZD>:D<8cDH <8cn$8H8H y8P|!T:!|JT:|<8cn$88H AH %,@8a`x8P8 H YH@:9`8<:@ W8!0A4}{x8880<8nx8PH E, ;@h9<8cDH paD,@,<8cn$8`8PH l aD,@ H mIaD;8a`<8d8P8PH ;7@=9kD+9)+,AP9=?9)E }#KxH oaD,@,<8cn$8`8PH k}aD,@ H laD<8cE H AD,A`=?9)E,;}#KxH -<8cn$8D8H H xdx8PH<8c˴dx80H8H8 8!|N |!B|wx|#x|+x|3x|;x}Cx}2Kx}QSxA= a)|H@L,A 8H,A 8:<`| A$=)9) :<8c8 HEH 0<8cDx8H<8cDx8'H<8cDx8Hy4| P| x9)!܀3| P| x9)!؁!܀}U<8a8ExH:<`| @ ,AL889<<8cc$x<8<8<8: Hx!9@H:??;9: >x=?;;;`a~x88<8c@8PH A;x<8: 8P8H 8a<88P8PH y8a@<8X8P8PH a8a<88P8PH I=?9)!88Ԑ-,AD=?9);0;}#KxH i<8cbx8H H xDx8PH=?9);H;}#KxH )h(<8cb88H H xDx8PH=?9);`}#KxH h(<8cb88H YH =xDx8PH=8aDxH<8c: 8Ex8HY= C0=ɫimđ!h(*l̑!h($ѡ=?9);x}#KxH <8cb88H H xDx8PHX8!P|N A|B||;x}=Kx<`| A$=)9) ><8c48HEH<8cW<8T}e[xx8Tx9 AK),A8Ht8aTxH8aT<8\<8dx89Hi8aT<8|<8x89HExHa,A(8aT<8<8x8 9 H$8aT<8<8x8 9 H8aT<8<8x89HɁ8} HP9)!P8aT<88Px8H7} HP9)!P8aT<88Px8HŹ8aTxH88aTxexFx'xx~x~ʳxHʙ8aTxK8!|N |!B|qx|#x|+x|3x|;x}Cx}2Kx}OSx= a)|H@L,A 8H,A 8><`| A$=)9) ><8ct8H H 88I3| P| x9)!} Kx9 |I֐=?9)-l;}#KxH M2} HP9)!<8cTt88H Ł/} HP9)!<8cTt88H H xx8PH,AP8a888xH58 88P<<8cTx<8<8ƻ<8-x!9@Hy588<~x~x}sx~fx~x~Hx}{x9AH=?9)-;}#KxH 9<8cTt88H H xx8PH=?9)-}#KxH <8cTt88H H mxx8PHm=?ThLA@ ѡ H  =?WhL@@ ѡH 8: ~x<88F8FH 98a 6<88F8FH !;@x<808<8<`| A$=)9) ><8c8HH <8cx8H<8cF,<8<8F<88x9 9@PHd݀,@;8<xdxx~ƳxGx~x)x9AH==?9) ;`}#KxH <8cF,88H QH 5xx8PH5=?9) }#KxH <8cF,x8H H xx8PH=?9)!8=?9) !<@8D8<H8L<8cFT<8FT|#x<8F,<8,|3x=?9)H|3xH)!<8c 4H (!9|x@HQAp5|xHQAP8`?; }<U):}) h$<8cF,88H !;7@;97Z@H %<8c HH !8!|N |!Đ!B|#x}Cx}9Kx}XSxXa\A`!da= a)|H@,A 8H,A 8><`| A=)9) >H4:|H@=?8H9|H@=?8 =?)| A| @=? =?)| A| @=? ,A,@8 8<<8cC~x<8<8Ƹxx~ɳx9@Hhe8<Cx$xx~xx=9=?9)=_9JH><`| @<`8H<8cC<8<8Cxgxx9 xH`,@H8 8<<8cC~x<8<8Ƹxx~ɳx9@Hg<8cx8HU<8cCd<8<8Cxgxx9 xH`Q,@<=?9)!8?;<@8 D80H8L<8cCd<8C|ex|fx<8|hx=?9)|jxH݀,Ad=?9)@!8=?9)!<@8D8(H8#L<8cCd$x~x|fx<8d|hx=?9)|H`=?9)@!8=?9)!<@8D8+H8#L<8cCdDxx|fx<8繤|hx=?9)} CxHՀ,@<8cH #i|cy@H !],A<8cH~x8`x~Ƴx8PHY<8cH #%H !!<8cH #8a`8PH|ex<8cCd8`H ]H <8cH "H <8cH "H <8cH "H <8c8exx8 HI,@<<8cH "=?D`r<8cCd88H H<8c0H "UH Q<8cDH "EH A<8cXH "5H 1<8clH "%H !=?), A:U):}) ā8U):}) h(̀:| Pl<C0=?ɩJXh($ѡ̀:H|9U):}) ā7U):}) h(̀9| Pl<C0=?ɩJXh($ѡ̀9| P| x9)!<8cH <8cCd88H QH <8cH <8cCd88H -H <8cH <8cCd88H H <8cH H <8cH H }<8cH qH m<8cH aH ]=?), AȀ8|xHQAp?;{<8c H %|cy@@8|!T:|W:|<8cCd88H U|cy@H ,@;7@=9kH<8c H <8c@H <`<8c8"HyH7|xHQAp?;{<8c,H a|cy@@8|!T:|T:|<8cCd88H ֑|cy@H ,@d;7@=9k+9)+<8cLH <8cCd88H =H <8c`H H <8ctH H <8cH (8! |!N |!Đ!`B|{x|#x|+x}Cx}6Kx}RSx؂!܃!A= a)|H@L,A 8H,A 8><`| A$=)9) ><8c08HH7| PX| x9)!X6| PT| x9)!T} Kx!X|I֐T T| x9)2!T=?9);}#KxH )<8c:x8T8H ԵH xx8PH<8cPx8>H兀,A|,@=?9)!8=?9)!<@8 D8)H8L<8c:x<8:|ex|fx<8籤|hx=?9)|jxHHl=?9)!8=?9)!<@8 D8)H8L<8c:x<8:|ex|fx<8籤|hx=?9)|jxH=?), AH,AD,@L8 8<<8c:~dx<8<8Ʊ'xx!9@H^Q;Px<88P8PH Y8a<8<8P8PH A;x<88P8PH %8a`<88P8PH 8a<8,8P8PH 8a<8|8P8PH ݓA8!<@8PDHL<8c:|dxx<8:|3xx=?9):=_9J:H),@H<8cx8H)! | 8a<8<8:&xGxx9  xHV,@;!X9)! x88 HG8a`x8 8H 888a`8 H a480=?9)!H8`D=?9)!@8ap8@80<8:8PH }<8cH <8c:x8X8H 95} HP9)!P<8c:x8P8H <8c:x~x8H <8c:x~ijx8H H }5|x`HQA|??;9;p <8cH M2|xHQA<8|T:W:|"<8c:x88H u;7@H ;Z7{@<8cH Q8!|!N |!B|vx|#x|+x|3xH} Cx!PAT\tx= a)|H@h,A 8H0,A 8H,A,A 8><`| A$=)9)><8ch8HH,A|p|8a888xH888<<8c4$x<8<8Ʈ<88x!|9@HZ;??;98=x=?;PT;`;@AXa\x8P8X<85 8PH ;0x<888P8H 8a<88P8PH 8a<88P8PH 8a <8<8P8PH u=?9)!88<@;PDH8L<8c4<84|ex|fxx=94x|jxH,@x<88P8PH 8a<88P8PH ;x<8@8P8PH 8a@<88P8PH 8a<88P8PH 8a<808P8PH y88!<@DH8L<8c5 |dxx<84|3xx=?9)5 =_9J4H,@ |H88<81@8D8H<8c4<8|ex<8Ʊ|gx=9|ix=_9J8H,@8a<8H8a<888H 8a0<8 8P8PH m8a<8p8P8PH U8a<88P8PH =8a <88P8PH %8ap<8`8P8PH 8a<88P8PH 8a<88P8PH 8a`<88P8PH 8;@?;{8;;; P;a8<@D!HLPT<8c4<8P<8580|gx=9l=?9)5 9AHx<888H i,@ x<888H H;@,@d8a<888H !,@88H08a<888H ,@88xHE<`|A ;aa8<~#x~xXH}kxP!T9AH=?9)t;0;}#KxH a<8c488H H xx8PH=?9)}#KxH !<8c4dx8H ɭH xx8PHڑ=?4hLA@ ѡH ,Al=?9)!88<@8D8/H8L<8c4<86\8|fx<8|hx=?9)|jxH]UHh=?9)!88<@8D8/H8L<8c4<86\8|fx<8|hx=?9)|jxH%,A0,@,=?7hL@@ ѡH ,Al=?9)!88<@8D80H8L<8c48<86|fx<8 |hx=?9) |jxH\=Hh=?9)!88<@8D80H8L<8c48<86|fx<8 |hx=?9) |jxH <8c88|exx89HS,A<8cPx8EH9H8axHme!8 |K=9k=?9)8+ }c[xH ,AH<8cx8H,Ax<8c4|dx<8x8HAHT,AH88 <<8c4<84|#x<8Ƶ899!9AHϹxHՍxHTa,A 8M88*H8I8*8,A88H88,A88 H8 8AP*aH } HP9)!`;8a<88<86<<888`xxHAT* } HP9)!d8a<88<85H<8988dxxHT8h8a<88<88p<89<8hxxH8a<88<89@<89D<84xxHm8a<88<89H<89L<84xxH=}{x}sxH,A;}{x=?:IAXa\}sx:PTx8X8P<85 8PH Y8P88a<88<89P<89Tx=99XxH488a<88<89P<89T}{x=99X9!xH ;8a<88<89\<89`|#xxxH1AT* } HP9)!l8a<88<87<89d8lxxH!PiAH }`XP9kAT* } HP9)}kIր}k֑ap8a<88<89h<89l8pxxH!l=? 5h$=_ 4 LA@ = 5 *x|H=? 5 (8'88a<88<89p<89t89=?9)9x9AH9!p=? 5h$=_ 4 LA@ = 5 *H=? 5 (x|8';88a<88<89|<8989=?9)9xH8a<88<89<89<85 xxH%8<8cH 2;;;a|<8c488H -;7@H .8ȀX8=?9)8ȑ!<=?9)!@8ĐD8H=?9)4!L!P=?9)4!T8ȐX8\8`8dh8l<8c4<84~%x~xH}kx!PATH<8cH m(8! |N |!B = a)|HA<8c8"HݝH| Fp}kUi@.|P, @9k,@8,A%})Bi|H%})B}h,A$%})B8 %})B8H %})B8 %})B8 ,A<%})B8 %})B %})B %})B8H8%})B8 %})B8 %})B %})B | Fp}kUi@.|P, @9k,@8,A %})Bi%})BH%})B%})BiX8!P|N |!B = a)|HA<8cP8!H۱H| Fp}kUi@.|P, @9k,@8,A%})Bi|H%})B}h,A$%})B8 %})B8H %})B8 %})B8 ,A<%})B8 %})B %})B %})B8H8%})B8 %})B8 %})B %})B | p}JUI| P| p}kUi| P|Fp|T@.|P, @9J, @9k,@8,@8,A8%})BI%})Bi%})B %})B H4%})B%})B%})Bi %})BI X8!P|N |!B|;x},Kx!)<`| A<8c 8 HQH| Fp}kUi@.|P, @9k,@8,A%})Ri|H%})R}j,A$%})R8 %})R8H %})R8 %})R8 ,A<%})R8 %})R %})R %})R8H8%})R8 %})R8 %})R %})R ,}$p|T|HP|p}kU`|8P|Fp|T@.|8P,@8, @9k,@8,@8,A8%})R%})Ri%})R %})R H4%})R%})R%})Ri %})R "}$p|T|HP|p}kU`|8P|Fp|T@.|8P,@8, @9k,@8,@8,A4,})R }j,})R,})RH0,})R |,})Ri,})R(}$p|T|HP|p}kU`|8P|Fp|T@.|8P,@8, @9k,@8,@8,A8,})R,})Ri,})R,})RH4,})R,})R,})Ri,})RX8!P|N |A!B|{x|+x|;x}Cx}>Kx = a)|HA<8c@8!HIHT| Fp}kUi@.|P, @9k,@8,A=})i|H=})}~,A$=})8 =})8H =})8 =})8 CxHq,A<=})8 =}) =}) =})8H8=})8 =})8 =}) =}) | p}JUI| P| p}kUi| P|Fp|T@.|P, @9J, @9k,@8,@8,A8=})I=})i=}) =}) H4=})=})=})i =})I 85CA(<})}):}z: 85J@<})})8 h8!`|AN |!B|#x|+x|3x= a)|HA<8c8HҙH<8x8Dx9 Kp,A<8cx8HHx8aD<8 |#x<8x9H9!@Kg-H,A 88aD8LKmm=, @$@|t@T>,{A 8h8!`|N |a!B|#x|+x|3x= a)|H@$%<`| A$=)9) %<8c8HeH8<8x8x9 Kn,@8a<8|#x<8899!@Kf,A$<8cx8'He8H8;;a8a@xxfxx99 HHx<8$88H щ,@Xcx88x8HH,VA,<8c,x8DH<8cpx84Hý8H88a8Kk88!0|aN |!B|#x|+x|3x= a)|HA<8c8HH<8x8Dx9 KmM,A<8cx8HHx8aD<8D|#x<8<x9H9!@KdeH,A 88aD8LKj=, @$@|t@T>,{A 8h8!`|N |!B|~x|#xH݀|@x,AP8a@xHA<8cTxH<8c|dx<80x84Hu8a@xHH <8c<80x84Hh8!`|N |!B|yx|#x|3x|;x}Cx}3Kx}WSx( = a)|HAx<8ch8%HHx=?9)8;@}#KxH ̱x~ijxH|ex<8cHxH 1H x~x8PH88!H8|#x~ijxH]|~x,@?;{$:@~:# ;<8c$H !a|cy@$<8cX88H |cy@H =,@,\@t9`9@9@H,}(Z P|t}|H@ 8HL.|H@ 8H4,@$,A 8H ,A 8;<`| A=)9) ;H,A 8H8\! ,A$>}P93~P:H ! ,A$ .~P:1}P9H V<9)})ր })!P9)!PT<@a8P8@<8|3x9T9!X~ xK_.}`HP9+})֑!dR;> HP;9,@,@! ,@9 !h}`[ylA! ,A .} HPah}+HP9)H!h;7Aah9kap8 !`|I֐t=L=?ȁa }8P,@ 3})P;|@t7p} I})ad})XP9)Kx|H@}+KxT<@U`<Da8@8D8\8T9X~ xK\T,@`P,@|A؁! ,A8t}~Uk:!L}kJW<}) lL<C0HHW<}) ,@@at}>ZU):aL})ZlL<C0HH(* HD!t}~JUk:L}kW<}) lL= C0!HH( ;;7@xah9kahl4l@}-P9)|H@} Kx!D }5xP9)a@ |H@} Kx!H H<8*<8c8HH <8cdx8;Hu8'8!|N |!0Ba萁쐡|;x}Cx}+Kx}RSx AA a$(<\= a)|H@,A 8H܁,,A 8HĀ,@ ,@,@! ,@x8|HA(+|HA4<|H@ 8HT! (|H@ 8H4,@$,A 8H ,A 8><`| A$=)9) ><8ct8HAHp,A(<})P9)!`2~P:H2!`,A0 a+~P:(})P9)!hH!akah88|Iց*|JH| x9)!Ha8H~x<8 |3x9L9!P~jxKY(a }`HP9+}փp;< HP;9,@4,@(,@9d}q[yA! ,A(a+} HPad}+HP9)H!d;@7A`d98 !\~I=C0==! }:P,@ 2})P;|@P8}/I})})pP9)aT|H@!Ta~x8T<8 8X9P~ixKWP,@|A,A}~Uk:!8}kJHX}= |u@8}>U):a8})ZlD@@(* H<}~Uk:8}k}= |tlD@@( ;;Z7@Ёd9d61@La`}+P9)|H@} Kx!0 h}4@P9)a, |H@} Kx!4 H <8cx8:HM8'8!|N |AȐ!B|+x|3x|;x}Cx}3Kx}RSxx|= a)|HA<8c8 HYHd;;A pCx<88F8FH 8a <88F8FH ;! #x<8`8F8FH 8af<88F8FH 8a<88F8FH 8a<888F8FH i8a8<88F8FH Q8a~<88F8FH 98a<88F8FH !8a <88F8FH 8a<8X88H 8a<8l88H 8a<888H 8a<888H 8a<888H 8a<888H y;`dh8lpt;a 0cx<88<8<`| A 8 '<8cX8HH,A 8H8\! ,A$<}P94~P:H ! ,A$ /~P:2~ P:H V:9)})ր })!P9)!PT:@a8P8@<8(|3x9T9!X~*xKF/}`HP9+})֑!ds;<@HP;Z,@ ,@t! ,@d9 !h}`[ylA! ,A /} HPah}+HP9)H!h; 7Aah9kap8 !`}I==?La }9P,@ 4})P;|@t8p} I})ad})XP9)kx|H@}+KxT:@U`:Da8@8D8\8T9X~)xKC9T,@pP,@|Á! ,A4}~jUk:L}kW:}) lL= C0!HH|W:}) ,@<}>jU):aL})ZlL<C0HH(* H@}~jUk:!L}kJW:}) lL<C0HH( ;;97@!h9)!hal5kal@}.P9)|H@} Kx!D }6P9)a@ |H@} Kx!H H <8cxx8;H=8'8!|N |!@Baؐ}Cx}+Kx}TSx!A !,X= a)|H@,A 8HЁ! ,A 8H,@ ,@,@,@p(|HA$+|HA,=|H@ 8HP.|H@ 8H8,@(! ,A 8H ,A 8><`| A$=)9) ><8cT8HH ,A 8H8T! ,A$=~IP:R4~P:H T! ,A$ .~P:0~iP:sH nV:9)})ր })!H9)!HT:@a8H8@<8|3x9L9!P}{xK@.}`HP9+}փq;=@HP;Z,@Ё! ,@! ,@9 !\}`[y`AT! ,A .} HPa\}+HP9)H!\; 7Aa\9kad8 !X|I֐ha }9P,@ 4})P;|@p8d} I})})hP9)kx|H@}+KxT:@U`:Da8@8D8T8L9P}{xK=L,@P,@0|A(h}>U):a(})ZW:}kz ;;97@,!\9)!\a`5ka`@}2P9)|H@} Kx! }7P9)a |H@} Kx!$ H <8ctx8;H8'8!|N |А!B|yx|#x|+x|3x|;x}Cx};Kx}\Sx = a)|HA8<8c}8"HH<8c},x8'H8H8;@#x<8 |#x<8 899!@K C0=?~x<8||#x<8899!@K9},@\;;;aP;@|{}> t8c8t88H ;7@;;;a`;@|{}> t8c8t88H ;7@8aP88&x8 H8a`88&x8H݁!}i| } HP9I9k}+P9i| A@| A4})}*JU):})l|!xx( 7Z@8!|!N |!B|mx |3x}+Kx}OSxA8a:,8 q:@>C0=?=?p,@Ԁ <8c,H Ia,@L;;;aW:|"<8c$88H ѐa,@;7@H a;;,@! ,AD99@8@U :}):iL O LiOiM N MiN95J@Ѐ,@HW:}) L,@4}:U):})l(* H8}zUk:}kW:}) Ll( ;;Z7@:R6@T8!|N |`&|HAaB!$,d(,!0@,A 8H$>a$׋88H 9a(88H %,@08888a@H 888aDH 888aHH Հ888aLH ($= 8k`ԀH eD=_ HL8j`H ML!H8|@P*;GA@WN:}sxH |{x}sxH |xx}sxH /|nxA ,@80H ;>|@<x6~x;v~88H 9>;A؂Wx8Ex;H 8@aHI93W:~.}5q.,@8;9)B|@X8Z;~9@@D|IW:}b./ @(|P@p.UY:B.q.}y.Y.9J;B;8|(@8W:~8}*.x|3x@48PT:|C8BH@ | x}h[x9kB|A8U:}*.}|.}.}j.}<.|J.} .|\.|p.| p.|q.|q.|(|3xAp;~89@X@<8[9a@" 0A+9J9k;8B|8A,@99a@UG:T:@}Y.A8}d[xD~\x88~8@8W:8.x|3xA8:'T:}P}2} 9)|@ |x}h[x9kB|A8U:..S...*.J.3.~p.~p.~q.~q.~8|3xAl4:G@H=H88m8P:H %M=<v9 b8 :(({W`@@AT8da$:2}OЀ!A:|\@؀=?A=T<,!,U^<h|* 9^`Ah. lApx|A!!X;,@>_>?=!xR:}?=>;@:1;͋paw}b9AWI<8 |4H WB<|Z4,@D:9|(,@0~óx88H ٓH8~p~7@|/Px@>?=_6\:?`ʋ:a;w|b9A~xW{~,@D8~@,:@0~óx88H %H9~p~7@@0\/@a,HA~}rH\,@X!D,@4lA,}`Ah+a,}.͊pZ|H\l!,ah|J.|H\D/@ !,~2~ +.H ,@4!,o|J.a~"~p}J| | K.H,@D? UUc5UV,a~7.Ma~}~S~[.H/@A$\"9|`@@aAAa,|.|o"|ܲ|p|H4? UUc5UVa,'.M|A|a,|[.A$a\ :|98d!;8F\8aAAA(R`A;d~:`~}!aA098!~| N |!`B|tx|#x((|;x}Cx}3Kx}QSxA(؂(܁((聡(a(= a)|HA<8ci`8 H ,A 8HȀ,A 8H,@3, @,|HA })P9)})ր| @ 8 Hl*, @0|HA$})P9)A( })ր| @ 8H,,A 8Ha( ,A 8;<`| A$=)9) ;<8ci8!HH;~x<8ڔ<8ވ<8۬8hxHW%,I@,I@ 'HX,M@,M@8'H4<8cidx8AH<8cidx8;H8cxH'|x17| |x8a<88'<8lHP%a',*A`=?9);P}#KxH <8cl8'8H sQH 5xdx8PH5<8cj$dx8H!8,@ 8a<8ڰ8'<8lHOa';7A;~x8'<8ވ<8xhxHUx<88'<8lHO=|vx|@d# '})9)!'~x8'<8ވ<8xhxHUIx<88'<8lHNِa',A;7@H8( (((9 !';7A;?_;Z0:< '})9)!'~x8'<8ވ<8xhxHTx<88'<8lHN9,A,@x8'exHOa( H,@8a8'exHOՐa((Hd,@t8a8'exHOa',A@, A8,A0, A(8P<8c0H e<8cl8'8H pH 8aPdx8PH,@D8a8'exHO=,A<8cjDdx8AH<8cjdx8H|,@a8~x88'<8۔8'9(9!@9AHP',Ad<8cjdx8FH9<8cjdx8CH%<8ck4dx8'HH ,@8a8'exHNqa(;7@,@ !( | AA((| @ 8HTa( | @8rH !((| @802} HP9)})ցA(*0} HP9)a( })֑-a8#x~x<8l|+x}GSx}kx=?9)ڔA(H*́!( ,A(A( ~PP:}`PP9ka(HRA(!((~HP:}@HP9JA($a(, @!(,A8', @ 8H(',@8H8H 8( 90(})9)A($8 a(|[| P!(4(,A؁A(UI:9aP})Zi9*(});)~I',@;;|Q@8!( |I| '~IxA($|P@}ISx x|@~x|x@HQA4|Pa(+|Kց- HP;( 7A:aP>C0=?`8 y;|@4~x8'<8ވ|+x8hxHP!'9)!';|A!(|HAA( ,A |P.|Kցa(+}@HPH9>})9I}3 O| u@8 lHm`'''(}*U):(}) * ;7@:7ZAK̀', @l9 !'a':`;5x~9QA|PA(*|Kց- HP;@;a( 7A;:AP,~&8|y֐(0=?`|@T|A| uA(@ 9JA(~x8'<8ވ|+x8hxHN!'9)!'P,@A(| tH<p})}2J P| u@9Jp})}2J Q| u@9k,A<',AUI 6}`&p|}iH}`&p|T@.}`R;@HH',A }@&p|T 6|PPT@.}`ZHUi 6}@&p|T 6|PP}i;@;~ @ |A|A!(|HA|A( ,A |P.|KցA(*}@HPH9^}J9J(0}*U):A(})Rm`'=`C0a''(h* ;7@(,@;:61AK',@H;;|Q@8!( |IT<| '~x8'<8ވ<8ڔ|3x9'9!(9AK~@x!($|H@} Kx)x|@~ x})P9)A( JI~Wxa($|X@}w[x x|@~x|x~QA|PA(*|Kց- HP;a( 7AX:@:aP> C0=?`8 y=?H;|@DW@<(,@A(~x<8ވ8(8( 8'9(9!KPXP|Aԁ!(|HAȁA( ,A |P.|Kցa(+}@HPH9>})9IW<})iN, @< lHm`'!''(!(Ā ,A(}*U):A(})R r$h*H}*U):a(})Z * ;7@:6A`C0=?`8 y=?H;|@DW@:,@8(~x<8ވ8(8( 8'9(9!KPXP|A!(|HAA( ,A |P.|Kցa(+}@HPH9>})9IW:})iLm`'a''(!(Ā ,A(}*U):A(})R r$h*H}*U):a(})Z * ;7@:6@!(9)!(A(,5JA(,@0(8!(|N |Ԑ!B|wx|#x|+x|3x|;x}Cx= a)|HA<8cZ8#H@,A 8<<`| A 8 '<8cZ8$H!Hd;~x<8<8<88xHGY,I@,I@ H0,M@,M@8H 8xHY8a<88<8ɰH@a,*AL=?9);@}#KxH 5<8cɰ88H cH {xx8PHt8,A<8cZx8BHt}<8c[,x8DHti<8c[px8DHtU<8c[x8DHtA<8c[x8DHt-<8c\<x80Ht<8c\lx8Ht<8c\px84Hs<8c\lx8Hs<8c\x8DHs<8c\x8DHs<8c],x8,Hs<8c\lx8Hs<8c]Xx8DHsy<8c]x8Hse<8c\lx8HsQ;9@9@}( P|uAW:})B PH W:}kB}()P})t9)+P;5J@=?9)8@ }#KxH ~M;;;aW:<8cɰ|"8H a;7@H y8a@x8PHr<8c\lx8Hr<8c]x8?Hry<8c]x8(Hre<8c\lx8HrQ<8c^x81Hr=~x<8<8<88xHD H8a<88<8ɰH=a;`7A;~x8<8<8xxHCx<88<8ɰH=A|yx|@d# })9)!~x8<8<8xxHCMx<88<8ɰH<ݐa,A;{7@H8;`7A;; })9)!~x8<8<8 xxHBx<88<8ɰHvH ,@8a8xH=u;{7@`,@8H8H,@ 88!|N |!0B|qx|+x|3x}Cx}/Kx}NSx!= a)|H@L,A 8H,A 89<`| A$=)9) 9<8cX88H{H! ,A 8H88~#x<8<8Ȁ|+x88~ȳx9!<9AK1,@<,@A(<8cXX$x8'Hn~#x~ijxKHĐȐ@Ԑd!d| ֐;x<8X88H |=?9)$;0 }#KxH y<8cà}{x8H ]y<8cà}sx8H ]e<8cà8@8H ]QH u5x$x8PHn5/| A0|H@,<8cY$x8FHn<8cYL$x80Hm=`C0=?ɩʔlđah(=?Ĥ`$! lđah(`$! lđah(=? $lh(L`$Llh(D=?8`$Dlh(H`$H8a<8Y|88H {;@;~#x<8Ȁ|#x<8~dzx9<9!K1<;7A<;a;|{}> ?8c888H z;7@;8a<8Y8 8 H y,@ ;@H88a<8Y88H y,@8a888H z=8,A,@A8|x,@<8cY$x8HHk;:=?:Y:`:@Aax88<886H x$x86Hkq=?9)<;0}#KxH vL=?8r <8cà8 8H Z9H rx$x8PHk=?9)T}#KxH vq=? Ĝ2$<8cà8$8H YH qx$x8PHj=?9)l}#KxH v%<8cà8D8H YH qx$x8PHj=?9)}#KxH u<8cà8H8H YuH qYx$x8PHjY<8cZ$x8AHjE<8cZT8L~ųx&x8H@l<C0=?ɩʔh(=?P=?Ȅk:(!,U)029)!P8,@؀TX=?9)à!8!<T7|H@} Kx080@X0|H@} Kx484D=?9)à!H!L8PP=?9)Ǽ!T8X\`dh!!l!p~#x<8|+x|+x|+x9!T9AXK%H8,@88!!<~#x~x~x<8@}{x}sx9!P~ʳxH;@,@~#x<8@<8|+x|+x~ȳx9!<9A\K @7AP?;;0?`C0=?ʔ~#x<8|#x88~dzx9<9!\K ~#x<8|#x88~dzx9<9!`K \,@!d|H@@<8cH sM<8cà8\8H VH nx$x8PHgHp!\9i}k9 | } HP9I| AD|A8}+i}*JU):})`lēa( 7A(K<8cZd$x8CHg-8H4/| @| x/n| @| xn8!|N |!Bah|#xp|3x|;x}Cx}4Kx}SSx= a)|H@L,A 8H,A 8><`| A$=)9) ><8cQd8HrH!p ,A 8H8T< ~#x<8<8D8 8~x9!9AKр,@TA,A />@8@<\<W~eWl,# LL  #LlL,l H ;, A<!PW=_W<|f||!`<\f\|HAP[`; 8;Ah8!`HN |B}|<=lUUdDGgDDddN |hB}|h<=ldUHUD#CGCC#N |!B|yx|#x|+x|3x|;x}Cx}5Kx}VSx(TX= a)|H@d(, @ | @ 8H 5, @| @ 8><`| A$=)9) ><8cH8#HhH;#xxH||xpt;=?;iI:xAxa|x8x8p<8ư48H i<8c<8I<8x8x9 9@H9,@\#x8@xx8H%<8clH }8a@8HE|ex<8c8@H IH Y<8cH M6} HP9)!<8c88H I4} HP9)!<8c88H IeH !< ,A8a<8I H8a<8I,8 8 H ha<8cH <8c48H I <8c88 H HH !8 ,A<8cH <8cH aH ]<8cH Q!L =?<8c88H HH !<8cH !P <8c88H HYH <8cH <8c~x8H H5<8c~x8H H!H <8c H ~cx\Hq|ex<8c~dxH GH <8c H y~Cx`HA|ex<8c~DxH GH U<8c4H I~#xdH|ex<8c~$xH GH %<8cHH ~xhH|ex<8c~xH GaH <8c\H <8c,8H G=H <8cpH <8c08H GH <8cH <8c@8H F<8cD8H FH u!H ,A<8cH YH U<8cH 8!|N |!B|vx|#x|+x|3x|;x}Cx}1Kx}PSx(,= a)|HA<8cDp8HcH08;! #x<8D8F8FH eE8a <8D8F8FH e-;ACx<8E 8F8FH e8a<8Eh8F8FH d8a <8E8F8FH d8a<8E88H d8a<8F 88H d8a<8F 88H d8a<8F488H d88;;a`cx<8FH8<8B9}rAH }8~hrVb<|b.}}rUr<}2.|;x|h}IPUF:|b<g9A0H/@$<pX|h|#x@U<} }{x@8}|= UUa#UV|U<~B}f~OBT<|}F|*T<8VF<9K*:s|.|pE9J8}}~F.}+}bp88HP}=PU":~Bb=r8 AH }8~G}(rU"<|.|hr|;xW<|.|0PT:} bbS;B||ErTJS0r|HP:b88 9 }s)8A0~]@PW:~I|Dbb8B,})@8B|HW :}@b|XP>j@84F88@(9k|Hx<?>@= }b[x=T~H}j[x|#xAl:e|dP|iW:| `.,@(|@ |Jx>A|HRT|xH$| `.,@|P@H =|<@!H8H =<_=?BHH8H|r9@L`,dT?>U<5~x~mx~0P}sxAh=<H<?U<<FH} |rEh~j}5BGHT:RvX}~1@|H ,@>!:MX~hA?<_U<^~x x~0P}sxA|=U:RvX}~1@hH@,@>!:MX~hA$?<U<~x}P}sxA<?U<~8T<=}U|}vRH?<|n]|jH:T<:+Tx<]x|p@|.}. PH4>a}~т@4H,@(<:MX~hA}r<=_U:RvX}~1@?!`H.A8?>d>?XHHMH;nz~Oq<dLH,@$ @8c8@88H C;7@;;G|z}> @8c8@88H B;7@8x8!p|!N |kx,@(| t,A, @9)H,@`,A| tH| t|t,A, @9),@8cU @.} H<,@,A| t|t H| t|t | t,A, @9),@8c, @9JU @.} U @.} RH,@,A$| t|t | t H | t|t | t | t,A, @9),@8c, @9J, @9kU @.} U @.} RU @.} Z}#KxN |A!@B||x|#x|+x= a)|HA <8c#8 H><``cH`8c<8`ex<8Ɔ K|}x8|<8Pex<8Ɔ Ka,AH=?9)z\;@}#KxH =9<8c 88H H 8xx8PH1H8,@H\8,AD,@8H8,A$,@8H, @88,@ 8|8ex8K|zxH<` = a)|HA<8c#8 H=eCx8!|AN |Ԑ!pB|vx|#x|+x|3x|;x}Cx}9Kx}WSxaȀ= a)|HA<8c"8H<8|<8Ex<8ƄHK|}x8|<8Ex<8ƄHKɐ~,@8D,@DHH\8,AD,@8DH8,A$,@D8H, @8D8HD,@ 8|8DEx8HK)yHX<` HH,@ ,A,@,@8|H@ 8H 8|<8Ex<8ƄHKaL,@ DH 8D>D|I֐PT:@~óx8L8@8P~xhxH;`;7AW:|{<8Ex<8ƄHK)}D{;7AHK8|<8Ex<8ƄHKy8| <8Ex<8ƄHKѐy88!|N |!B|;x}Cx= a)|H@X,A 8H &, A| @ 8><`| A$=)9) ><8ct8 H:HH<8灼9@9!DKm@,A(,A <8ct8 H9<` h8!`|N ||&B|+x!<8|#x8a@88ܑA;@H <:@#%::I,AA8 @,AA,@}7Kx; ;@8@9 .!ܐA/ ;@x~x]9l/ j@}H =|~xH9t, @<_ cx888H ;,A0/A,. A$A,@,AlH /AA/A,a.A TC:H Y8|~yA؁-}{x| x@}/Kx!|H@|+x~ I:|x;`:~@4?:u/A,@, T:|2e@~}80Z~x:@H=h%C:d,r@cH |sxH =l%K*8 i :@HV~;1~pU&;Z.U@l@h! <U:W:9!@8@e%V<}KJ|"A~9@a@,@X!z U`:||r~c(8|b0~x@Z:@H!K ~g^0UH:~KP|rD|8;@ HaCr:k/r@cH |sxHl9#c,:@Hh.;8A88\P(~H8|&0p~0|V8A|K8|0@/@@9F|P@4W$ W >@AA8 X8!P~|Ё N |!B|~x= a)|HA<8c8"H3)H$<8czdxHw]xH1ixHvX8!P|N |!B= a)|HA<8c8$H2H=?) X8!P|N |!B= a)|H@X 8 LAA LA@ 8'<`| A$=)9)"'<8cT8H1H0=?)    HaX8!P|N |A!B|}x|#x|+x|3x|;x= a)|H@X,A 8H $, A| @ 8><`| A$=)9)"><8c8H1HT8aP8T8X8\xH E8a<<8cxxxFx8P9T9!X9A\HxH"a8!|AN |!B|vx|#x|+x|3x|;x}Cx}1Kx}PSxX\`x= a)|H@X,A 8H $, A| @ 8><`| A$=)9)"><8c8"H/H$=?)@ ,AxH!ma8<@8DH8LPT<8cw<8~x~fx<8w=9~ɳx~xH:><`| @(<`<8cx8)H"H8=?)@ ,@Ā,A, A8d;=?)\9)!=?!)X9)!=?)X9) !=a=?9)wБ!=9w=?)X9)!=?)X9)!=?X94X9ă)X;9X9ya8L99ܑ!9yla<8cw8d8h~&x~xxHtuh,@~#x~x8l8pxH=p,@=?)\ ,@ll,Aap,@a ,A<8cw8txHt,A!!8aa<@8PDH<8cx8X!~Ƴx~x~hxa9+9KH xHxH+ap;8Hp,A,@l;p,@9 8<8cw|dx<8w|+xxHQ%<8cw|dx<8w|+xxHT1<8cw<8w|exxHE<8cw<8x<xH;!!8<@<8cw<8x aX8\<8w<8w=9x=?9)w} CxH=MpU:P`9}Aց!|fJa|Z|z|r8`}BxxHxHpU:9}Aր|f!|Ja|Z|'x}BxxH8ax8|88xH8a888xH:8ax8|88xHO8a888xHRH8Hh,@(,@p9 !p;9`xHX!h, @d, A!h, @4d, @(;8~x<80~x8H ,ip,@`p,@,8|!~x|"~xxH$8H~x<80~x8H ,p,@=?)@ ,A4<8clH UE~x~xHF |ex<8cw~xH H S!=?)@ ,A4<8clH U~x~xHE|ex<8cw~xH IH R݀(8! |N |H Y!`|;x}Cx}/Kx܃䁡= a)|HA<8cH8H)aH=?)lÉIéi \X) x,@894Ap8a`=?l8l8l88l8U :}K}+" \}+* |}+2 L}k: l94@8a888xH8<8cp<8q<8r<<8qPxHQ888<@D8 H<8cp|dx~x<8q8=9e9!9AH]:;: ;` ;P=?Ip::a?@cZ;8a`<8`8P8PH )8a<@<8cq8<8e<8p89`9!9A K,@,A<8cp8xH,AX8a<@DaH<8cp|dx~x<8q8=9e9!9AH]xHxH%e;H,A,@8a`<8`8P8PH ',A8a`<88P8PH ',@ : H8a`<88P8PH 'u,@(~x~x}{xx}kxH Q;:HX8a`<8P8P8PH '1,@8H(8a`<88P8PH '|cy@ n;,AH8a<@DaH<8cp|dx~x<8q8=9e9!9AH|A;,@,A<8cpxHm=?)lӉIөi \X x,@894Ap=?l88a`l8l88l8U :}i"}I \ }i* | }i2 L }): l 94@=?)l),A<`8!H T|!B= a)|HA<8c 8!H$}H,=?)    X8!P|N |!B= a)|HA<8c 8H$H,=?)L    X8!P|N |H S!|#x|+x|;x}Cx}6Kx}WSxAaa!8x}{x= a)|H@,@,A 8Hh$, A(| A', A| @ 8H0h@ 8 H h@ 8;<`| A$=)9)";<8c @8H"H<8cjdxHXѓa88al8p8t8x8|99!9AH-8a888gxH=`C0=?iqlTaPPX(l\aXɁXX(``$=?lh*`Ad|(l\XX($(`$=?)x       `;7A<=?;~P8|!|c|"8P&xH ";7@=?)|=? o =?ÉnHL@A`=?)|=? m L@@=?ÉoH4=?)|=? k| =?ÉoL@A =?ÉnD<8cj<8k8lfxH9<8cj8pexH/ ~óx~xEx~fx<8j|;xixH0?C0=?ql\XX(o~óx8Ex|#xgxHi<x(2!9)m)!\XX($=?m,`( .\=?9)j!8=?9)k!C0=?q=?)l=?Im =?io=?Énp>?x:x;1x;98Qx;ZȀ,@ 9<}i| } HP9IH9|}+9I})}iXP;8 l\XɡX(hz|l\X(`<nzfnѡg:с9}A8a888x8X}Bix}{xHW:}+ }+ }+ }k ;7@8a888gxH8a888gxH+8a888gxH@8a888gxHC<8cjdxHRa8!PH LD|!`B|sx|#x|+x|3x|;x|;x= a)|H@X,A 8H $, A| @ 8;<`| A$=)9)";<8c8HuH =?) ,A|<8cZH FeH Da;7AL<8cZH FE;x~xH7|ex<8ccxHH D;7@<8cZH EH C8a888gxK8a888gxH8a888gxH)8<8a<88P8PH 184;@;9=?::@ 9P> b1?c :~x,A<8cc@|dx<8cd|+xgxH>U<8cc@|dx<8cd|+xgxHAa88<8@8 D8H8L8P8T8 X8$\8(`8,d80halp~cx~x~x84899!9AH;,Aa8;Փa88<8"@8D8H<8cc<8|ex<8|gx=9|ix=_9JYH(1|@ H<8cY8H1),@<8cc@<8<8cH<8Y88hx9 9@H{8,@\;7A08|!<8ccH|"ex~xHω;7@<8c[H :1H<,@;|A;@,@P8a888gxH88a888gxH;ŀ8!|N |H D!0|wx|+x|3x|;x}Cx}=Kx}YSxaA Xx= a)|H@,A 8HT%, A| @ 8H4 8 LAA LA@ 8;<`| A$=)9)";<8c8HYHd<8c[HdxHI},A 8\9 !`9 !lH8\8`8lh<8c[H<8[8\fxH+<8c[H8`exH!U,A(=?i^0X$h(dX$d`(k.dxxx&x8dhxHÞdh(h(H8xxx&x<8[H|;xixH"EÞý`(lT<C0PP=?ɩb<h($;;7A08}|x|uDxH-|@||x;7@;,@;=?)=? `8 L@@=? ]Hd=?)=? ^ L@@=? ]H8=?)=? [ L@@=? `t(t;7@<8c[pdxHF-8!кH @|!B= a)|H@\(@ 8H$,@h@ 8 &<`| A$=)9)"&<8c8"HUH$=?)   X8!P|N |!B= a)|H@@(A(,@,@,A$<`"<8c8"HH,=?)4    X8!P|N |!B|ex= a)|HA<8c8H%H<8cU`<8UHWYX8!P|N |!B|~x= a)|HA<8c08H H8a P8 TxHy8a X8 \xH0 P,@ 8<8cU|dx<8SlH P,@ 8<8cU0|dx<8MxHh P,@ 8<8cUH|dx<8NH@ P,@ 8<8cUH|dx<8N,H P,@ 8<8cV4|dx<8NDH P,@ 8<8cUd|dx<8QHȀ P,@ 8<8cY|dx<8NH P,@ 8<8cUX|dx<8R(Hx P, @ 8<8cU$|dx<8RdHP P, @ 8<8cU0|dx<8RH( P, @88<8cU`|dx<8M8 X8 \9 T=?9)Y9APH<8cY8 X8 \8PxHV x8! p|N |!B= a)|HA<8c8H YH,=?)    X8!P|N |!B= a)|HA<8c8"H H=?)8  X8!P|N |!B= a)|HA<8cD8H qH,=?)    X8!P|N |!B= a)|HA<8c8!H H=?)D  X8!P|N |!B= a)|HA<8c8H H,=?)    X8!P|N |!B= a)|H@ #9)( '@$<`"<8c@8"HHH=kp#U):})Z #U):}+J T:}k <X8!P|N |!B= a)|HA<8c8"HYH=?)  X8!P|N |!B= a)|H@Th@ 8 Hh@ 8'<`| A$=)9)"'<8ch8HH,=?)L    X8!P|N |!B= a)|H@( @ 8<8c8!H H=?)p  X8!P|N |ۡ!B|}x|#x|+x|3x|;x}Cx}6Kx}[Sxh|= a)|H@,A 8Hl,A 8HX,@*|H@| @ 8H,,@7|H@| @ 8><`| A$=)9)"><8cP8HH8 ܀T:} |.h(=?éNo|T:} |.h(o|;U):}) (oz7U):}) (oz8a888xH\8a888xH8a888xH)58a888xH]8axH ,AP7} HP9)=`C0=_ɊTm)!a`(`h(k$;} HP9)m)!a`(`(h$k$=? N LA@T*rrX$`(`*8a888xH38a88Hh*=? N2`(2`(`*8a888xH3q8a888H,8a888xH3=8a888xH*8,A8Ԑ8<xDx~xx~dzxhx~x9AHEm(a9@5kA8`=C0=?ɉT=?INUI:}):8 lɡ`(hP*l`($*ѩ9J5k@xH%xHU8=?9)N@!<8`@8ܐDHxDx~x&xxx~ɳxjxHxHalxHqapxHEatxHxHxHxH}88!0|ˡN |!B|~x= a)|HA<8cH8HiHt8a@xHA@,A\<8cHxHE<8cGdH V5<8cI$<8dx8H<8cGlH &8@8a@xHAh8!`|N |!0B|rx|#x|+x|3x|;x}Cx}1Kx}NSx = a)|HA<8c8 HyHĀ,@dh`Hdh(=?H$k<d$U):})* (k:h1U):})* `/U):})* x,@l|ptHhh(=?H$k<p3U):}) (k:t.U):}) l-U):}) |?;ԓ8;`<@;@AD;`*aH;L<8cG8d8h|fx<8|hx=?9)|jxH+8;!l!<@ADaHL<8cG8p8t|fx<8,|hx=?9)<|jxH*œ8:x<@ADaHL<8cGx8h|fx<8h|hx=?9)x|jxH*y8;|<@ADaHL<8cG$x8t|fx<8|hx=?9)|jxH*-~Cx~x~ųxx~'xxH@~Cx~x~ųx~x}{xxH@~x~dx~x&x}sxxH@i~x~dx~xx}kxxH@M8!|N |!B|~x= a)|HA<8c8 HaH8<8c<8D<8Cpx8Hc<8cCpxHـX8!P|N |A!@B|~x= a)|HA<8cL8HH8adxHY8h8ah8l8p8t8`9xx9@H1!x9)d| @| x!x?;l88x<@8D81H;L<8cD<8D88d|fx<8|hx=?9)|jxHx,@h8;h<@8D8*HL<8cD|dx8d|fx<8|hx=?9)|jxHx8l8p8t8`9|x9@H)=?9)!88l<@8D8BH8L<8cD<8D8|ex|fx<8,|hx=?9)<|jxH?;뀓88p<@;@ AD;`0aH;L<8cD8<8D8|#x<8D<8|3x=?9)|3xH&͓88t<@ADaHL<8cD8<8D8|#x<8D<8|3x=?9)|3xH&y89 !<8@!D8H<8cD<8|ex<8,|gx=9L|ix9A`H5H 8h8ah8l8p8t8`9xx9@H8ah888899!xHa8 @hA 8?;88<@8 D8H;L<8cD<8D8|ex|fx<8d|hx=?9)p|jxHՀ,Aē88<@8D8BHL<8cD<8D8|ex|fx<8,|hx=?9)<|jxHq?;뀓88<@;@AD;`$aH;L<8cD8<8D8|#x<8D<8|3x=?9)|3xH$q88<@ADaHL<8cD8<8D8|#x<8D<8|3x=?9)|3xH$88<@ADaHL<8cD8<8D8|#x<8D<8|3x=?9) |3xH#ɓ88<@ADaHL<8cD8<8D8|#x<8D<8D|3x=?9)\|3xH#uH8h!|H@} Kx`8ah888899!`xH8!|AN |̐!@B|~x= a)|HA<8ch8$HH8a`xHA?;猓8?;{<Гa<@8D;@8AH;(L<8c=|dx8`|fx<8|hx=?9)|jxH<8c<8d8h8l8p9t9!xxH 8:d<@8D8/HL<8c=<8C<8>p|fx<8|hx=?9)|jxH-<8cL<8=8hx8H\]?;d8;l<@8.DAH;%L<8c=<8> <8?|fx<8|hx=?9)|jxH!I8;!p!<@8-D87HL<8c=<8> <8?X|fx<8|hx=?9)$|jxH 퓡8;AtA<@8D89HL<8c=<8C<8?X|fx<8\|hx=?9)t|jxH =?>x|=?>$|88|<@8D8,HL<8c=<8><8>|fx<8|hx=?9)|jxH |$x<8c<~x8hx'xHx9!xxH;9)a`| [|Y} HP;8!|N |Ԑ!PB|~x= a)|HA<8c8#HYH8a`xH?;欓8??;99p!<@;D85H;@(AL<8c:|dx8`|fx<8|hx=?9)|jxHM8<8c9p8d8h8l8p9t9!x9A|H͓8:d<@D8/HAL<8c:|dx<8:|fx<8|hx=?9),|jxH<8c\<8:8lx8HX?;p8:h<@;D8)H;`aL<8c:<8:<8;|fx<8|hx=?9)|jxH品8:p<@8D8+HAL<8c:<8:|ex|fx<8|hx=?9)|jxH퓡8;t<@8D8%HaL<8c:<8:<8;|fx<8 |hx=?9)$|jxH18;x<@D8$HaL<8c:<8:<8;|fx<8L|hx=?9)d|jxH<8c<8:8|x8HWi8<8c9p~x~ųx8l~xxx9A|H99)a`| [|Y} HP98!|N |!@B|~x= a)|HA<8c\8"HH08a`8d8h8l8p9txH>:倒8:`<@;`aD:/H:`(aL<8c7P|dx<87|fx<8|hx=?9)|jxH<8c<87P8hx8HV%?;8:d<@8'D: "!HaL<8c7P<87x<88p|fx<8,|hx=?9)T|jxH8:l<@;D;+HaL<8c7P<87x<87|fx<8x|hx=?9)|jxH8;!p!<@DHaL<8c7P<87x<87|fx<8|hx=?9)|jxHa8;AtA<@;%D:@;AHaL<8c7P<87x<87|fx<8|hx=?9)8|jxHe~x~x8h~Ƴx'xHxxH ~x~x8h~Ƴx'xHxxH 8<@8DHaL<8c7P|dx<87|fx<8t|hx=?9)|jxH<8c<87P8hx8HT8<@D!HaL<8c7P<87x<88p|fx<8|hx=?9)T|jxH8<@;DHaL<8c7P<87x<87|fx<8|hx=?9)|jxH8!<@DHaL<8c7P<87x<87|fx<8|hx=?9)|jxHa8A<@8#DAHaL<8c7P<87x<87|fx<8|hx=?9)8|jxHm~x~x8h~Ƴx'xHxxH8!|N |!B|~x= a)|HA<8c8"HH8a`8dxH=?9)ԑ!88`<@9 !D8H!L<8c2<82|ex|fx<8|hx=?9)|jxH`,A$<8c<828dx8HQ8a`8dxHA8!|N |!pBa|#x= a)|HA<8c$8#HH8aH<8c0888xHU! ,A::a 0;;:A :!?;0??;90: 990:<9 :xxx4x8~cx<8H8F8FH8a v<88F8FH8a<888Hi8a<888HQ8a<888H98a<888H!8a<8(88H ēȓ̓~Cx<8<8<8<`| A$=)9)"><8cܨ8HH;} HP9), @l<} HP9), @T8a<@DAHLP!TX\xx~x}{xHx~xjxH+=H;} HP9), @8atxH18ax8|xH݀t! | p8ax8pxHw]8|9T:8<`| @8xx~xFx~xxxAH8atxHE8ax8|xHt! | p8ax8pxHvq8<@Dx~xx~hx}kx~JxH8ax8|xHv-8axH8!|N c(|x|HQM U :}kR9(})ր})U):})* 94M K|A!B|}x|#x|+x|3x|;x= a)|H@|h@8 <8cHH<8cH<8c@x8H9H<8c H<8c@dx8HHЩ<8c Hҝ<8c@x8HHЅ<8c4Hh@8<8cHHUHQ<8c\HE<8c@x8HH-<8cpH!<8c@dx8HuH <8cH<8c@x8HQH<8cH<8c@Dx8H-H><`| A$=)9)"><8c 8H}H,=?)    h8!`|AN |ؐ!@B|}x|#x|+x|3x|;x}Cx}9Kx}XSx= a)|H@d,A 8H,d, A%| A | H@ 8><`| A$=)9)"><8c48H}H8ap8txH<8c`|dxxHm8x88|<8@AD!HLPTX\x<88|#x88~x~ɳx9AH-8ap8txH8!|N |!B|~x= a)|HA<8c8!HyHHt)8a@xKqy@,A ,@ 8 H@,A ,@ 8 D<c8xH<8c<88DxH<8cxHxHsxHq<8c <8<h8x8 Hh8!`|N |ܐ!`B|}x|#x|+x|3x|;x}Cx}>Kx}ZSx = a)|H@|,@,A 8H8$, A(| A', A| @ 8><`| A$=)9)"><8c8HH`8a`8d8h8lxK}8h88l<@ADؐHxdxxx'x~x9!`9AdK~8!|N |A!B|}x|#x|+x|3x|;x= a)|H@X,A 8H $, A| @ 8><`| A$=)9)"><8cӸ8HHL8aP8T8X8\xK|8<<8c|8P8T8X8\xixJxHq8!|AN |!Ba(|#x|+x|3x8}Cx!@}\SxH!LAPTXa`dhlptdrx= a)|H@,A 8Hl,A 8HX ,@9|HA| @ 8H,,@:|HA| @ 8><`| A$=)9)"><8c8H!H|9} HP9), @x:} HP9), @`8!<`| @8xx}{xx~xHxIxAH8atxHA8ax8|xHt! | p8ax8pxHjm8<@DCx~xEx@~x!\~jxK8ax8|xHj)8axHw8!|N c(|x|HQM U :}kR9(})ր})U):})* 94M K|A!B|}x|#x|+x|3x|;x= a)|H@X,A 8H $, A| @ 8><`| A$=)9)"><8c8HHP<8c88P8TxH8a<<8c`xxFx<8`|;x9!P9ATK 8!|AN |!B|yx|#x|+x|3x|;x}Cx}>Kx = a)|H@,A 8H\,A 8HH'| A| @ 8H$(| A| @ 8><`| A$=)9)><8c8HMH(=|HA;|H@`8a@8D8H8LxK@,AD,AL,@$<8c0|dx|ex|fxxKH=}iP9k}kp}k, 2@9`2;})P9)})p}), 2@9 2| QA8| QA8}k|X@}`[x})|H@} Kxx8!p|N |a̐!B|zx|#x|+x|3x|;x}Cx}4Kx}SSx\halx= a)|H@P,A 8H<|H@ 8><`| A$=)9)"><8c8%HYH8a888xKs88<<@@DDHHLLPPTT8X8\8`8dXhl`pdtxa|pt|Cx$xx~x~dzx~x~x~jxH݀8!|aN |!B|~x= a)|HA<8c88HH<<8cތ<8`xH-<8cތxHY<8c8xH⩀X8!P|N |a!pB||x|#x|+x= a)|HA<8c8HeHx|#x|+xH==,@8a`<888H`,Al8`8<80@8D8"H8L<8c<8<8ݨ<8|+x=9,|+x9A`H!Hh8`8<80@8D8"H8L<8c<8<8ݨ<8|+x=9,|+x9A`Hᅀ`,@8a`x8Hi-cxxH<,A8<8cPx8(H<8cݨxH<8cxHՀ8!|aN |!B= a)|H@ #9)( '@$<`"<8cȤ8"HHH=k#U):})Z #U):}+J T:}k <X8!P|N |!BaHLP|3x|;x}Cx!`}PSxlp= a)|HA<8c8HH4::A:a:=?9)ߌ!=9kߤa=a=?)9)!;,A ~#x~$x`~xxKw=́!H ,A~Cx8PLH~cx~Dx8P8PH8a`8PPH~x8`8P8PH9ap!Бi<8cߌH~cx8PHOI||x;~cx8PH|P<8c x8Hu!~x8PHO ||x;~x8PHi|P<8c x8HtH9ap!ԑi<8cߤH)H}kxtH%|fx;x}kx8dH;px8PH,@Xx8PH|yxx8dH|xx!xxAax88<8t8dHY,A ~Cx8P}{xH8a`~DxH8a`<8,8P8PH-88d<`| A$=)9)"><8cĨ8HmH;8;<;aa@D8a888899!9AH8a8xxxHU8a888xH}8a888xHQ8<@DHpLtPxTX\`dh8a8exFx'x~hx~Ix~*xHc8a88889xHUu,A<8ctxHm8a8xH =?Drh$=?9)֜!8=?9)!<@8a8888=9֜=?9)=_9JָH<8ct88xH ~óx~xH|gx=?ּr=?ۄk<8a8~ųxxH88!0|N |!B|xx= a)|HA<8c8HH|;;=?)x;9PIx;ZTix;{Xx; W:|e|||xHE;7@=?)x8 08 48 8h8!`|N |a!B}+Kxa= a)|H@,A 8Hl,A 8HX,@(|H@| @ 8H,,@+|H@| @ 8><`| A$=)9)"><8c8HH8,@ A8a<@D}i[xH1Hl,@A8<@}i[xHHH,@A8a<@}i[xHUH$,@8<}i[xjxHq,A LA@,@0<8cx8CH}%=?h(H,<8cDx8FH|=?h*<8cx8H|<8cx87H|x8!p|aN |!BaHLP|3x|;x}Cx!`}PSxlp= a)|HA<8c8HH<::A:a:=?9)ԑ!=?9)!=a=?)t9)!;,A ~#x~$x`~xxKlḾ!H ,A~Cx8PLH~cx~Dx8P8PH8a`8PPHm~x8`8P8PH8p!А <8cH~cx8PHDY||x;~cx8PH|P<8c0x8Hj1~x8PHD||x;~x8PHy|P<8c0x8HiH8p!Ԑ <8cH9H}kxtH5|fx;x}kx8dH;px8PH ,@Xx8PH|yxx8dH|xx!xxAax88<8Є8dHi,A ~Cx8P}{xH8a`~DxH8a`<88P8PH=88dffbfg:aP8} })&p| p}+HP)(})P9)!PW:!|J!|J|T:|T:}U:}:U):}[UJ:|T:|8a<@~x88|j|r}z})}JH;7@\8!|N |ؐ!@B|}x|#x|+x|3x|;x}Cx}6Kx}XSx= a)|H@,@,A 8H %, A| @8HXe95kAH8U:} I, @ } )| A | H@95k@ā><`| A$=)9)"><8ct8HyH8ap8txH-<8c,|dxxH8x88|<8@DHLPTX \xxexFx'x~x~ɳx9AH8ap8txHe8!|N |ۡa!B|ux|#x|+x|3x|;x}Cx}<`| A$=)9)"><8c8Hx!Hl8a88xKT:} |.h(=?épo|T:} |.h(o|8U):}) (oz;U):}) (oz8a888xK)8a888xK8a888xH}8a888xK8axKU,AP;} HP9)=`C0=_Ɋm)!da```(`h(k$8} HP9)m)!lahh`(`(h$k$=? t LA@T*rrX$`(p`*t8ap88t8xHx|8ax88|Hh*=? p2`(2`(`*8a888xH8a888H,8a888xH8a888xHxHAa8;aa<;@;DH~xDx~x~x~gx(x~ɳx xHxH-xHaTxhHaXxlHexx<8P`xtHExH xH xHa\xpHcxxxxKdр8!|aˡN ||@&ۡAA!B||x|#x|+x|3x|;x}TSx!ăaȀ= a)|HA<8c$8#HtH  8 LAAD 8LAA,,A 8H>|H@ 8;<`| A$=)9)";<8c$8#HsH=?)` ,ApcxKe =?9)H!8!C0=?ˉ,=k|Pllhh(h(h$llh(*9:})ր})U):}) *| xP7A?`C0=,8;olahh(*| T:|.*8a888'xH!x7@;Z7@<8c`$xH}a$xHQ#xH#xH#xH}#xK<`| A$=)9)"><8c8!HIiH/=?i6T,A8x<8~ųx8HJ;-x<88P8PHJ;,x<88P8PHJ8<8 @8PDHL<8c<8H|exx|gxx|ix9AMH><`| @4<`,A<8cHsHq8HL=?)6T ,A4<8cHsex~ijxHd-|ex<8cxH*HqA8!P H.l=?)6T ,A9@AM8 H 9`aM8aM8M8M8M xK8aM$8M(8M,8M0xHV<8c|dx<8|+xxHk<8c|dx<8|+xxHn<8c|dx<8|+xxK<8c|dx<8|+xxHw8aM48M88M<8M@xK";+x8)x88H=8M8MX=?)70 8x<8T88HG8\,A8/M|=?)708 <8 8 8a(x8~ƳxHHA49)( A=?)hH =?)p!MT8a+<8T88HG9,@h:! | Hh/!@| ,A<;(x8x88H؉xxx88HH;x<8h88HGy8aMDxx8HMD,A<8chx8)H+=?)t, A ,@8a<.8PXH,=?)x, A(,@8a<.8QX88HF=?09)'!88MH<=?.9)RX!@=?/9)!D=?-9)PX!HL8P8T8PX8`\8a<8<8(<8Ɨl<8|=99!MD9AMLH8MD,@,;;@;`'A8a<<8cx<88MD8MP9<9!xHeMD,A<8cx8.H7MD,@T<8cx8H7}xx8H7mx8MDx8H=MD<8cx80H`MD,@<8cx8H@MD,@<8c0x8H MD,@<8cPx8*H6MD,AMD,@)MP9`4A(=_09J9Ui:})R 9k4@;<;a;A-P; '!8<8c8MPxfx|#x=09IxxH;M`M\<8c|dx<8,<8ƒPxK3=?9)!88MH<=?/9)!@=?-9)PX!D=?.9)RX!H8MTL=?9)!P8MPTXa\A`8MXd=9kPah8M\l=?9)D!pat8M`x=?9)H!|P$88`!88aM48M88M<8M@~gxO!P9AH%8Md=?)6T 9 !M!@j,@&=aMK70;Z=̒`=?9)!M=_9JAM:@=9kD9kaM=ˬ=?É=?9)!M=_9JAM=.9kRXaM=/9M=?-9)PX9)!M=_9JAM=9kaM=l =?)709)(!M=?)709)<8c<8PxHKih($L!M!8AMA<@<8c<8 8L<8ƒ<8=9$|ix|jxHMA88Md<9!Mh!@9A(БAD9aMlaH9MpLP8TAX<8c|dx|ex<8Ɛ|gx99:9ZH)Md,@8MdH0Md,@9 !MdHMd,@ 9@AMdMd,AMd,@@8aMl8Mp8Mt8MxxH݀Mt,A,Mx,@ 8a!M|J8 8HAM*70Ml  @<  @0Mp  @ @8a<8HPAM*70Ml @H  @m<8c<8PxH3Ձ!N!8ANA<@<8c<8 aM7080<8ƒ<8=9$=?9)} CxH6 !N PL8i8888L=9x9@HxKY!N8i888}'Kx=9x9@H8a8MDx8HрMD,@ 9H<8c|dx<8x80KH8a<88 8 H%,@<8c<8|exxH= <8c<8PxH2q!N!8ANA<@<8c<8 aM7080<8ƒ<8=9$=?9)} CxH4!N PL8i8888L=9x9@HQxK9:Hp8a<88 8 H$,@ aPPP xP(KH48a<8(8 8 H#,@<8cxHY:H8a<848 8 H#,@88#<9 !@9@AD9`aH<8c<8@|ex<8ƒd|gx=9|ix=_9J|H5%<8c|8H>1|cy@0!NȐi<8cH8cx<888H#Ht9@!N̑IaNaN܁N䑁N؁!N؁ANܑ!LAL9@AN9`aNЁ!NЁANԑ!LAL<8cH8cx8L8L<8ƒ8HIE:H8a<88 8 H"q,@88 <9 ,!@9@AD9`PaH<8c<8|ex<8ƒ|gx=9|ix=_9JH3:<8c8PH<,@$<8cH8c<888PH <8cH8c<888H"y,@xM,@l!P ,A9@AMxNLL~ѳx:L!L8a+8L8L<8ƒ8HG!N!89AMA<@AD9`!aH9L<8c<8|ex|fx8+|hx=?9)0|jxKUM! i,A0<8c|dx<8,<8ƒPxK:H8M|| Ad, ~A\x<8T88H ,A<;!#x8H;e,@#x8H;Q||x;#x8H;9|Px8M|88H %,AHM8M#x8H;aML8M|Lԓ!Lx8L8M<8ƒ$HN8a8H:ŐaN!NAN!LALN9aaN!NANH:]?;]=?É_t=?b.=?é^H8~Z~ P~xx:999<8c]<8]|exxH+<8c]<8]xH!8a888<8]|;xxH"<8c]|dx<8^<8]xK1h(o889!!<@D8H<8c]<8]<8`<8^ |3x=9gp9!9AK!8<@<8c]|dx8<8]<8]=9]|ix|jxH"h(o: (o AP8a8 Exx8H?h(r o 8a8 8x8H8a8 Exx H?<8c]<8^8xHy!8<@<8c]<8^8<8]<8]=9]|ix|jxH!h(oh(ro8<@DH8LPTX<8c]|dx|ex<8` 99!9AHi=,@84H̀,A,@8a88 8$xH$,@8,H$,@ha|dxx$K84<8c]|dx<8]|+xxH3<8c]|dx<8]|+xxH6H$,@;,@8a888xH3u8a888xH64,A<8c]xHW=?)T ) i\IX~`x,@894Ap=?T88apT8T88T8U :}i"}I }i* , }i2 }):  94@=?)Ti8a888xK=?)<0 ,,A<` ,AD<8cgH9Cx H)|ex<8c]DxHMH6<8cgH8H6=?)< ,A <8cgH8H6H =?)< ,Ad<8cgH8Cx H)Q|ex<8c]DxHH6e<8cgH8Y~x~xH)!|ex<8c]~xHH65=?)< ,AX~x~xH(,@4<8cgH8~x~xH(|ex<8c]~xHIH<8cgH7H5~x~xH(!i}#Kx~x8(x~xHI8!d} H<||@&H L@@ 8><`| A$=)9)"><8cC8HEH|<8c?xH8u<8c? x<8>xH@<8c>xexxH9q<8c?0x<8? xH@y<8c>xexxH9=h8!`|aN |!B= a)|HA<8cB8!HyH=?)(  X8!P|N |!B|px|#x|+x|3xhl!pAtaA!= a)|HA<8cBP8 HH8axH8a8xH! | 8a8xH ;`;;:P?@cZ? c9,A`x8!|!<@DHLPaTAX!\~x}{x}sx}kxhl!pAtH*a;,Al8<8c=l<8=<8=|<8=xK当8<8c=D|dx<8Bp<8=8=9Hx9@KQ;;8ap<8B8P8PH18<@<8c=8<8H<8=89p9!9AKÙ,A,@8a8xHHH8ap<8B8P8PH,A(8ap<8B8P8PH,@;`;;H8ap<8C(8P8PH,@(<8c=8<8Ix8PKqHH8ap<8Cx8P8PHY,@xHH8ap<8C8P8PH-,@$<8c=D|dx|ex|fxxK]H8ap<8D8P8PH,@<8c=D8xK\=,Ax8!|!<@DHLPaTAX!\~x}{x}sx}kxhl!pAtH'xK[AxK<8c=D|dx<8Dhx8KxK;;|@xHH|A;`,@8a8xHyH8!@|N |!B= a)|HA<8c@$8!HH=?)`  X8!P|N |!B|#x|+x= a)|H@((A ,@$<`"<8c?8HH kTc:=?)9)|cJHLiX8!P|N |!B= a)|HA<8c?`8HH,=?)    X8!P|N |!B= a)|HA<8c?8H-H4=?)     X8!P|N |!pB|;x}>Kx = a)|HA<8c>8HH@`DdHhLlPp,A<8c7$8@8`xHL],A<8c7D8@8`xH#ŀ8!|N |ܐ!pB||x|#x|+x}:Kx}YSxȂ̃Ѐ= a)|HA<8c=8HHH=? 6 L@@0<8cCHH<8c5x8HHi8= a)|HA(<8c=8H)>=)9)">HxxH{Tc:=?)@9)|cJxHOQxxHPCx$xxHLy=?6h@ hhA87X!PaPTAPPTH D) =? 6!(=? 62=?6h$@8a@xHMY8!|N |!B},Kxa = a)|HA<8c<08HH8A8a<@DĐHȐL}cx9A`K!8!|N |!B= a)|HA<8c;8HmH=?)ؼ  X8!P|N |!B= a)|HA<8c;h8HH=?)P  X8!P|N |!@B|~x= a)|HA<8c;8 HH48a`8d8h8lxK8p=?9)3 !88p<;x@;DH8'L80P8a`8d8h8l<8;8=92=?9);`=_9J2Kvq8a8xKx h(cn h(k. h(cn h(k. `@\=? 2 @$=? 4 2=? 6D 2H(=?6Dr=?4r `@=? 4(ѡ * `@\=? 2 @$=? 4 2=? 6D 2H(=?6Dr=?4r `@=? 4(ѡ *,@\A<`@$8=?)9AH ? !A<`@$8=?)9AH ? !,@=?7 `(cn=?7 `(cnA<`@$8=?)9AH ?E !A<`@$8=?)9AH ? !<8c2|dx|ex|fxxK޵8a888xK98!|N |!B|~x= a)|HA<8c88H H8a@8DxH9@,AxH-<8c/D8H8LxH;1<8c/D<8/lxHA !P<8c/l<8/lxH! !T<8c/D8HxH !X<8c/l8LxH !\<8c/D8DxK8aP8T8X8\<8/l=9/DxK5x8!p|N |!B|#x|+x|3x= a)|HA<8c68HH=? .$ 8L@A,@ 8= a)|HA(<8c68Ha>=)9)">H8xHLqxxHM|Tc:=?)P9)|cJxHJX8!P|N |a̐!`B|tx|#x|+x= a)|HA<8c68HH|8a$8(8,80xKi8a4888<8@xKe8aD8H8L8PxK<8c-(|dx<8-L|+xxH <8c-(|dx<8-L|+xxH <8c-<8-TxK0=?/Xh(<8c-(8<82(80<8-(=9-xK=?9)-(!8=?9)-L!<@<8c-<8-d<8.}&Kx<8-(=9-(} Cx} CxK;x8~xH?x=?;i6 aГ;@; !ؓA8aP88<8-T8PH 0=?.h(<8c-(88Px8PH;x8~exH?9x=?:6(::8aP88<8-T8PH I0=?.h( <8c-(8 8Px8PHxK8a4888<8@xH8aD8H8L8PxH 8!|aN |!B= a)|HA<8c3X8#HH=?)Ϩ  X8!P|N |!B= a)|HA<8c38"HH$=?)D =?)@ X8!P|N |!B= a)|H@<#9)( '@ 8'<`| A$=)9)"'<8c28$HHH=kԁ#U):})Z #U):}+J T:}k <X8!P|N |!B= a)|HA<8c28"HAH=?) X8!P|N |!B = a)|HA<8c18"HH<=?)X      X8!P|N |̐!B|#x|+x|3x|;x}Cx}:Kx = a)|H@8,A 8:<`| A$=)9)":<8c1d8HH<x888GxKx888GxHɀ,A ,@T8a88FxH)9<} HP9)!PT:||8aP88FxH!H 8a8ExH59=? +L2с h$с h$<8c'88FxK<8c'8ExK},A ,@<|xHQA =?(;a;W=:}} h(}=g *ѻo<8c'dxxFxH}= h(g *ѻo<8c'dxxFxH;97A 4K0,A ,@<|x`HQA ;;=?(W=:}} h(}=  *Ѽ <8c'xxFxH%}} }= h( h*<8c'xxFxH}} h(}=g *Ѽo<8c'xxFxHu}= h(g *Ѽo<8c'xxFxH;97{A K,@<|xHQA hW):}i8k})8X\ , @8 ,@8ǐP88<8'99!PJxH[;97A K,A ,@Ѐ<|xHQA ;a;W=:}} h(}=  h* <8c'dxxFxH}= h( h*<8c'dxxFxH;97A KT,A ,@<|xHQA=?(W):}i `(`}) h(d *сh *ѡl8a`8d8h8l<8'9IxKQ;97AhK,@<|xHQADW):}i8})8 h*l h*hA8|;x|3x8l9h=?9)'9AH\=;97AK,@<|xHQA=?,=?'W):|i}) `*l *h `(dh(` `(pA88c8l8h8d8`9p=?9)'9AH>;97AKp, @<|xHQA=?,=?'W):|i}) h(p *l *h`(d *ѡ`A88c8p8l8h8d9`=?9)'9AH=;97AXKp, @؀<|xHQA4=?,=?'W>:|~}> `*p *l `(hh(d `(`! | PA88c8p8l8h8d9`9!P9AH=%|~}> h(t *x *|`( *ѡA88c8t8x8|89=?9)'9AH<,A|~}> `* * `(h( `(A88c88889=?9)'=_9J'H<;97AxKT, @`<|xHQAT=?(;;aW):}i8k})8X\ , @8 ,@8ǐP88<8'99!PJxHUW=:}= h(}}g *Ѿo<8c'xexFxH }= h(g *Ѿo<8c'xexFxH ;97AK̀, @4<|xHQA;;aW):}i8k})8X\ , @8 ,@8ǐP88<8'99!PJxHT]W=:}} h(}=  h* <8c'xexFxH}= h( h*<8c'xexFxH];97AK, @Ā<|xHQA;;a=?(<8c'88FxKIW=:}} h(}=  h* <8c'xexFxH}} }= h(  h*<8c'xexFxHe<8c'88FxK}= h(}}g *Ѿo<8c'xexFxH}= h(g *Ѿo<8c'xexFxH;97@h(8! |N |!B= a)|HA<8c"8"HiH$=?)( =?)$ X8!P|N |!B= a)|H@x#9)( 'A ,A$9)( @ 8H =? T L@@ 8'<`| A$=)9)"'<8c"P8$HЁHH=k#U):})Z #U):}+J T:}k <X8!P|N |!B= a)|H@X 8 LAA LA@ 8'<`| A$=)9)"'<8c!h8HϕH,=?)(    X8!P|N |!B}+Kx = a)|H@X(@ 8H =? x L@@ 8 +<`| A$=)9)"+<8c 8"HH<=?)      X8!P|N |!`B|#x|+x|3x}Cx}5Kx}[SxAYx = a)|H@,A 8HP$, A| @ 8H0h@ 8 Hh@ 8;<`| A$=)9)";<8c8H͉H8P8T(79)m)!D<C0@@=?ɩXh($;;7A08}|y|vDxH|@||x;7@;,@;8aLdxHaL,@=?)=? T L@@=? H=?)=? < L@@=?H=?)=?  L@Ad=?8HlL,@`=?)=? T =?L@A8=?)=? < L@@=?XH =?(2oD<C0@@=?ɩXh($=? 2X`(k.X<8cd<88PfxKu<8cd8TexK8aXdxH.E<8cd|dxexH)=? h<\;7ALXh*H8|)8aH8\|*fxGxH\(\;7@8!|N |Đ!B|zx|#x|+x|3x|;x}Cx}6Kx}USxp= a)|HA<8cH8HЀ,A 8H4,A 8H %, A| @8HXe9@5kAH8U@:}  ,@ } )| A |H@9J5k@ā><`| A$=)9)"><8ch8H}H8|9@5kA,UI:}))|H@!9J5k@܁<|IT:p8ap8txHa<|IT:p8ap8xxH=<|IT:p8ap8|xH<|IT:p8ap8xH<|IT:p8ap8xHс<|IT:p8ap8xH><`| @\8a8xK),A,@L8a888xKeѡ̀,@l=?-(!n!ЀaЀH  =?h(hn>(!!ЀaЀH  =?h(hn,@|=? -(!n!ЀaЀH  =?h(hn=? -(!n!ЀaЀH I =?h(hn8a888xKX8\<`@;DtHxL|PTX\`Cx$xxxgx~x~ɳx~xH8<@Dxxxxgxt!xA|HI8a888xKe8a888xKH8a888xKFa8a888xK8a888xHxKa<8c<8|ex|#xxHT8a8xH(<8c|dxxH(xH_M<8c<8|ex|#xxHT8a8xH(<8cxH8<@Dxxxxgxt!xA|KH5<8cxH]xHbadxtHe!ahxxHfalx|HhxH\ExxHOAxHZ1xHX!8atxHY8axxHM8a|xHA8axH58axH)8axH,A,@8a888xKр(8! |N |!B}Cx}4KxA$!8a@DHLP~xPTX\!4I~WxA`Ad~Px~Ox8a@8DxK58aH8LxK̉@,@!);@5)!hAWI:}i}) +|x`HQA8!`} I֑!l} ֑!p!P} I֑!t=? ,!d} I֑!x!T|I֐|H,AlW:!pJW:t}>U):$})< !(( n!aH  =xW:|}>U):(})< !*( n!aH 1 =;||T:}=}>JU):}) (!.!aH  <H,AH`}=}>JU):}) ( d}=}>JU):}) h( ;7{@;Z!h5)!hAK !;@7AWI:}i}) +|x}@HQA8!`|`Iց!P|Iց!d|Iց!T|I|}րH,AL}~Uk:}k}>"U):$}) }~*Uk:}k}>2U):(}) }~:Uk:}k}>BU):}) ;5J@;Z7@$D,@! ;@7AWI:}i}) +|x`HQAt8~ ~@ց!X~`I=? ,~yց!\~IրL,AW:jW:}>U):,})< !(( n!aH  =W:r}>U):0})< !*( n!aH i =;||T:!<J}=}>JU):}) (!.!aH  <L,A@}=}>JU):})j ( }=y}>JU):})r h( ;7{@;Z7AK\!;@4AWI:}i}) +|x}@HQA8ց!X|`I|yց!\|I|}րL,AL}~Uk:}kj}>U):,}) }~"Uk:}kr}>2U):0}) }~:Uk:!<}kJ}>BU):}) ;5J@;Z4@(8!|N |!B= a)|HA<8cD8H1H8H'9)'9@gUi:})* h@| @9@, @āg, @8Ui:})* h*=?r @ 8 X8!P|N |!@B|ux|#x|+x|3x|;x} Cx}2KxAaAa! ~x8x= a)|HA<8c8H H,@(,@,@ ,A 8H$, A\| AP', AD| A8A*, A(| A:, A | @ 8H:9)( @ 8 = a)|HA(<8c8H%;=)9)";H8a@8D8H8LgxKE,@T8 T;7AD8~|||q~xH֩8cT|@aT;7AK8T8X;7A88||x|v$xHQ8cX|@aX;7@Ѐ,A 8H0, A 8H, A 8H8P:9)!\;x<888HaPc|}<888HqaPc<|}<888HQ;;7Ah;A;8aP} [})Y|H@Ui<9)|HA;}|z8|!8c|"8&xH;7@:;;;H:L;@; P?c,A\<8c8P8T8XgxKœ8=)9)">H8xH xxH|Tc:=?)9)|cJxH)X8!P|N |!B= a)|HA<8c d8 H5H=?)Ȅ  X8!P|N |!B= a)|HA<8c 8HH$=?)X   X8!P|N |!B= a)|HA<8c8 HUH=?)  X8!P|N |!B = a)|HA<8cx8HH<=?)|      X8!P|N |HqA!0|}x|#x|+x|3x|;x= a)|HA<8c8#HMH8a8|3xHC!x<8<x8H ,Ax<8@x8H,@=? z@azѡ`=? h:D=? h:d=?сH=?koah;`<8c8@xFxHa@`=? D d=? T h:H=? x h:h=?hkzaLzH tx<8Dx8H,@a=?I @=? x h:`=? D=? | h:d=? h:H=? h:h=? kh:aLсlH|x<8Hx8H,@la=? @=?éT,r *`=?xKr *D d=? Hr *h=?É :L*сl=? k`:aP*ѡpJ`*AT)*!t;`<8c48@xFxH I*@a=? l h:`Dozӡd=? h:сH=? h:h*Lko:Hx<8Lx8Hm,@La=?I @=? x h:`=?P D=? od=?é zH=? h:hkaLjсl;`<8c8@xFxH a*@ `D=? h:d*Hozӡh=?lkzaLzсl<8c8@xFxH u=?Hx<8Px8H,@8A=? x h:@=? `=? oD=?éllr *d=? h:H=? (h:сh=?ÉJ:ALkh*al;`<8c8@xFxH @ `*D=? dzѡHzӡh*L:сl<8cHx<8Tx8H,@a=?I @=? T h:`=? D=? od=? h:H=? h:h=? kh:aLсl;`<8c8@xFxH 9a*@`=? h:D=? h:d*H=? x h<h=? h:L=? h<l=? h h:P=? P h<p=? kh:aT=? h:сt<8c48@xFxHA=?lHx<8Xx8H,@4=? z@azѡ`=? x h:D=?  h:d=? h:сH=? (kh:ah;`<8c8@xFxH}a=? h:@A=?h :`=? oD=? h:d:сH=? h:h=? kh:aL=? Jh:AlH x<8\x8H,@(=? z@azѡ`=? T h:D=? h:d=?xсH=?koah;`<8c8@xFxH1A*@a`*D=?l2 *d=? H=? kh:ah=? PJh:AL*сlHx<8`x8H=,A Lx<8dx8H,A ,x<8hx8H,@!=?xi2 *@A=? z`zѡD2 *dk*aH=? (Jh:Ah=? T)h:!L*сl<8c8@8`FxH=?czH x<8lx8H,A ,x<8px8H,@=? z@azѡ`=? T h:D=? d=? xh:сH=?kah;`<8c8@xFxHA=? h:@a=?h z` D=? `:dzѡH`=? `:hJAL=? H\x<8tx8H,@ =? @a `=?éT zD=? h:d=?É :H=?l oh=?ixсLko:al;`<8c8@xFxHY @a`=? h:Dzӡd o:Hh=? Ph:сLkH x<8xx8H,@h=? x h<@a=? h<`=? h:D=? h:d=? H=?él ozh=?PсL=?Éko:al;`<8c8@xFxH @a z`=? h:Dd=? h:H=? h:h:сL=? kh:al<8c8@xFxHuozHx<8|x8H,Ax<8x8H,Ax<8x8H,@a=? T h:@A=?2 *`=? oD=? | h:d=? h:H*сh=? h:L=?hr *l=? :PJ:Ap=? k`:aT*ѡt<8c4H(x<8x8H,@L!=?2 *@a=? `=? T h:D=?xK *dh*сH=? (kh:ah)!LJh*Al;`<8c8@xFxHM@a=? `=? h:D=? l h:d H=? h:hсL=? kh:al<8c8@xHx<8x8HQ,A`x<8x8H1,@a=? z@A=? `=?x2 *Dzѡd=?kzaHzѡh*сL=? Jh:Al<8cHx<8x8Hq,Ax<8x8HQ,@ =? @a `=? zDzѡd=?сH=? |kh:ah;`<8c8@xFxHa=? x h:@*`=? `:Dѡd=?kgaH*h<8c8@xFxHoHx<8x8H,A$x<8x8H,@<8cDx8HaHDx<8x8H,@,A=?T :@a=?)r*`=?  :D=?*d=?xr *H=?  `:h*z!L b:l *P=? ( `:pT`*t*ѡXka:ax=?lJA\`*С|<8c8@8`FxHoHx<8x8Hu,@=? @a=?  h:`=? x h:D *d=?éh ozH=? h:h=?r *L l=?Él :P=?I p*ѡT=?T t=?i X zxс\=? (kh:a|;`<8c8@xFxHy@a` zDzӡd=? | h:H *hnсL=? kh:al<8c8@xFxHo:8!лAH|!B= a)|HA<8c8$HaH=?),  X8!P|N |!B}=Kx= a)|HA<8c|8HH@PDTHXL\ ,A<8c8@8PxH,A<8cp8@8PxH!x8!p|N |!pB|yx|#x|+x|3x|;x= a)|HA<8c8HH,A|+x8`8`8 HġH8a`<88 8 Hq;px<88P8PHU8a<848P8PH=8a<88P8PH%8d=?9)!8;`<@AD8PH8L8 PTcx$x<8x<8H=9=?9)t9AdHx8`xx8 H(98!|N |!B= a)|HA<8cx8"HH=?)\ X8!P|N |!B= a)|H@X 8 LAA LA@ 8'<`| A$=)9)"'<8c88HH,=?)|    X8!P|N |!B= a)|HA<8c8HaH,=?)0    X8!P|N |!B= a)|HA<8c,8HH,=?)    X8!P|N |Ԑ!`B||x|#x|+x|3x|;x}VSx؃܃= a)|HA<8c8HEH( 8 LAA, 8LAA,A 8><`| A$=)9)"><8c8HH=?)8 ,A?;쓡8<@;#DH;`aL<8c<8<8|fx<8=9ܠ=?9)(} CxHY8<@DHaL<8c<8<8|fx<8L=9ܠ=?9)p} CxHH8<<8c<8ܠ|#x~xx(xxJxK;`<8cܠ|dx8`8d8hxH`,@<8<<8c<8ܠ|#x~xx(xxJxK%H4`,@(;`8ad8h<8xKixK,@h<8cܠ8dxH½ 6<8c8hxH¡ 5= a)|H@`=?)8 ,AL<8cH<8cܠ~ijx8Hu!H<8cH<8cܠ~x8HtH= a)|H@P=?)8 ,A<<8cH]<8cܠ~ijx8Ht<8cܠ~x8HtH18!|N |A!0B|}x|#x|+x|3x|;x= a)|H@X,A 8H $, A| @ 8><`| A$=)9)"><8c8HeH8a888xKl8a<<8cxxFx899!9AK|888<8@8pD8H8LP8T8X<8c|dx<8,<8|+x99!9AH鱀8!|AN |Ha!|{x|#x|+x|3x}7Kx}XSx(,= a)|H@|=?h@ 8H<=?h@ 8H ,A,A 8 ><`| A$=)9)"><8c8HH@ H=?Xh((l<C0=?ɩތh($ H i  H @ H Mh:@ H 2`a*Ü{2=? 2 H q{`P*2 H r{hx9`4AD9A@Ui:})R * * r{nx9k4@h$9`,A,9A@Ui:})R  `: 9k4@,A$=9)!8a8@8`xH-,A$=9)!8a8@8`xH8!H|H!|yx|#x|+x|3x|;x}Cx}7Kx}]SxH= a)|H@p=?h@ 8H0=?h@ 8H ,@ 8 ><`| A$=)9)"><8c8HHl<C0ɡ=? ۼ(h=?Ոh$P H  H -  H  H =?IÜ|*=? 2 H {rP H e H |ra@PӁ@8`9`4AD9A@Ui:})R * * r2zzZn89k4@h$9`,A(9A@Ui:})R  2 9k4@9`,AD9A@YxUi:})RSz `<[zh: щ9k4@Ѐ,Ax8@8`xHQ,A$=9)!8a8@8`xH8!H|H!@||x|#x|+x|3x|;x}Cx}:Kx}^Sx = a)|HA<8c<8HD(@ 8 ><`| A$=)9)"><8cX8HIHH<8cxxH<8cdxxH<8cxxH<8c~xxH((?>H $$>2=?I)r=?iո,Jr2H*`h*d?2r)r2jH*Ӂhh*ӡl<8c8`xH !`<8c8dxH !d<8c8hxH !h<8c8lxHm !l@PDT;AP<8c@8@ExxHY`с@dѡPDThHlXсLѡ\,@<8cT8@ExH<,@8;P<8cT8@xxHM<8c08@xxH8!H(|ؐ!`B|xx|#x|+x|3x|;x}Cx}:Kx}YSx؀= a)|H@P,A 8H'|H@ 8><`| A$=)9)"><8cx8$HIHd8a`8d8h8lxKby8Kx}WSx = a)|HA<8c8!Hd 8 LAA LA@ 8><`| A$=)9)"><8c8 HQHxxDxxfx'xxH Mh*h(=?T2@h*h(2D8a@8Dxx~xHu8!|N |!B= a)|HA<8c8"HH,=?)o܀    X8!P|N |!B}+Kx!)<`| A<8c|8!HHL=?)o         X8!P|N |Hy!|#x|+xT|;x}Cx}3Kx}USxhAlp!txayx= a)|H@X,A 8H $, A| @ 8<<`| A$=)9)"<<8c8 HHWP(uk(=? $$= \l2=?th(`n=?)H$=?h(on(H$ h(k.^P*V***(`(((8|88<@8a888899!9AHr,A;@;7A08~|y|odxH|@|zx;7@؀,@=?)n`=? Μ L@@=?IH=?)n`=? ̄ L@@=?IHx=?)n`=? ` L@@=?I HL=?I$H@,@4=?)n`=? Μ =?I,L@A =?IΠh(= `h$h(28,@8lT<C0PP=?ɩРh($ X(bс=?ʀ r<?8|<8cɬ<88xK<8cɬ8xK~xx~ex~x<8ɬ|;xxK<8cɬ8xKI=?r`(Xrh(\*с`*ѡd8aX8\8`8d<8ɬ|;xxK~óx~Dx}sx~&xxH<8cɬxH=?9)ԑ!8=?9)!<@8a8888|=9=?9)ɬ}*KxKh(h$hl (aT+ |@|x!T |xQAL*p8|)8ap8|*xgxHh(;7@<8cxH<8cɬ<8|exxK<8cɬ<8@xK=?r=? P$h( np=?9)ԑ!8=?9)!<@<8cɬ<88p}&Kx<8=9=?9)} CxK((*!| (a **! 8;<<8cɬ|dx|ex<8(~x|}i[xAKg((! *a (! **a 8<<8cɬ|dx|ex<8,}j[xKgY4 | @<*t(x8at~Dx8x~&x<8ɬxH!8!0Hl|Ԑ!B|xx|#x|+x|3x|;x}Cx= a)|H@$(<`| A$=)9)"(<8c8!HzHЀ,A8@;:::<8c<8@8DFxgxxH̀D,@TCxdx8HxxH,A,@H;,@ H0H(D,@,@;,@\8!|N |!`B||x|#x|+x|3x|;x}Cx= a)|HA<8cӌ8Hd 8 LAA LA@ 8><`| A$=)9)"><8cӨ8Hy1Hj@`Dh(d *HhLlP *ph(TtXx;`<8cx8@xxHս<8c$8@xxH1=? @@h(`h(Dh(dh(Hh<8cL8@xxHh(@Dd<8c88@xHh(@`h(Dh(dHh(h;`<8cL8@xxH1@`h(Dh(d<8c88@xxH8!|N |!Ba = a)|H@p,A 8H8$, @| @ 8H'|H@ 8 +<`| A$=)9)"+<8c8#HvmH&}iP9k},Kx|IQA}&Kx<`C0=? m`LaHH@((9)m)!TaPP@(=?i<=?\=?`}&`P9)m)!Da@@@(0$LA@ *X!\H (`!d9)8 lTaPɡP@(h(9)m)!LaHH@($$9)m)!Da@@@((:h`d9'| @| xg }k*8lTaPɁP@(`h(+) })*lLaHH@( (r,jzkrljKr } R}*.iщ94B@8!|N |!B|+x|3x|;xl!pAta|C= a)|H@؀,@ ,A 8H,A 8H!l ,@lAt*|H@\| AP!p ,@ Ax*|H@| @ 8H >, A | @ 8.<`| A$=)9)".<8cT8HsH8<8cP<88}sxK9 !5A|AUI:a})ZAp*ax }P}4Kx5A4!l At*HP|x7A8 T}~Uk:}k}>U):}) hL@A}>U):})|T:|.`@|T:|.`@}~Uk:}k}>U):}) LAA}>U):})|T:|.h@|T:|.h@ L@@ LA@;8:@<8<8=KW:~=?iV:=_x::`9,@dW:} }i*})2I}TR9*})ցk}~Z}+JU):}) ( Uk:}k @UJ:}J `,@Pdhh*lh*ph*`}.h*}.h*W:9a@} Z `@ ~.H,W:9a@} Z `@ ~k.H W:}.;4@;:>:sɔ:;@~x,9]@9@|}5.U@:|.T:}  )|J}+.|JT:|.,@$,@$@`@`HX,@@`UI:H(,@8UI:}) @ `T:}) @ `H,@ T:}) @ `H,@(@`T:}kUI:})HX,@XUI:}) @ `T:}) @i @ 2xX(`$ѡ `i H,@T:}) @i @ 2xX(`$ѡ `i ` 2xX(`$ѡUI:}) @w @ 2xX(`$ѡ `w `H0,@UI:}) @w @ 2xX(`$ѡ `w ` 2xX(`$ѡT:}k @i @ 2xX(`$ѡ `i `H, @T:}kUI:}) @i @ 2xX(`$ѡ `i ` 2xX(`$ѡ @k @ 2xX(`$ѡ `k ` 2xX(`$ѡ<8c88}sxHa;6@;7@ :5@ԁ!9)!5@H8!@|N |aܐ!B|~x= a)|HA<8ch8Hl H<8cD8888P9x9@Hu8a8xH87AX=?ɵ@;a;8a8888P9x9@H8a8888 99!xHI H  P! H U !h$a8<@8a888 8=9=?9)D=_9JK{,A $H<<8cD8xHE ! <8cl8xH) !$8a 8$8Px8H!9)!7@h8!`|aN |!PB|~x= a)|HA<8cĄ8Hj H<8cD8P8T8X8\9`9!dxHud8h7Ap8ah8P8T8X8\9`9!dxH=T\h@X`hA88ah8l8p8t8x9|9!9AHq8al8p8txKM<8cD8xKwP,A(TX\`Ht<8cD8TxH !<8cl8XxHe !<8cD8\xHI !<8cl8`xH- !8a8888x9|9!xKݑ!h9)!h7@8!|N |ۡĐ! B|{x= a)|HA<8c”8HgH8`8a`8d<08fx8Hd,@8h8a<8al8p8t8x8|99!9AHl,A`<8c88pexH !<8c`8texH8a8exH-=?鴴h$P=?9)`!8=?9)!C0=?ɶ,YxW@.|~8Hu,@L|~8Ha|gx8l\XX(<P8a8P|fxH;7@8!|ˡN |!PB|~x= a)|HA<8c8HeH8aP8T8X8\xK8a`8dxH8ah8l8p8txH8ax8|xKUx,A8a888xH+,A88aP8X888xH)-8a888xH,E8h8=?9) !HH,A=?(r|h$P=?9)ԑ!8=?9)!<@8a88P88=9=?9)=_9JKmxxHw|gx8a8xxH}8!|N |A! B|{x|#x|+x= a)|HA<8c8H[HL|+xHw],@<8aT8X8\8`xK]8ad8h8l8p8txH-8ax8|xH lx$Th(`Xh*=? r8a88889xH&a=? L@@,<8cH<8c88H=HH`,AT8axH%,@,888<8H4,A ,@$88<?=?@|h$P;8;<@8a88P8899!9AKjcxDxHu|gx8a8exxH588<?|h$P8<@8a88P8899!9AKjI8!|AN |!B= a)|HA<8c8HXH=?)E X8!P|N |!B= a)|HA<8c8HX}H=?)ET X8!P|N |!B= a)|HA<8c8HXH=?)E =?)E =?)E =?)E =?)E =?)E =?)D  =?)D =?)D =?)E =?)E =?)D =?)D 99@'=?D;=?ID8B@D9=?D8=?D8@=?D8=?D8@U :}i }i }ib }i" }i* }i2 }): 95J@X8!P|N |!B}+Kx = a)|H@<#9)( '@ 8 +<`| A$=)9)"+<8c8HUHt=kC< T:| .#U):}+J T:}k @T@.=?)C89)|;x|J}ESx8HW5X8!P|N |!B},Kx = a)|H@8((@ 8 *<`| A$=)9)"*<8c8HTHt=kB@ T:| .#U):}+J #U):}+J @#U):}+J T:}k X8!P|N |!B= a)|HA<8c8!HT5H 8(X8!P|N |!B}+Kx = a)|H@8((@ 8 +<`| A$=)9)"+<8c8HSHt=k@ T:$}+.#U):}+J T:}k @cTc@.=?)@9)|cJ|;x8}FSxHTX8!P|N |!B},Kx = a)|H@8 ((@ 8 *<`| A$=)9)"*<8c8HRHt=k? T:$}+.#U):}+J #U):}+J @#U):}+J T:}k X8!P|N |!B},Kx = a)|HA<8c 8"H,#9)( '@$<`" <8cD8#HQH=k>#U):})Z #U):}+J #U):}+J <#U):}+J #U):}+J |T:}k  X8!P|N |!B},Kx = a)|HA<8cdHP#9)( 'A,@ 8 *<`| A$=)9)"*<8c8#HPH=k=#U):})Z #U):}+J #U):}+J <#U):}+J ܁#U):}+J |T:}k X8!P|N |!B},Kxa = a)|H@<#9)( '@ 8 +<`| A$=)9)"+<8c8"HOuH=k<#U):})Z #U):}+J <#U):}+J #U):}+J ܐ#U):}+J |#U):}+J  T:}k  X8!P|N |!B},Kxa = a)|H@x#9)( 'A ,A$9)( @ 8H =? L@@ 8 +<`| A$=)9)"+<8c8"HNH=k:#U):})Z #U):}+J <#U):}+J #U):}+J ܁#U):}+J |#U):}+J T:}k X8!P|N |!B = a)|HA<8c@8"HM)H<=?)9      X8!P|N |!B}+Kx = a)|H@X(@ 8H =? L@@ 8 +<`| A$=)9)"+<8c8"HLEH<=?)9      X8!P|N |!B= a)|H@<#9)( '@ 8(<`| A$=)9)"(<8c8#HKH\=k8$#U):})Z #U):}+J #U):}+J <T:}k X8!P|N |!B}+Kx = a)|HA<8cX8"HH#9)( '@ 8 +<`| A$=)9)"+<8c|8!HJHp=k7H#U):})Z #U):}+J #U):}+J <#U):}+J ܐT:}k |X8!P|N |!B= a)|H@<#9)( '@ 8'<`| A$=)9)"'<8c8(HIHl=k68#U):})Z lD<C0@@=?ɩh(#U):}+J T:}k <h8!`|N |!B= a)|H@#9)( 'A,,A (A%9)( @ 8H =? 4 L@@ 8(<`| A$=)9)"(<8c8#HHUH\=k5@#U):})Z #U):}+J #U):}+J <T:}k ܀X8!P|N |!B}+Kx = a)|HA<8c8"H#9)( 'AH,A<$9)( A,=?  8L@A(@ 8 +<`| A$=)9)"+<8c8!HGHp=k4#U):})Z #U):}+J #U):}+J <#U):}+J ܀T:}k |X8!P|N |!B= a)|H@<#9)( '@ 8'<`| A$=)9)"'<8c8(HF!HT=k2ȁ#U):})Z@D #U):}+J T:}k <h8!`|N |!B},Kx!)<`| A<8c8!HEuHd=k2p         ! $! X8!P|N |!B},Kx!)<`| A<8cl8!HDHd=k1         ! $! X8!P|N |!B},Kx= a)|HA<8c8!HCH=?dhL@AhL@@ 8H, ,A 8H ,|HA 8 = a)|HA(<8c8!HCy>=)9)">Hd=k0        ! ! $X8!P|N |!B},Kx= a)|HA<8c8!HBH=?hL@AhL@@ 8H, ,A 8H ,|HA 8 = a)|HA(<8c8!HB)>=)9)">Hd=k/        ! ! $X8!P|N |!B= a)|HA<8c|8HAeH=?).h =?)-ܐ =?).d =?).` =?).\ =?).X =?).T 9@9`'=? .@UI:})B 9J5k@X8!P|N |!B= a)|HA<8c8#H@uH$=?)-`   X8!P|N |!B= a)|HA<8cX8!H@H$=?),   X8!P|N |!B= a)|HA<8c8#H?H$=?),t   X8!P|N |!B= a)|HA<8c8!H?H$=?)+   X8!P|N |!B= a)|HA<8ch8#H>H$=?)+   X8!P|N |!B= a)|HA<8c8!H>1H$=?)+   X8!P|N |!B= a)|HA<8c8#H=H$=?)*   X8!P|N |!B= a)|HA<8cx8!H=IH$=?)*(   X8!P|N |!B= a)|HA<8c(8#H`8!|ˡN |!B= a)|HA<8cP8H9H,=?)&    X8!P|N |!B= a)|HA<8c8H9H,=?)&4    X8!P|N |!B= a)|HA<8c8H8H,=?)%    X8!P|N |!B= a)|HA<8c<8H8!H,=?)%<    X8!P|N |!B = a)|HA<8c8"H7H<=?)$      X8!P|N |!B}>Kx = a)|HA<8cx8"H7H=?~xhL@AhL@@ 8= a)|HA(<8cx8"H6>=)9)">H<=?)$      X8!P|N |!B = a)|HA<8c8#H6!H<=?)#      X8!P|N |!B}>Kx = a)|HA<8c<8#H5H=?|hL@AhL@@ 8= a)|HA(<8c<8#H59>=)9)">H<=?)"      X8!P|N |!B= a)|HA<8ch8)H4H=?)! X8!P|N |!B = a)|HA<8c08#H49H<=?)!0      X8!P|N |!B= a)|HA<8c8)H3H=?) ̐ X8!P|N |!B}>Kx = a)|HA<8c8#H3EH=?zhL@AhL@@ 8= a)|HA(<8c8#H2>=)9)">H<=?) @      X8!P|N |!B= a)|HA<8c8#H2QH=?)  X8!P|N |!B= a)|HA<8ct8H1H=kp9kP9  =@?KKK K$ ( , 0K4 8 < @KD `KdKhKHKL PKT XK\<? x | Kl=? ~ p t=? ~ =? ~ =? ~ =? ~ K KKKKKKKX8!P|N |!B|ex= a)|HA<8cH8!H0H48a@8DHS=k8 !D@} HP9)+h8!`|N |!B|~x= a)|HA<8c8H0 H8=?)8l 8Ґ HxH<8cwpxHaX8!P|N |!B|ox|#x|+x|3x|;x}Cx}6Kx}WSxa(!,:x= a)|H@,A 8HT6, A| @ 8H4 8 L@A L@@ 8;<`| A$=)9)";<8cx8H.H=?)T ,A<8cHYHW<8cHYHW;7AL<8cHY;x$xHJM|ex<8cvxHHWa;7@<8cHYIHWE<8cHY9HW58a`8d8h8lgxK8ap8t8x8|gxK=<8cv|dx<8w|+xgxHR<8cv|dx<8w|+xgxHU!888<8@8DaH!L}{x~x~Ex~x~gxx~ɳx~xH=8;=?)T ! ,@:;A:!;<8cv|dx888hxHsU,@D @4 @$ @ @ ;HP,@D8A<`| A=)9)">H$<8cpxHxK@=8a88889 xKY8a8xKr<8cp88xKA=<8cp8 xK68a88 xK8a$xHK!8a(8,xK1} HP9i4| P<| x9)!<| X@a<`| AxHH%0;<8?;p<@D;A@AH;!D!L0P;HT:LX\~x}kxL~x~Gx~hx~)xxH8<@DAHL4PT;aPaX\~x<8p}{x~x|#x~hx|#xxHI8<@D!HL8PTaX\}kx<8p}sx~Fx|#x~(x|#xxH,@<8 8<Cx$x0<8p|3xx~x9AHH,@488a@8D0<8p|3x9H9!L9AH0H,@488a@8D0<8p|3x9H9!L9A HHD,@88 8<8a@8D0<8p|3x9H9!L9AH=$,A =?phA8<8c4x8GH<`&̐<8c|8H$iH"! !aH y ! !=? p@ !aH ya !H( =? r(=?p `(k.8a@8D<8p|+x8H9L!0xHxHa,@ xH=888 <0@D8a@8D<8p|+x8H9L|+x|+xHP88a@8D<8p|+x8H9L9!A0H8aT8XxHEr r (=? v, @ =?p!XT} HP9)m)!<C0=?ɩwh(`$=? q2=? qx$P=? p@=? q*8a\8`8dxK݀`,A<8cp<8q,xK0=? qL@A=? v4LA@ 1H2U):})r ||с8 h(4U):})z сaa4U):})z сѡ3U):})z сѡ3U):})z сa<8cp888xH==? qL@@ 3H4U):})z xxс=?p h(с2U):})r с2U):})r ѡс1U):})r ѡс1U):})r <8cp888xHY!< LA@ H h(4U):})z 2U):})r ѡ3U):})z 2U):})r ѡ3U):})z 1U):})r ѡ4U):})z 1U):})r ѡ<8cp888xH],A!<=? p LA@ЀT:|z8T:|rU:}r9SUJ:}Jz8=?9)p!<@DHALaP!TLX8P\h$8Ȑ` h$8̐d=?9)p!hl}#Kx|;x8<8p|3x9JHm,A !< =?ph@T:|zT:|r  h(̀T:|zU:}rȁSUJ:}Jz1U):})r9)!88А<@DHALaP!TLX8P\$ѡ8Ԑ`$с8ؐd=?9)p!hl}#Kx888899!9JHY\,A8ah888l8p9txK8ah88xK6;2U):})r |2U):})r 4U):})z x3U):})z 8ax8|8889xHY1U):})r |1U):})r 8ax8|8889xH2U):})r |1U):})r 4U):})z x4U):})z 8ax8|8889xH١3U):})z x3U):})z 8ax8|8889xHY h(2U):})r |2U):})r 4U):})z x3U):})z 8ax8|8889xHՁ1U):})r |1U):})r 8ax8|8889xH؍2U):})r |1U):})r 4U):})z x4U):})z 8ax8|8889xH3U):})z x3U):})z 8ax8|8889xHՁ4U):})z x4U):})z 2U):})r |2U):})r  h(8ax8|8889xHQ3U):})z x3U):})z 8ax8|8889xH 1U):})r |1U):})r 8ax8|8889xH4U):})z x4U):})z 8ax8|8889xHy`,A=? qL@A=? v4LA@ 1H2U):})r ||8 h(tTc:|czT:|z8c8888xK;7Ah?`C0=?woēa(k:x8ax8|8889xHm;7@=? qL@@ 3H4U):})z xx8 h(rTc:|crT:|r8c8888xK;7Ah?`C0=?woēa(k:|8ax8|8889xHu;7@4U):})z x3U):})z =? qL@A=? v4LA@ 1H2U):})r ||h$ h$8a8888xK;7At?`C0=?woēa(k:k88ax8|8889xHI;7@=? qL@@ 3H4U):})z xx2U):})r |1U):})r ;7At?`C0=?woēa(k:k88ax8|8889xHi;7@=? pLA@=? v8@!L;7AH!H;7Ap::;;!;AT;aX8<@!DAHaLP~x8@8D0489!9AHy!9)!7@!9)!7AKl=? v8LA@=? q@!H;7Ax!L;7Ap::;;!;AT;aX8<@!DAHaLP~x8@8D0489!9AH!9)!7@!9)!7AKl=? qLA@=? v<@!H;7AL9 !7Ap::;;!;AT;aX8<@!DAHaLP~x8@8D0489!9AHف!9)!7@!9)!7AKl=? v<LA@=? q@L9 !6A؁!H;7Ap:;;!;A;aT;X8C0=?Oh=?`=?H=?éL$|PlԒ(h$3})P9)m)!(h$䛍T:}  }.h*HT:}  }.h*X{8 |ցZ|RT:}  }.h*}yY}kRUk:}+h*}.h*rrhUI:}) @;U):}) P;9)})})RU):}) r`UI:}) DT:|.T}+ rd;;,@@T:|.@T:|.P|ց:|JT:|.H,@TT:|.D;U):}) T;9)})ր})U):| .rdH`,@X:U):}) @;U):}) P;9)})ր})U):}) r`A`ad X(Zh`( `.!HLAAR`( .HL@@ 8a@8P8`88~(xH5;7@;6@ ,A:U):})iap;U):})IA;9)})ր})U):})2сT:|.t;U):}) ;9)})ր})U):| .rT:|.xT:|.|ց:|JT:|.rU):}) |T:|.;}9Iր})U):}) raAс<8cH8p88~'xHHD,A8:U):}) p;U):}) ;9)})ր})U):}) rT:|.t;U):}) ;9)})ր})U):| .rT:|.xT:|.|ց:|JT:|.rU):}) |T:|.;}9Iր})U):}) r<8cH8p88~'xH,A\,@:U):}) p;U):}) ;9)})ր})U):}) rT:|.t;U):}) ;9)})ր})U):| .rT:|.xT:|.|ց:|JT:|.rU):}) |T:|.;}9Iր})U):}) rp<8cH8p88~'xHh8!`|ˡN |a! B|3x|;x}Cx999`8A@89@U:} * `LA@$ L@@} 9HU:})I95k@,@p8989@U:}*B ,AX!9)!U):})B}j !U):})B}j" ,!U):})B}j* LHU:})* `LAA|!9)!4LA8@TB:}b*U:} * Ad( ($aUk:}kB}@}" h( h: aUk:}kB}@"}"" h( h: ,H8!U):})BU:}j !U):})B}J" ,!U):})BiL!9)!8L,@8@TB:}b*U:} * Ad( ($aUk:}kB}@}" h( h: aUk:}kB}@"}"" h( h: ,H8!U):})BU:}j !U):})B}J" ,!U):})BiL94A0K,@`;@,@D! ;9`98U:})* h@9k94@, A , @l, @ |HfW:}+ P}+" p}k* 4^A8@TJ:}j*W:} * AH( ($}`}* h( h:T}`"}*" h( h:HW:}i T})" ta8^,@8@TJ:}j*W:} * AH( ($}`}* h( h:X}`"}*" h( h:HW:}i X})" xa8HTW:}+ P}+" p}k* 8^,@8@TI:})* hLA@`h\H |FTJ:}j*W:} * AH( ($}`}* h( h:T}`"}*" h( h:HW:}i T})" ta8,@8T:}j*T@:} * AH( ($}`}* h( h:X}`"}*" h( h:HTI:}i X})" xaT:}j*T@:} * AH( ($}`}* h( h:\}`"}*" h( h:HTI:}i \})" |AT:}j*W:} * AH( ($}`}* h( h:`}`"}*" h( h:HW:}i `})" A8H9`98U:})* h@9k}cxH}cx94@, @x|FH, @xf\8L,@8@TF:}&*m<C0=ɫDh( ATU:}+* ( ($}K}& h( h:P}k"}&" h( h:HU:}i P})" paTJ:}j*U:} * AH( ($}`}* h( h:T}`"}*" h( h:HU:}i T})" tA4LA8@TJ:}j*U:} * AH( ($}`}* h( h:X}`"}*" h( h:HU:}i X})" xATJ:}j*U:} * AH( ($}`}* h( h:\}`"}*" h( h:HU:}i \})" |a88a8P8p8gxHU8!|aN |!B},Kx!)<`| A<8cP<8HHp=kؠ         ! $! (! X8!P|N |Ԑ! B|yx|#x|+x|3x|;x}Cx}6Kx}USx = a)|H@8,A 8><`| A$=)9)"><8cO8HH|x8d8h8lxKUd,Ax8p8t8x8|9xK8ap8x8txK|=| H@(,@})XP9)!`T:||8a`88xH|,A =U):}) =U):}) <U):}) 8<U):}) 8<8c2xHH,@0#xdxExxx9|=?9)2xHIHh,@\#xdxExxx9|=?9)2xHH0h,@$#xxxfxGxxxKh,A$#xxxfxGxxxKql,A8a8xK-x88p8t8xxK8ap8x8txK88<8@8DH#xxxfxGx~x~ɳx~xHM8!|N |AȐ!0B|rx|#x|+x|3x|;x}Cx}:Kx}VSx! = a)|H@,A 8Hl,A 8HX,@*|H@| @ 8H,,@5|H@| @ 8><`| A$=)9)"><8cL8 HAH|8ap8t8x8|xH8axKaUk:=?)Ԡ}kJ 8,@<9AA8<@Dxdx~xxGx~ȳx~xHH,@89AA8<@xdx~xxGx~ȳx~xH%H|,@89AA8<@xdx~xxGx~ȳx~xHyH<,@08<xdx~xxGx~ȳx~x~xH},A LA@,@0<8cLx8CH1=?/h(H,<8cLx8FH=?/h*<8cM4x8H<8cMPx87HH<| P| x9)!:| P| x9)!A88<8@DaHLP8TX~Cx8p8t8x8|xixxH]!8!|AN |!ܐ!B|}x|#x|+x|3x|;x}Cx= a)|H@th@D8 <8c;THY<8c+x8Hƭ<8c+x8HƙH -<<`| A$=)9)"<<8cI8HH@8ap8txK1p,A$8ax8|88xKc8a888xKd=?,\ (=? -X(ѡ8axHu8a88xK_,A=? + @=? , @=? ,4 @ H=?,@h@=? -H=?,h@=? ,H=?-h@=? -$H=?+h@=? ,Hd=? ,\ @=? -HD=? - @=? -H$=? + @=? ,4 $H=? + L@@=? -=? -H h@t=? + 2 h*HX `@L=? ,0 2=? /$ 2 @=? ,\(ѡ *8a<8+8<8+xKc8a888xK98a888xK8a<8+8<8+xH%8a<8+8<8+xH18a8xH1!Ā9@|HQA,9PUI:})Ba}jZ9ki9J4@,@X!Ā} HP9)!P8P8=?9)+!<8P@D8a888<8/}(KxH\=?9)+!8!Ā} HP9)!T8T<8P@D8a888<8+=9/|;x}*KxH\8a88889xK8a88xK8a8|ex8xK(q8a8|ex8xK(Y,@8a8888xK%=?9)+!8!<`| A$=)9)"><8cA8H۹Hp8axK?;;'((`@(=?I)DP$hKP$]l0*Н=?(Czѽ 0(P(Н=? % @:;] ;}$P(ѽ$НH=?#C:P*ѝL=#+z0(ѽP=? (k@:kP(}T0*ѽ8ѝ<= 'H)h:=@}D)0*=(ѝ,0}4НXP*\`P(ѝd8}X8\8`8dxH<8c#<8#xKx8x8<8#=9#xKU8x<<8c#~dx~x}{x89 9=9]K<8c#<8#<8$,|+xxKŀ9| P`}I֓A8a<@8DH<8c#<8#<8B8`<8#@}B9=9]K;8=?H8H8H88 H9ȁ9}=JU):})*W:}j* 9}=JU):})2}j2 9}=JU):}):}j: 9}=JU):})B}JB ;4@?\h*dh(h88 <<8c#<8#|#x<8B89d9=9AhK-h*lh(p8;<<8c#<8#|#x<8B$89l9=9ApKh*th(x8<<8c#<8#|#x<8B,89t9=9AxKy(l<C0=?ɩ*h($;7A0=?i;{t=% zx:8}|x|v~xH!,@,Ap,Ah8|1($*ѡ$(8<<8c#<8#|#x|2899;9AKHp8|9($*ѡ$(8<@<8c#<8$<8(<8#|:99!9ZH(;7@=?)ũL (l<C0=ɫ*h($;7A:;=?i;{t=?É% ;AW:})j)9)( A H8|9($*$(A8<@<8c#<8#<8#8aH|:99!9[H;7@d<8c#|dx<8$(xK?;888<@8DH<8c#<8#<8B~&x'x@9=9]K=kH8 <?  99)+88&<<8c#<8#|#x<8B48(9,9=09]4K 8!Hp|!B= a)|HA<8c98#HH8,@|+x<8: H(,@|+x<8:(Hp, @|+x<8:,H,@|+x<8:4H8,@|+x<8:8H, @|+x<8:@|;x8H$,@|+x<8:DH, @|+x<8:LH,@|+x<8:T|;x8HȀ, @|+x<8:XH@,@|+x<8:`|;x8H,@|+x<8:h|;x8Hd, @|+x<8:pH,@|+x<8:||;x8 H$,@ |+x<8:|;x8HH 8X8!P|N |Hտ!!|zx|+x|3x|;x= a)|HA<8c8`8HѹHx=?)ÉIéi \Xx,@894Ap8a`=?88ɽ88齸8U :}K}+" }+*  }+2 L}k: 94@8a888gxK=<8c0<8l<8x<8HgxK888bH;6A:7A;!IA |PRx4A =K=?A8 a|Y֐=?9)D!=_9JXA`Xd\8lT=`C0aPP((*`!|JT:}. h(cn`( `.*dxA|PA\8A!9)}i`!|H@ }C0=?=_Êa8 !@I=_oTPP((*x|T:}  h(cn`( `.*|x*}. h(cn`( `.*8ax8|88}sxKɁ!9)})};JU):A})Rx !9)})};JU):a})Z| ;{;7@8;8aX8\8p8t}sxKM!9)})};JU):})X !9)})};JU):})\ ;{!9)})};JU):})p !9)})};JU):})t ;{:H,@;~x|QAa9k}k}{ZUk:}k:!9)})}*JU):}): a9k}k}{ZUk:}kB!9)})}*JU):})B ;{9J4@:pXt\H,A,@;R;6@,At8aX8\8`8d}sxK!9)})};JU):A})RX !9)})};JU):a})Z\ ;{;R8}kxA!9)}i`H;8,@ }?H $,$,A ur{$`Pr$H(ur{$,r$Pxx888(xKhh(}kh(X$h*rX$h*:29X$2X$x~x~ųx~fx'xK};@7Ap?C0=?˩o@(zѡ:h**8a888'xK ;Z7@,@,A,ur{$`P,r$H(ur{$,r$P!9)m)!<C0=?ɩh($$;@7`A>C0@ho@(zѡ:܃;7A?C0=?o(ozѡo LA@` L@@P LA@< L@@,h*`*8a888'xKm;7@X;Z7{@,A,AX,A*Hur=?D2{$`P,r2$H|,A4u2=?Dr{$,2rH8*ur=?D2{$,r2$P888C0=?:(o@(cz퀾zс:$hѡ!8<8a8888=99! 9APH1 ,@@;7A0;P||8c<888Hy;7@8aP8(H,@@8aP8(H|gx**8a88P&xH;Z7{@8a$888(89)xKì$,AHh*=?2h*2܀,AD2$h(,2h$h*8H@2h$h*,2$h(80(=?rh$P888,=)9)">H=?)h  X8!P|N |!B|zx|#x|+x|3x|;x}Cx}-Kx}[SxAhl!= a)|H@|,@,A 8H80, A(| A<, A| @ 8><`| A$=)9)"><8c8"HHhyk(8)(?=?\($($н0*ѽ=?IDIP((*0(ѝ((ѽ=?T8((* ѝP(=? 2*2@*`=? )h:=d0(h8(ѽl0*MH(=?|$`(ѝ=?Dkk@(} ѽ$k0*}(ѝ, (@(0ѽ4zk0*}@=? XJ$JH*]D (@(ѽH((ѝL}= X(YJ((]0*=ѽ]0*(*0()((=<8c<8<8xK<8c<8xKCx~dx%xx<8|;xxK8<<8c}{x}sx}kx899=9]Kwx=?: Ă: Ȓ8a88<88H88<<8c<8|#x8<9 9=9]K}A8<p@tDxH|L8DP=?9)!T80X8p\8t`8xd8|h8Ll8 p8t8x8|8888$888888}`8d8h8l8<98x9]H88<<8c|dx|ex<8,899= 9]$KA88<<8c|dx|ex<848(9,9=09]4K }$k(K$ =H($ P(jѽ<`| A$=)9)"><8c8HHЀ,@8 8@5ADTI:}) T:} *}e. }`XP |X@}`[x 8B5@9` '|HA9`q, A`(=?h$ *h*!` !d  *!l H |8@|;x|@@}Cx(lt<C0pp=?ɩ h($=? 2ї=? ި2іh(`$x!|89`|HA9`r, A(=? $`(Ѱ!P !T !X h((lt<C0pp=?ɩ h($=? 2ї=? 2іh(`$x|H 8!<`| A$=)9)"><8c8H!Hl<C0ɡ=? (h=?Ǭh$P H  H U =?IÝ|*=? 42 H - {rP H ԩ H |ra@(@8`9`4AD9A@Ui:})R * * r2zzZn89k4@h$9`,A,9A@Ui:})R  `: 9k4@,Ax8@8`xH݀,A$<9)!8a8@8`xH=8!H|!pB}=KxȀ= a)|HA<8c@8H}-H@`Dd*h(H*h(h*h(L*h(lPp ,A<8cİ8@8`xHٹ,A<8c8@8`xH!8!|N |!0B|+x|3x|;x}Cx}=Kx}XSxa AaC\xUxTxPxOx= a)|H@,@,A 8H %, A| @8HXe85kAH9T:} I, @ } )| A | H@85k@ā;<`| A$=)9)";<8c48H{H8a@8D8H8LgxKom8aP8TexK=8aX8\8`8dgxKp-@,@H,Ad=? Ęh=? p84AaPT:}i}) +| x}HQA/8|||A`}j:Uk:}k}*"U):}) (h @ѡh}j:Uk:}k}*U):}) *H4}*:U):})h @ѡh}*:U):})p @ѡp9J5@X84@phh@8h<?phaph(=? Š2`(ѡhk`*apD,@L,Ad=? Ęl=? t84AaTT:}i}) +| x}HQA/8|||yA`}j:Uk:}k}*"U):}) (l @ѡl}j:Uk:}k}*U):}) *H4}*:U):})l @ѡl}*:U):})t @ѡt9J5@X84@tlh@8l<?tlath(=? Š2`(ѡlk`*at@,@ XhH,@ `pD,@ \lL,@ dthp`(=? X L@@@@,A=? D (hH,Ap=?Dh*plt`(=? X L@@@D,A=? D (lL,At=?Dh*t@,@(D,@H,@L,A,hp LA@x@,A0<8cPdx8FHih=?h*pH,<8cdx8CHip=?h(h<8cdx8Hilt LA@xD,A0<8cPdx8FHiel=?h*tH,<8cdx8CHi9t=?h(l<8cdx8Hi8ah8l8p8tgxKma8ah8l8p8tgxH8ah8l8p8tgxH)8!|N |HAȔ!|zx|#x= a)|HA<8c8HuH\8aP8T8X8\8`9dxHHIP,A<8ah8l8p8txKj8ax8|88xK8ax8|88xKle<8cp|dx<8|+xxH<8cp|dx<8|+xxHaT\X(=? MZ:=?)-Zz`X`(<=? X:ѡ=? 2lD<C0@@=?ɩ<h($AJH*=? J2A!9`89AP=?Ui:})R\Th(2 `Xh(2 \Th(2 `Xh(2 9k4@87A=? 2=?É;a0;((ѡ*2*a8<@<8c<8H|ex8899!9A K9!9)!7@P,A쓡88a888899!9AHFd,A@8a88xKI8aT8X8\8`<8H=9pxK==?rH=?9)p!8=?9)!<@8a88H88=9=?9)H} CxKAT\P(a`X`(=? X<=? P:ѡ=? 2lD<C0@@=?ɩ<h($87AX=?é8a8Px8HE|L8a8L8Px8H(!9)!7@8ah8l8p8txKh8ah8l8p8txH8ax8|88xH8!AH|!B= a)|HA<8c`8#Hp]H,=?)]    X8!P|N |!B= a)|HA<8c8$HoH=?)\  X8!P|N |a!B|kx|#x|+x= a)|HA<8c8HoiHh;;x8}e[x|;xH18a@x88Hp8a@<888Hp,@ H 8a@<8d88Ho8,A8a@<888Ho8 ,A8a@<8l88Ho8,A8a@<888Hoq8,Al8a@<8t88HoM8 ,AH8a@<888Ho)8,A$8a@<8|88Ho8 ,A8a@<888Hn8,A8a@<888Hn8 ,A8a@<888Hn8,A8a@<888Hnu8,Ap8a@<888HnQ8 ,AL8a@<888Hn-8,A(8a@<888Hn ,@8H 88!|aN |!B},Kx!)<`| A<8c8$HlHd=kY         ! $! X8!P|N |H!|yx|#x|;x}Cx= a)|H@X 8 LAA LA@ 8=<`| A$=)9)"=<8cL8HkH =?)Y<    8 ((,A\=? $*=? $Ӂ*h(*`(=? 2aHX=? $*=? $Ӂ*h(*`(=? 2a(`(=? 2h(n;;`?@C0=?i,=?Y<:Y<:<`| A$=)9)"><8c8H^H8aP8T8X8\8`xK!8ad8h8l8pxK 8at8x8|8xKy8a8xHE,A,8a88889xKH(8a88889xK|$ѡ$ѡ8a88xKv8cxxxFxx~x9!9AH:,A,A(,ATH$TH4,A Ph$(ѡHPh$h*cx~xxx8(xxH2Q8!|N |!B= a)|HA<8cԸ8#H\H,=?)I    X8!P|N |Ԑ!0B||x|#x|+x|3x|;x}Cx}=Kx}WSx= a)|H@P 8 LAA,@ 8><`| A$=)9)"><8c`8H[H8a`8d8h8l8pxK8at8xxH,A,8a|88889xKxH(8a|88889xKzAt$ѡ$ѡ8a|88xKt)8<8@8DHxDx%xfx~dzx~xx9AHA! ,A,A(,AdxH$dxH4,A `th$(ѡH`th$h*x~ijx~xx8xxH:Հ8!|N |H !0|wx|;x}Cx}9Kx = a)|H@X 8 LAA LA@ 89<`| A$=)9)"9<8c,8HYH,AþHæѡPT,A8aX8\8`&xKH8aX8\8`&xKY8aX8\8`&xKr =? \LA@=? *H@AD=? \ LA@ H=? (@D\xQAx?`C0=?(;hoLaHH(h,A<8c8PxH<8c8h8P&xH;7@,A$|P,A,A8ap8t8x&xKH8ap8t8x&xK}8ap8t8x&xKp8@P|x7ZA?C0=?ˉ(?;{d;;oLHH(W:}) *LA@PL@@Dh8h,A<8c8PH<8c8h8P&xH;7@;7Z@d8!кH|HA! |vx|#x|+x|3x|;x}Cx}2Kx!= a)|H@,@$<`"<8c8HVuHl H! L,A8aP8T8X&xKH8aP8T8X&xKa8aP8T8X&xKo;@7A?C0=?ɤ;`o@D@@(k:`,A<8c@8HxH<8c@8`8H&xHM;Z7@2, @p8 lD<C0@@=?ɩh($,A8ah8l8p&xKH8ah8l8p&xK8ah8l8p&xKm;@7`A>C0=?ˉo@D@@(k:;7A?C0=?ɤoD@@(: LA@T L@@Dѡ`8`ѥ,A<8c@8HH<8c@8`8H&xH;7@|;Z7{@08!AH0|!B|~x= a)|HA<8c(8 HSHH>xHI-xHDmxHFxHG9xHF)xHExHHxHH-xHDxHGxHExH=<8c |dx<8h<8Ơ<8 xHNY=?)?8 X8!P|N |Ԑ!B|yx= a)|HA<8cL8 HRH<8c088@&x8PHo,@;;`7AL;;A@P;x8Px8PHIxx8P8PHS;{7@;@,@;;`7A;@=??L=?>:;;P}>J;x<8l8P8PHR,Ax<8˼8P8PHR,Ax<8 8P8PHR,Adx<8\8P8PHRi,ADx<8̬8P8PHRI,A$x<88P8PHR),@ ;@H;P}>J;x<8L88HQ,A$x<8T88HQ,@${P|~8c88&x8HHl;P}>J;x<8\88HQ,A$x<8`88HQi,@x{P|~8c88&x8LHpq,A4,@8,@8ؐH<8cd$x8 HCyH;P}>J;x<8̈́88HP,A$x<8͌88HP,@ HT;P}>J;x<8͔88HPu,A$x<8͜88HPU,@;{7@T,A #xHL8!|N |aĐ!@B|#x|+x|3x|;x}Cx}8Kx}SSx= a)|H@X,A 8H 8, A| @ 8><`| A$=)9)"><8c8 HNiHP-((=? I$=? l$`$=? @X(89)m)!T<C0PP=?ɩh($ *d *hP(l=? h<lX(p(plP* *P(ph(=? $`( .h*HX(=? 289)m)!T<C0PP=?ɩh($ *d *h=?h$h*hP(lX(p(p=?th$lh( *P(hX(<8c$<8<8xKem<8c$<8xKZcxxxFx<8$|;xxK\M=? 2X=?9)L!8=?9)p!<@<8c$<8x8X}&Kx<8L=9|#x=_9JK\h*=?lr\|ѡ`8a\8`<8x8Hz!8 <<8cL$xx~fx8d9h9!l9ApK788<<8c$|dx|ex<8~dzx~x~x~xK6݀8!|aN |HzѾA!|rx|#x|+x|3x|;x}Cx}4Kx}YSxX\a`aA= a)|HA<8c8!H(,A$<`ѐ<8c8HJmH\8aDxHmy~X((`(8)(h(WJ(=?)7l)k**-*é,0[xI@<8a<`| A$=)9)"><8c8HD H8a`8d8h8l8pxK8at8xxH8a|88889xKYx `$`$`*ѡ `$8a|88xK\yCxdx888xKUzX(`(2X($`*ѡ`(rX(h$88!<@D8H8LP~xxx~Ƴx~x99!9AHG!0 ,AP88!<@D4H8LP~x~ijx~x8899!9AH@=8!|N |!B|;x}'Kx = a)|HA<8c8HBHL@HP8@ 8H8P<8cHx8!p|N |!pB|3x|;x= a)|H@4,A<`"H,@$<`"<8c8HA-HЀ94A=?I.8@U :}+") )*}+* *}+bi k*J, 0 2I@ < 2z 8 j<H D2)cz 4kH:}k: J2*J@$Kk2k@$k94@`8@8`Hu8!|N |А!B|#x|+x|3x|;x}Cx}4Kx}[Sx = a)|H@\,A 8H$'|H@| @ 8;<`| A$=)9)";<8c8H?H(,A<T:|d|U:|}8c888HPiH T:||8e8HQu !@=?d@hA=?(@h@ѡ@@H5P}>Kx7A$Wx8x<9)|H@,W:|}8g8|;x}Cx89HH,ADT:||U:|}8e88889HOmH(T:||8e888HPq !D=?dDhA=?(Dh@ѡDW:||8f88@9D~xjxHGD@;7@,AHT:|d|T:||8c88@889H~xjxHG18!|N |Hm9a!P|#x|+x|3x|;x}Cx}4Kx}[Sx = a)|H@\,A 8H$'|H@| @ 8;<`| A$=)9)";<8c8HKx7A\x=?é=?É:`6x79)|H@tW:|||+x|3x88HM)=? @ A=? @@W:} |. (H,AW:T:||Ʋ|d|88HL=? @ A=? @\@T8U):})W:}`|. (`(h$*`$$X($*h$ѡDH0aDH(W:|||+x|3x88HKW:||8f88@9D~xjxHCMD@;7@`,AHT:|d|T:||8c88@889H~xjxHB8!aHiP|a̐!@B|#x|+x|3x|;x}Cx}6Kx}SSxaA= a)|H@8,A 8<<`| A$=)9)"<<8c8H8}H ,AЀ,AĀ ,A,@Ā:|xHQAW:} }+ (с@}Kja`D}+ h*d}+h*H hL}k h(lсPap<8c|8@8`xHl];7AKX ,@:|xHQAW:}I|ɪjk(a@}i|*с`}  h*D h*d h*H}) h(h h(L h(laPсp<8c|8@8`xHkq;7AK8 ,A:|xHQAlW:}I}i h(@}i `}) h*D d<8cl8@8`xHj;7@,A:|xHQAlW:}I @} }ih(` D})h*d<8cl8@8`xHj];7@8!|aN |!B= a)|HA<8c`8H5AH,=?)!    X8!P|N |!B= a)|H@l,Ah@ 8 H$,Ah@ 8(<`| A$=)9)"(<8c8H4]H4=?)!x     X8!P|N |A!PB|#x|+x|3x|;x= a)|HA<8c48!H3H,8(8<8<8{8<8{|3x9!9APH8aP<8X8(8HZ,@48aP8(HOM|}x8aP<8X8(8HZ}PH;88(<cx8x<8{8<8{|3x9!9APH58aP<8X8(8HZ!,@48aP8(HN|~x8aP<8X8(8HYPH;x|@xz8!|AN |ۡa!B|{x|#x|+x|3x|;x}Cx}5Kx}ZSx8<@c= a)|H@,A 8Hl,A 8HX,@(|H@| @ 8H,,@5|H@| @ 8<<`| A$=)9)"<<8c8H1qH8a|888xK8A8<@Dcx$x~x~xx~ȳx~x9AK8axHT),A=? y @=? z @=? z @=? z,H=_zh@=? {tH=?zh@=? zxH=_zh@=? zH=?yh@=? zHd=? z, @=? {xHD=? {t @=? {|H$=_ y @=? z $H=_ y L@@=? {=? {H @|=? y 2*H\ @P=? z 2=? |2Ѿh@ =?z,h(h*7| P| x9)!8| P| x9)!888<@DHL8a|888gx(x~x xH=?) ,A؀,Áa, A|(= C0=_Ɋllt!pp`($h(m`tp`($=?yh*ѡ8axKL=? z$( x=?9)y!8=?9)yđ!<@<8cyx88x}&Kx<8y=9y=?9)y=_9Jz K>5|x HQA=?y|6|xHQA8|T:`;@ W:|{8A<8c<8y<8y<8yx|3x|3x9!9A`H 18a88`x8 H[*;7@*;79@H8!|aˡN |!B = a)|HA<8c8H,]H<=?)      X8!P|N |!B|#x= a)|H@ #9)( '@$<`"<8c8 H+H,T@.=?)9)}c[x|J|3x8H-9X8!P|N |!B}+Kx!)<`| A<8c8 H+-HL=?)         X8!P|N ||@&HZA!|vx|#x|+x|3x|;x}Cx}8Kx = a)|H@$ LA@$<`"<8c8H*QH$,A@888<@8a888899!9AKUH<888<@8a888899!9AK=? w28a8xH,Ax,A0,A88H488H$,A 8H88$P=?9)q!8=?9)r!<@8a88P88=9r89!9AK: =? q LA@=? w *HX\ld<C0``=?ɩxh(=? q LA@ hH=?wh(X\ld<C0``=?ɩxh(L@@lX\hl|xQA@: 9?@C0=?ˉx;;a:t9:A|,A,A !HodA``(Pp8a<$t@D8aP~dx~x<8r$8=9q9!pH|,A H!odA``(Px8a<$|A@D~cx8P~x8<8r8=9q9!x9AH4;7@(=? s L@@8=?rh*hlh(hX\|x}@QA@C0=?x?;{ .--, }&, |&,|&,|&9:!:9|;;odA``(W:}) * LA@ L@@@A ,@A,@,A} A,@,A|| A,Ah,A`,AX| A,AD,A<,A4| A,A ,A| @,@؀,Ad,A H 9 !!8<$|@D8a~dx~x<8r$8=9q|ixHd,A8H!8<$x9!x!@D~cx8~x8<8r8=9q|#x9AH1i;7@8;7Z@ 8!@} HSL|!!PB|tx|#x|+x|3x|;x}Cx}>Kx}SSx= a)|H@d 8 LAA(=?j4hA h@ 88<`| A$=)9)"8<8c8H"QHPX8P8X,A<8cj`H<8cj`8X8PxHV=? j4 LA@=? o *H@aD=? j4 LA@ hH=?oh(@AD|À,Ah(HX,Ah*H\|xQAx>C0=?q;PoLHH(P,A<8cj`x8XH<8cj`8X8PxHU};7@|P,A,Ah(HX,Ah*H\8@P|x7ZA>C0=?q?;{|;;oLHH(W:}) * LA@T L@@DѡP8PѤ,A<8cj`8XH<8cj`8X8PxHTe;7@;7Z@\8!|!N |HOMA!|xx|#x|+x|3x|;x}Cx}:Kx = a)|H@8,@ 8:<`| A$=)9)":<8c8HH,A@8889)m)!<C0=?ɩmlh(czb(.=? l4 A=? g, @ :@`8aH)H:@=?n,Ap,AL$$8a888GxKE8H48̐8H8̐8~; 7{AH>C0=?˩ml:(o ɡ(`:$A8<8a8888=9f9!9APHɀ,@@;7A0;P||8c<888H;7@܀,A<8aP8(H7!,@h8aP8(H7 |gx8a~dxH88aP8(H6,@08aP8(H6|gx~cx88PFxHIi;97{@,At !aH o =? fLA@ =? f*H=? f(,A,=?hth*=?hh(H(=?hh(=?hth*<8cfx8ExHJy !<8cf8ExHJ] !o<C0=?ɩmlh(888Đ<$8@AD8a8<8fx|+x<8f|+x9!9AH'm8!AHIp|HI!0|ux|#x|+x|3x|;x}Cx}4Kx}SSx != a)|H@ 8 LAAH,A (d@ 8H(=?`lhAh@ 88<`| A$=)9)"8<8cp8HQH,A#xdx~xfxHcx$xex~xxKa,Ah(HH,Ah*HL;@7A?C0=?g8;Po@D@@(k:P,A<8c`x8HH<8c`8H8PxHL ;Z7@3, @l8 lD<C0@@=?ɩg8h($,Ah(HH,Ah*HL;@7`A>C0=?ˉg8o@D@@(k:;7A?C0=?g8oD@@(z LA@T L@@DѡP8PѤ,A<8c`8HH<8c`8H8PxHJ;7@|;Z7{@08!йHE|!B= a)|HA<8c8HHl=k9@KKKK K=? ]D <  <? $ ,K0 4K8 C0ˉHo`D@@(k:;7A?@C0=?HoDA@@(z LA@ L@@tѡH8Hh:,@<8cB8PH ,@<8cB8P8H8XH<8cB8P8X8H'xK;7@L;{7@8!H&p|Ȑ! B|zx|#x|3x|;x}8Kx}[Sx = a)|H@x,d@ 8 H@(j=?? `@$h(`@ 8 ;<`| A$=)9)";<8cv<8HuHx(j=? ? @8x88|<8@aDCx$xxx9!9AH9,A(89)m)!t<C0pp=?ɩD,h($;7A:P? C0hW:8lt!pp(o8a8x8|88H) =;7@H(j=? ? @<b=? > @=? =`$HP=?=`hA(=?=`hA h@=? =H =? C@b=? > @=? =`$HP=?=`hA4=?=`h@,=?C@с A=? =8x88|<8@aD#xDx8xx99!9AH%,A(89)m)!t<C0pp=?ɩD,h($;7At:P>C0h;AW:8ltpp(o|:8a8x8|88H =;7@xH,PT<8c=8P8fxH&8!|N |ܐ!B|xx|#x|+x|3x|;x}Cx}=KxaPT= a)|H@|%9)( AD=? 9 8L@A,=? > A=? > @ 8><`| A$=)9)"><8cq8H HxHS,@88<x<89@<88<89|+x|3x9!9AH,A8ap<8rH8ap<8r88H5,AD;x8H Ma8;px8H 1a=?9)r !8aP88<89D8HCx$xxHN8aP8H |gxx~x8PH,@]<`@$8=?)@AЀЀH F5 !;88 <8a<8:<890<89<88|;x9!xHϙCx$xxHNx8 H 5|gxx~xxxHр8!|N |ܐ!B= a)|HA<8cod8HH;;'=?);9:I;Z;i;{D=?;W:}+}+ }k W@.|c<8o88H%;7@8=?) x8!p|N |!B= a)|HA<8co8"HHt9@8'=?8@8~8@=?8889 UK:}+I}+I}+"}+2}+:}kB9J4@ĀX8!P|N |!B= a)|HA<8co8HAH99@'=?iP8c9P88P8DP8P8U :}+}+" }+* }+2 }k: 95J@8=?)P X8!P|N |!B= a)|HA<8cnL8#HiH89'=?9@8]@9<?8};88 8T:}+I}+I}+b }+}+" }+* }k2K85@X8!P|N |!B= a)|HA<8cm8HHP;;=?;W@.|c<8m88H;7@8=?)ܐ X8!P|N |!B= a)|HA<8cn 8#HHx88'=?d<@UU`BUV8}98@8??T:} 9'| }+p| P} HP(}*}*"}J*84@X8!P|N |!B= a)|HA<8cm|8"H1Hh9@8'=?I֤8`88@=?889UK:}+i}+"i}+*}+:}kB9J4@̀X8!P|N |!B= a)|HA<8cl8#HyHt88'=?<<`*`c88@8@=?T:} 9'| |p}+p| P } HP9)(}*"I}J*84@X8!P|N |!B= a)|HA<8clH8(HHP9@8'=?i$88@898UK:}+}+:}kB9J4@܀X8!P|N |!B= a)|HA<8ck8#HHH99@'=?x888@U :}+* }+2 }k: 95J@܀X8!P|N |!B= a)|HA<8ck\8H}HL=kӼ=?i/hk=?4ы=?4ѫ=? /< kыѫ X8!P|N |!B= a)|HA<8cj8!HHl8@;'?;s=?,;@T@.|<8csH}<8c.8@8H H!@9)!@7@h8!`|N |!B},Kx= a)|HA<8cjD8"HH=?-hL@A hL@@ 8= a)|HA(<8cjD8"HŁ>=)9)">HX=k(       ! X8!P|N |!B}+Kx = a)|H@X 8 LAA LA@ 8 +<`| A$=)9)"+<8ciP8HH<=?)T      X8!P|N |ؐ!B|{x|#x|+x|3x|;x}Cx}7Kx}VSx= a)|HA<8ch8 HH4=?+hL@AhL@@ 8= a)|HA(<8ch8 H㭁>=)9)">HL=?)Р        x8!p|N |!B= a)|HA<8cg8$HH=?)< X8!P|N |!B|3x|;x}Cx= a)|HA<8cg@8HH=?)8h*@h*D *I,@ 0aD 2L@ < 2z 8h<)H Dk2Zz 4`:iJA@X* h$@сD h$D8a@8D}e[xHuh8!`|N |!B|}x|+x= a)|HA<8cfD8 HHx8a<8fd88H8ИxxH5|~y@@8a@x8xH;@|~888H8ax8Hⵀ8!|N |!B= a)|HA<8ce8!HH<=?) ,A<8ce8=HH=?) X8!P|N |!B|#x|+x= a)|HA<8cep8H%H9`9@=?̈́8̈́8Ui:}): |(A9k| @ 9`9@, @8, A,<8'8@8D8HH%@h! | h8!`|N |!B= a)|HA<8cd8HEH<=?)̜ ,A<8cd8:HґH=?)̠ X8!P|N |ܐ!B|yx|#x= a)|H@D#9)( @H<8ckH <8c%$x8H H<`<8cdt8HqH=?i# | A+=?);7A=?;I;Z>b[xW:}+ ,@d}+ , @4#x8@H1@,A<<8cd8 HH$W:}) ,@#xxH%;7@8!|N |!B|#x|+x= a)|HA<8cc@8 HAHD=?)ʠ ,A<8cc`8?c[xW:}+ ,A}+ , @P8w888 899#9CHX,AX<8cb8HH@W:}) ,@,!8w888 899#9CH݉;7@L8!|N |ؐ!pB|;x= a)|H@D LA@<`H  LA@$<`ސ<8c_8HHH=?)Ű ,A<8c_|;x85H]H=?)żթ щ =kŸ9kh( =@C0=H&lTAPPP(2 h($ы lTAPPP(i2j ( lTAPPP(2 h($ы lTAPPP(i2j =?)Ű;7A=?Ű;IŰ;Z:X>?c[xW:}+ ,A}+ , @P8wż888 899#9CH)X,AX<8c_8HH@W:}) ,@,!8wż888 899#9CHڭ;7@L8!|N |!B|yx= a)|HA<8c]88HyH=?)ԃ;7A=?;I;Z?c"[xW:}+ ,@\}+ , @08a@H¹@,A8<8c]P8HH W:}) ,@ #xHۡ;7@x8!p|N |ܐ!B|wx|#x|+x= a)|HA<8c\d8#HiH=?)̀ ,A<8c\|+x8?HDZH=?)̃;7A=?;I;Z? c9W:}+ ,@D}+ , @4~xx8@H1@,A;<8c\d8#Hӱ;7@8!|N |!B|#x= a)|HA<8c[8HQH=?)i }XP9|x|XQA=?8 c|#x;@|8P} | @A(H}(HP8| @@8,AK, @@ })BA})) }I }`|.| .    84@|=?)9) )|x}@HQA@=?9@ }`2} B|.|.    85J@=?);7A=?;i;{??@cZW:}+ ,@X}+ , @Hx8c 8|ex8899! @Hz @,AY<8c[8Hщ;7@ x8! p|N |Ԑ!B|vx|#x|+x|3x|;x= a)|HA<8cY8HH=?);7A=?;I;Z[xW:}+ ,@\}+ , @ ~óx~x~x&xxHQH0W:}) ,@~óx~x~x&xxH1;7@x8!p|N |!B|#x|+x= a)|HA<8cX8HH=?)p ,A<8cX83H]HX,A=?)|9)H=?)|9)iX( `(2 X($`* X8!P|N |!B|#x|+x= a)|HA<8cX$8H-H|=?) ,A<8cX<83HyHT,A=?)H=?)9)iX( `(2 X($`* X8!P|N |!B|#x|;x= a)|HA<8cW8 HQH9`9@=? 9c9Ui:})B |A9k | @ 9`9@, @, @<8cW84H\U`:=?)}) |, @|Cx|+x|3xHH0U`:=?)}) |,@<8cW8@HX8!P|N |ؐ!B|wx|#x= a)|HA<8cW8H-H=?);7A=?;I;Z>?c[xW:}+ ,@}+ , @H~x8 888 9@H̀@,AP<8cW8H̉H8W:}) ,@$~x8 888 (xH;7@\8!|N |!B|#x|;x= a)|H@D LA@<`H  LA@$<`ސ<8cU8H˭HT=?)L ,A<8cU88HH,=?)X   X8!P|N |Ԑ!B|xx|#x|+x|3x= a)|H@,A$<`<8cUD8HH=?h,A$88 =?)p )xHH=?)`;7A=?`;I`;Z>b[xW:}+ ,@t}+ , @<x~x~ųx8@HVـ@,AD<8cU`8HH,W:}) ,@x~x~ųx&xH5;7@t8!|N |!B|#x= a)|HA<8cT8"HɍHd=?) ,A<8cT$85HH<,A</8cBp</8B</8Bh</8BxxH</8cBt</8B</8Bl</8B|xH]=?8 V<8c|dx<8|+xxK<8c|dx<8|+xxK)H?;V؀,A`</8cBp</8B</8Bh</8BxxK</8cBt</8B</8Bl</8B|xK8H <8cT8"H5<`X8!P|N |!@B! = a)|HA<8cR8HH=k89kk:`dx| x9)!x k:`d|| x9)!|k:`d| x9)! k:`d| x9)!k:`d| x9)! k:`d| x9)!;AhA8;ala<;p@;tDH8ax8|88899!9AHU=_J9J@A8<8a8Exfxxx=?9)9JHe><`| @!t8|HQA?88$=?i8c@,A|P!|JH!}%J8,@~8 |ApT:}) |@|xT:}) ,@8| x}`@QA08}=?}*})B 9J5k@84@H8!|N }+Kx8A<@D$| A| AD  (| A Hp H    H$|HA4   H`&|HA$   H    N |ؐ!B||x|#x|+x|3x|;x}Cx};Kx}WSxa = a)|H@((} HP9)| @ 8% <8cN8 HIH,$|H@X%|H@} Kx9|H@} Kx:|H@} Kx9|H@} KxH܀$|H@ 9#|H@9H'} HP=`C0=_jm)!Da@Ɂ@X(`$| PlLaHHX($#| PlLɡHX(h$| PlD@X($`O}&U, Apxx%xx<8 xix~xHxxExx<8 xix~ʳxHCxx%xx<8 HlxxExx<8 xix~xHiCxx%xx<8 xix~xHAxx%xx<8 xix~ʳxH8!|N A|#x|;x}Cx}GSxe}`XP&} HP}`p| Zx}@PPUJ<} p|Jx|@PTB<;, @;;, @;| @l,A`&|HPx|||x4Ae| PT:} :|X@}`[x |B4A`KԀ&|HPx|||x4A8e| PT:} :|X@}`[x |B4@}@p|}P#|Px||}#Kx4A܀/A$| PT:} :|.|@(H | PT:} :|.|@|`x , A |}`P}|cZ4AlK|@p|}PPc;|Px||}$Kx4A4| PT:|g., A |c}`P}R|Z4@ػAN |ܐ!B|xx|#x= a)|HA<8cI8H}H=?) @ Aѩ=?)܃;7A=?;);9>b;xW:}+ ,@d}+ , @4x8@H@,A<<8cI8HH$W:}) ,@xDxHݵ;7@8!|N |Ԑ!B|xx|#x|+x|3x= a)|H@,A$<`<8cH8H-H=?);7A=?;I;Z>b[xW:}+ ,@t}+ , @<x~x~ųx8@HJ@,AD<8cH8HH,W:}) ,@x~x~ųx&xH;7@t8!|N |!B|dx= a)|HA<8cGp8H H<=?)h ,A<8cG8=HYH8=?)h X8!P|N |!B= a)|H@,A$<`<8cG<8HiH;9`=?I9Jc 9W:})R |A;|@ ;9`, @,@<8cGX8.HmH(W:=?)}) |, @ =k+9)+HEH4W:=?)}) |,@=k+9)+=?)؀ }^P95JA|=?i8c808Xɨ88U :}i }i" }i* }i2 }): 95J@=k9kU :})Z8 +\9)+\X8!P|N |a!B|+x|3x|;x}Cx= a)|HA<8cE8 HqHp9`9@=? 9c8Ui:})B |A9k| @ 9`9@, @, @<8cEx84HU`:=?)}) |, @|#xdxxx8@Hc5@,A<8cEx8@H,@=?)iX( `(2 X($`*ѽiX( `(2 X($`*ѼH4U`:=?)}) |,@<8cFx8BHux8!p|aN |!B|#x= a)|HA<8cD8HH9`9@=? 9c8Ui:})B |A9k| @ 9`9@, @, @<8cDx80HlU`:=?)}) |, @$8a@H @,A@<8cDH(U`:=?)}) |,@<8cEx8:HAh8!`|N |!B|+x= a)|HA<8cD$8HyH9`9@=? 9c8Ui:})B |A9k| @ 9`9@, @, @<8cD<8,H}HLU`:=?)}) |, @ HiH(U`:=?)}) |,@ |#xHڵX8!P|N |!B|;x= a)|H@@,A<`H$$, A| @$<`<8cCX8H-H%|x}@HQA<=? }`:} 2|.|.    95J@=?)ă;7A=?;I;Z?? c9W:}+ ,@X}+ , @Hx8c 8|ex8899!@H\@,A;<8cCX8H=;7@x8!p|N |!B= a)|H@,A$<`<8cA8HH9`9@=? 89c88Ui:})B |A9k| @ 9`9@, @, @<8cB81H=?)89)U`:} J ,@8 H\U`:=?)8}) ,@<8cB<87H,U`:=?)8}) ,@<8cBt8/HIX8!P|N |!B|#x|3x|;x= a)|HA<8cAH8HyH8=?)܀ ,A<8cAh8;HH|+x}e[xHiX8!P|N |!!B||x|#x|+x|3x= a)|H@(,A<`H =?)H ,A<8cA|3x87H$=?)HI;5JAL=?H8 H9W:}+: ,@}+B)| A;5J@=?iH+, A8  H<8cAHx8EH9@;=?iH9k=a, A(W:})Z ,@ 9@H$;H<8cA8HHp, @;9); ( @<,A,,A$,A<8cAx82,@; , @L=?)\ ,A$, @8P8T8H8P8ÐT8X8aP<D8 88T8X9\H2ـ\,A8<8cAx8>H=<8cB 8H<`H`<cD8c 888 HxHՉ<cD8c 8|ex8899!\HW8\8<cT888 899#9CHH,<8cB<x8JH,@=?)\ ,A,@ Cx<8P|#x<8(H$,@(Cx<8P|#x|#xxH}8H\,@ Cx<8P<8(|+xH(,@,Cx<8P<8(|#xxH!8P8<cT888 899#9CHH<8cBx8PHu=? H9W:}*B }(R $ L)t8 P,@8}+Kx=? @ <? HT<8cBx8.HH<P,@0=kH9kW:}*Z<? }kR=? @ $8!|!N |!B|#x|+x= a)|HA<8c>8#HHD=?)T ,A<8c>88?HAH=?)P  X8!P|N |!B|#x|3x= a)|HA<8c=8HYH=?) ,A<8c=85HH9`9@=? 9c陸8Ui:})B |A9k| @ 9`9@, @, @=?  <?H,=?)9)U`:}`J }) $X8!P|N |!B= a)|H@,A$<`<8c=8!H)H9`9@=? 9c阘8Ui:})B |A9k| @ 9`9@, @, @<8c=483H=?)9)U`:} J ,@8 H\U`:=?)}) ,@<8c=h85H,U`:=?)}) ,@<8c=81HX8!P|N |!B|#x|+x= a)|HA<8cH8!|N |А!B|zx|#x= a)|H@@(@H<8c2H]<8cDx8HHE<`<8c8T8HH0=?i# | A+ ,A0, @ H=?) =?)| H=?);7A=?; ;>bx=?鑬::W:}+ ,@t}+ , @4Cx8@H}@,AL<8c8t8H%H4W:}) ,@  |e||fxH;7@t8!|N |Ԑ!B|xx|#x|+x|3x= a)|H@,A$<`<8c68HmH=?,A$88 =?) )xH}H=?);7A=?;I;Z>b[xW:}+ ,@t}+ , @<x~x~ųx8@Hـ@,AD<8c68HH,W:}) ,@x~x~ųx&xH;7@t8!|N |ؐ!B|yx|#x|+x= a)|HA<8c5p8"HH=?ix# | @+|HA=?)x  =?)t;7A=?t;It;Z>b"[xW:}+ ,@l}+ , @8#x~x8@H@,A@<8c58%HAH(W:}) ,@#x~xxHa;7@|8!|N |А!pB|xx|#x= a)|HA<8c4X8HH=?)  Aѩ=?);7A=?;);9=?>C4>b;xW:}+ ,@|}+ , @LPPh$@8a@8DH%D,A<<8c4x8!HH$W:}) ,@xDxH-;7@l8!|N |А!B|{x|#x= a)|H@@(@H<8c,8He<8cdx8HHM<`<8c3D8HH=?)c | Ai=?);7A=?; ;>bx=?鋴::W:}+ ,@t}+ , @4cx8@H@,AL<8c3d8 HeH4W:}) ,@  |e||FxH;7@t8!|N |!B|#x= a)|H@(=? 4 L@@$<`<8c18HH(=?)8 h(r@ (@h$@=?`(cn@=?)0 @ Aѩ=?),;7A=?,;I,;Z?c"[xW:}+ ,@d}+ , @48a@8DHD,A<<8c28"HH$W:}) ,@8a@$xHY;7@x8!p|N |А!B|zx|#x= a)|H@ #9)( @$<`<8c08HH$=?)c (| A i ,@=?);7A=?i;{ ;>bx=?鈈::W:}+ ,@}+ , @4Cx8@Ho@,Al<8c08"HMHTW:}) ,@@,@  |e||xHH<8c0x8=Hm;7@T8!|N |ܐ!B|xx|#x= a)|H@(@$<`<8c/8H}H=?)c ,| Ai=?);7A=?;);9>b;xW:}+ ,@d}+ , @4x8@Hp@,A<<8c/8HH$W:}) ,@xDxH;7@8!|N |ܐ!B|xx|#x= a)|HA<8c.`8HMH=?) 0 Aѩ=?);7A=?;);9>b;xW:}+ ,@d}+ , @4x8@HM@,A<<8c.`8HH$W:}) ,@xDxH;7@8!|N |А!B|zx|#x= a)|H@ #9)( @$<`<8c-P8 HH=?)c 8| Ai=?)|;7A=?|; |;>bx=?x::W:}+ ,@t}+ , @4Cx8@H@,AL<8c-P8 HIH4W:}) ,@  |e||fxH;7@t8!|N |ܐ!B|xx|#x= a)|HA<8c,8HH=?) < Aѩ=?);7A=?;);9>b;xW:}+ ,@d}+ , @4x8@H@,A<<8c,8H H$W:}) ,@xDxH;7@8!|N |ܐ!B|xx|#x= a)|H@ #9)( @$<`<8c*8HeH=?)c 4| Ai=?);7A=?;);9>b;xW:}+ ,@d}+ , @4x8@Hu@,A<<8c*8HH$W:}) ,@xDxH;7@8!|N |!`B|#x= a)|H@,A$<`<8c)8H!H,=?)!(, @,=?) ,@<8c)8:H]H8=?) 8=?) =?) 9`8 =?I9J9Ui:})R 9k4@=k8 =? = ?+   + $ (+,;`x8@x88HcUx<8*88H,@=?)8 8H=?)8) 8 =k8l 8 +9)+ xH8X=?) =?)88Ð l<C0ɡ= h(hѩ9 ѩ 9@I(I,<? 09`ii4i8 < @=?)Ii  8!|N |H!|#x= a)|HA<8c'8 HH,A`=?)~ ,A<8c'8'H=?)~;7A=?~;~:Ђ~: ~;>?q~;{$:xwx::`>@C0=?ˉ=?I =_j=?é0W:}+ ,@ }+}+}+ , @88{88Ha9{;|H@} Kx HW:}) ,@w97LA@*H( 1~9) lA(2LA@*H( ;7@=?~;=?)~ʼn (=`C0=_JlaP(2 h($ўlaP(i2j (laP(2 h($ўlaP(i2j>|I֐8a<~ExHj:<`| @8HCxH<8c'Dx8DH<8c( Dx8AH<8c(dDx8$H=?~,A`888<8Đ@8ȐDAH8d8 <8|+x|gx|#x=?)~)9AH1:=?)~;7A=?~;~:Ђ~:=;`~::A> b1"=?!~Գx=?i~99?C0=_˪܃/~;9W:}+ ,@<}+}+,A4,A(o~ !| A !| @$a`apdathxal|W:}) , @\A8<8c|dx<84|+x|gx|hx|+x|+xHy,A4,A(o~ !| A !| @(8a8H{y<8c,8`8p8Hy=a8 A8 !}+HP9)!!}*HP9)!=?)~ 8A<8a8~88899!9AH/:,A:<8c(8HA8!i~888 899#9CHUHdW:}) ,@PA8<8c|dx<84|+x|gx|hx|+x|+xH,A4,A(o~ !| A !| @8 |e|r|jFxHĕ<8c,8`8pFxHɁ8l(2Ѐl($ѡЁA8 l(2Ԁl($ѡԁam`(2؀l($ѡ؁!m (2܀l($ѡ}hXP9ka88}*HP9)!9!!<=_J~ @AD8a888'x99!9AHꭓA8!i~888 899#9CH;7@,@<c~DxHb8=?)~ H<8c(Dx8#H{)8!pH|!0Ba萁쐡|3x|;x}Cx}/Kx}NSx a !(= a)|H@L,A<`H0,A<`H,A$<`<8c8 HH! p t=?)t ,A=?h@ p=? ϴ @ =? 0 @=? XH =?<h@=? РH =?h@=? ϤH =?h@=? H =?h@=? ϴHd=? X @=? ФHD=? Р @=? ШH$=? @=? < $pHt=? L@@=? Ьp=? аHpt h@t=? 2p h*HXpt `@L=? , 2p=? 2tp @=? X(ѡp *t=?)tă;7A=?t;It;Z=?!|:p:at:Ax?c"[xW:}+ ,@@}+ , @ȁ!|it8c Ht-8<@D!!HLaP$TAXa老쀡~&x~x~x}{x}sxHx,A,@<8c$x8GH x,@<8c$x8DHwA<8c 08HHlW:}) ,@X8<@D!!HLaP$T!Xa老쀡~&x~x~x}{x}sxH;7@8!|N |!PB|ox|#x|+x|3x|;x}Cx}1Kx}USxa!= a)|H@,A$<`ѐ<8c8HH=?)pH;7A=?pH;IpH;Z>b"[xW:}+ ,@}+ , @`8a<@8PD}{x}sx}kx~xx~Hx~)x~xH"P,Ad<8c8HHLW:}) ,@88a<@!D}{x}sx}kx~xx~Hx~)x~xH;7@08!|N |!0Ba|#x}-KxA !aA $(,A0= a)|H@,A$<`ѐ<8c<8HH=?)n;7A=?n;in;{? c9"W:}+ ,@}+ , @x8=)9)Б>H=?)m ,A8<@DHaLPATX\ `$d8 h8 l=?)m pt#xx~x~Ƴx~x~x~ix~JxH }H<8cx8FHq8!|AN |A!`B|bx|#x|+x|3x|;x}Cx}:Kxa = a)|HA<8cT8H(,A$<`ѐ <8ct8!H}HpA8ؐ<ܐ@D8pHLP=?9)!TaX<8c@|Dxxxx}cxixJxK8!|AN }(B>; 4k:@!?!>(=_Q>=k:vk>@?Jk:pk|=k=_}Cx=>????>K|qxN> ,k= hk= k9IJk8Jk9J [k|3xkukI=?C< V|;x|#xXBF kx9#J |+xH<kt| @<kpDH<kp?_>_/z Б2H8`H,??kl|@= ;`~8mJ8HMH>ckh?_Pkd}}(|#x}%2i$H=a88|8H]>ck` P\|zxx?k\|hb0ԓ,@: / @?xkX|#x;<;;~888xxHI,@,A;/9`8} Cx@H;9!I8j9k|A |Hx9`| I@ }d[x} Cx9)B́@A8<=kTaA~bkP8H= ;`)8mJ`Hi= 8kJH}=_ 8jJHqklSkh8lPk`ȢH!k\?<kTgf.9)%kP, aԑ@8`iH,@ /@> 88tKHҵ9??|kX ԓHb%kl?kL0 } 1%0,@? 8}KPH <_ 8bKpHuyklK<,@= 8mKH ? 8xKHIkl< 8eK؀48H =? 8iL $HkLd/A? 8{LPH ? 8|LtH邚8|@@A8Ykl=KkH L,H@4/ u@(,m@kL=? ;8iLH}?<kT8ankPnHh? :`8|LHA> ;0 U:|.>_ 8rMHdx>? 8qMPH> 8wMpH> 8vMH~Hkl;3kh8m8I9@9 Pk`; Z~bf48:}{xd8~x8r8a<@DH?|bxkD=_m|Dx8 8(8(LH9|xxqP,XT@0: 8`9:|a!!dahHL/@8;89`99@:ɓdha|AH8Ȑhd;8a8xH ,@?_ 8zMH(;8a8xH,@> 8sN HM8`Hykl< =kDx;9`{899!P:EN@9A@x9pa@LpAt8HDHE=@{aEH{; HA?kT=]k(9`kP<k<9r?/<kh=>==_#k@8k0k,<ɘk8k4 k$:uP< =?&$/k|C k 8HE?<=]kk?k;k &82{k HԹ/ A,AH,$,@ H$~ w$wHN/@CxHIaHAaH98!~N |B!`C|yx|#x|+x,A8`fHX8;|8@@=>===_=?=<<oaLLaH+a aDa@aaa====?=_=</__`k_I_j`___|8P/@8;|8@<~xE~>x~x}{x=C0~ex~FxW:|W:.}B;h:`ap!t}(.dxmi!|!x|.9J P(`@1C (pAtNB{9;Ȁ_Hб|8A H?>C0`>3>_>x/ n2`@|xH(p8$$@Apt@;|@=<==_=<<<<n_E_?`C0,` __`_肃_翴W:ax8Pl;a|x|.>(|Z.rH::vh$((``aptpv|4}@P}(}^}|P8P!TaZ\A^RVXHX|ALH/ @;|@?`C0oA=a>>ο>w>(>>_>?<<___`_r_Q`%_耵W:ax;l|8Pax}'.K(|.8 czPaD)g@(`@aptApv|4mˀ|\pPa|oʀA}Pɡx}!}. ((((*`8*@( ap@`tApAt!patApatXPARaTaVaZra\jA^A`!dlnbfhHU|@Aȃ`D]/@;|x@>_>?>>>>>?>__Q_`0`__>C0{_W<:ZQW:;mB9@A}.^(o|.P-bue1H(8  !p!tpv},4|`Pix|@PhxH)|AlH/@;|p@xo?C0|>x?Կ>x>;=(<<<<=w_r_`__g`D_+_W:8Pl8;a}.K(T|.-` P::(` @(aptApav}4mBAliɡ!!M(!((* (`*@`8p@(t؁ptaptAptXPTVZRs\^Hʹ|A8!N }(B}&<gXH|zxۡ|#x|+x|3x!?![,A<XL%!paptH4?Xd,AT>>XT>_X2XnHɡo=nXHɅ9@[~X,@> 8t;hH!H =<KX<X ?z>dX;`^XJxj3X:@ءPAT؁PT<PH)>;XD||x=Hȱ=?=Wh4,|@&TB.AAH=xXTxvHI|vx/@}}p{H,@c=?WO9(@/A,AAxW>_2XT,pLPH~ZA /@ |^xH<,@~p|PH$,@ H/@ |^p@@=?<_> XX`|wX|hxxH%H(XDo=-H-H<`C0oƀahloEod?\??,>d=aX~ųxa`~xɁh`ɡX((lM(h0OX` (yXtPX(^2"zx:8(@( AP}AT!P!TH|~y@? 8x;|HM8Ht==nXTxlXx[x8H}Hq}x88~dzx~x9 9@H-|qy@? 8|;H8H>_.AHO%}x>C0ǹHŃl<_hoTH!hlŀɂ,lH`(ȁhlal (L`(ahoɀ!l}LAhoh`l `(Ahl!h`(i`(?rXc`(*8z@@*XAP@0T`@rodˡ`}`(h X^r@0P HP@ فPTo=@C0ad?A`X(Ɂ`, (@@8ۡPT<@C0od=A``Ɍ,`(X((@`@aPTo'AhlahA``(`( P*+H(IP*١PToAdˡ``(h @PۡPToA`d0(ˡ``(@hۡPToA`d0(ˡ`=`(H 0@hPTA`PTmadˡ``(`h@ ؁PTm A`!dˡ``(`h@8PTmA`da`#`(H @@PT(A`P!Tm#ad``( (@@PAP!Tm$A`d*`h`(  H@hءP!Tm%A`d*a`+`(*@ @hفP!T,@;,@;=XfXA9 XX~ A9",A, AX@~@́PX}|@PoX`}HP:Kj;hxx~Gxhx9 9@H|my@> 8v;HHh:`|@;|@==~>C0ˮ, XT<_X<}}ZP|PmFllhhlɁhf((X@8?2~>*:@HAPT١Px/!TH|P8AT.AL|@D|@<H~#x}N!nX@ L|fx~dx}kxx}N!;~A0:s|A0X>X`xWxy}kx89A8a_>PN=2N==!0|;x"}]SxM :M Nt(0؁PdTC)!@APeT+ :|G PHPTd)|m(P7c !PaT} PA;`|pP|0A;@???>N`Nl8TNX8!t89ixuJx:` pH 8|xyAԓ=_,A,@0<NLe/@899`p8@alHL,@H>?NL,A8@:@Al8@ApH89p8@lAh_>?=_?MhM>@C0*M0; oA`Ad8ȁ`|d0( 8*!2`HaPT}P8@ȁAl}րp<h|}}`=?P|Bc0}Z?C0}y:)~x}{x~*xil`Ad8ȁ`dH( X*2hءPT}$8 },U":}".|H||GHK}k| H}B;9AH;|@???hٮ0=@C08oA`d8`|@0( !8*i2XفPT}P8 @A}>?P>1ip0=C0}fl`Ad8`@H( X*2`haP!T9>| JT:|gk9kB;|ƺA4t?>NDtNl}kxM}sx~x8s9a8A>9HHH/|9&@||r||I1ց!P|:}|b}K~x|}H"9e~x~ųx+9k} t|LJ}J}$'||EF|B8c}|AlH>_> I(Fx2I8H9x/N8a>/|zxNxhxFxtIHv8>7C8@C<A|xx!@|#xG;; i`EH]>>C?pCx, ACCeHH(C<wC`MkCHa|ux, @(~y@ /C8A8^C9/( A=U :8.|"iN lLlllllllllllTllăwC{H,@=_*C/Al<_<CD~FxC~HxVCȐ`8Ad%{H =nC8~'x~)x{HH=<a`=d<C@, @C$h H3i`8AdCOCDCȁC |3x/{HqC$8|;x{HM9@=<C\#C,I@<C0H=mɭaL<AH<_<C8C|*h(%C<==OfiCCCbqH8!~N }hBa!=A\;;||xl|#x|+x|3x, |;x} Cx!PAT`d@< 8dH1H=><<;`ŀEgHE~#xPHy|tx}8,AX[9`;aP|P@ 8A }8X9k P"8BA}]Sx:}[R;] H XH䂡;;@ 9`| A$:;aP~~Z9k7Л7@BP9a T}sx}kx~x~(xIxxa8H:?>=;~ۄ,<;a\, Ay;HH$;>@ybEE;Hi|rx/ @~Ux~x/AA,AH,A/AhH8(88P8H;aP88||~x!` px| A9@aH|@A9`al  `A|8`Q| @,@;ZH(8``dS @|A;ZH8`R|(@!i! @=;I;XA|ZQ@8B(=L;T.,;]@<9! F;T}`8K8B9)BH8`T|@ȀA/@t?8];Xz|GQ@8B(=?I;T./;]@(9! 8^B8BI9)B}: H@89`a| ;]AI|Z9kF@FBH;;@!H=i8 (9@8+^AcxH|(A$9}9Z|PA8};} ;j|J|{XP8G|i8hЉC8cB8BB9` @$}8L|X9k8BB9`| |8@ZDГA;|Z9kИ@BH9a |XA;`cc @,@H9z|}i[x@ KPI}PZ9kЙB|:}:Kx;HTy8dHEHD?w < $$H@<<E|A@H#9,ALP9a T}sx}kx~x~(xIxxa8H/@> ;;<b%|H|@ 8A b8B~x;Bx|p@8@ |X;A,@=ۄ,A`9@ @???{;X9a ;TC98|K9k9)| A9@B,A9(ۄ 8/( @ 9@(I=?i;X 8,(@ 8;>?|;T|x@4| x9! 9)~nR;|A܃(8! N }hBa!A=;4|wxl|+xl|3x, |;x|!A@< 8dtHH ?>4<4lg`ŀEH}sxPHa8},Ah\9`;P|P@ 8A }X9k P8BA}^Sx};P)\Z9kzЛz@Bl,A0a|9 }sx~ixxؑ8H <>?489`4<:@a??dmW/ A444fHEH(4l<4`Eg44Há, @ÃQ48:,Al==3~xx484l~x4<{H%{?48~x~xH9@ZY44:+ A<U&:8e|.N \\d4}H,@8=? 3,@Y44$j H"=<448萡O3p4l4 |3x/}H$<48}|;xH́48=8@m4@L/ @o<C0=_mlɪ8=?<=A< 3<4 *h(4$=HfeC3d4(XL4,"@( !:4< (@0,A!|4ܐA$}|x~x~xHՀ}<$ ܀HA4@|,@l?C0??4=ɼ8=?M=<o@{3ܐ<AL4 4$h(h 4(3EYC4,f(#:4<@H/ ء؁a4ܑaATa|x4}g[xC3}i[xp4l~x|H܀|~x|3xH:x43P4l44|;x ܀{HY܀{|3x5$H944$ Ha<4484748~x~xH䃦4<]/ A=4@G,@0=4 3~xp4ld~xHT,@T<4C3~x04l|;x܀nH!܀n~x|3xH4;4l>tbH@ 8A 8B~;B!xy|X@ 8@ |V;a|A/@=,A`9@|@?<<39a E3 |O9"|9k9)A9@B, A9(9G,(I@ 9(?{3؁9 /( @ 8k;=|#3Qx@4| x9! + 9)~R~;||A܃X8!PN }hBa=?a8@_!`?&<C0&>A@>~>\=<_[&<,w(:}7KxP9 o8 HTȁP&t&X(!H}CxU93h|;x& 8 AN}SSx8(0H<aN,%&"&\HH}cxN Lld((l !HN xL LlH,@lP<Q= 8P` a'9}~P<$&p}p8}l&p}B`P|Rp}(Px|B~x~xH-H PP<@Q=`8`\al9|~7pp|`|~&pP|p|ՠP{2@H=_&xx~ȳxxgxHx=~ijxH&PzH|A|?~%:xgx~xx9 H~x<8&&PiHm??~x}7P&~Ƴxgx~xH!H,>xw%xgx9@9 Hua8!haN |HBA?#DA<!e#<,A<#xfH8?=C0[#|=_ʃ9 z?_@m`"Dȡ@(0(` CHaL,A4<< #x8}H,~@0}< H/@<< #x}8H,@x<#@D,@=_= *#x8iH /@ <= #x8lHm~#D^,@<? #x8H|,@x<#@D/@=_= *#x8iH ,@ <= #x8lH~#D^,@ <? #x8H/ @x<#@D,@=_= *#x8iH ,@ <= #x8lHu~#D^/@<? #x8H, A , @x<#@D/@=_= *#x8 iH ,@ <= #x8(lH~#D^,@ <? #x8(H/ @<#@D,@ =_= *#x80iHH(,@$<= #x88lHq#D~#D^/@<? #x88H|, @<#@D,@ =_= *#x80iHH(/@$<= #x8@lH#D~#D^,@<? #x8@H,@|<#@D/@=_= *#x8HiH ,@$=? l#x8PkHm#De#D^,@<? #x8PHx/@|<#@D,@=_= *#x8HiH ,@$=? l#x8XkH퀼#De#D^/@<? #x8XH,A|<#@D,@=_= *#x8HiH /@$=? l#x8`kHm#De#D^,@<? #x8`Hx<#@D,@=_= *#x8hiH /@$=? l#x8pkH#De#D^,@ <? #x8pfHŐ~#D,@<#/A$=_= *"8xex8iHa?? #x8(~He,}@t= 8kH~? 8XH=,}|~x@H< 8dHa< 8f8HU? 8}xHI<_ 8bH=< 8eH1"Ax8!pHAN |hBA??8|`a!@8@~HU?<_|dxB܀~P|:4H~8988Hŀ~8 H~8@8H8=|kx}d[x~}Ha~$PC} R4H~P|:8H<CZ,A =_*T~ H8@~8H=\<_|dx P~#|J8H~8988H~8@8Hြ|dx<P~}l24H~8H~8@8H<_|dx  P~C} R8HE~8988H ~88@H5<|dxP~}l28H通,A ?~\TH8!AN |HBa<A%|~x!`|#xCi|A I,@(=?< 8 LhHH??8{LlH=_ ,,A=_  <?C0(<Ȥzx|8Pf <&yh}*<@meaDH@m@DH(@lf($ADA@/H(H(`'($D($@ AX=?=)zly= XzkzXLAAفHLH`X(@APATl@<ȩzȃy?ɞzT@. !z`L3AX\H `(H`dl P<iz<Gy|ɆzT@.R`OYӂA١hlH@`(فptH=?=_ȉz=jyɈz :`LAAptH`(@halm` H?Iz=>yT@.ɌzJ`L3A١`dH@`(فXa\l`X<iz<dy}"U"@.XezXOYӂAءPTHX(8HLl|HăLfHm8@]a8!haN |HB<AF|#x!Pc|(A(bA8`aTH,@,??h<8Ƕd8H0/@0??|h=?]8ɶĀk88H4,@<,8f|#x|ex@=C0l!D=H=_@=?aL@rȡHȊsd'0(ɉsE (`HPC$`@?_zr*[:HPH@)`$?[r*@`APHt,@L?H@(D=[@<_`h=?|<<X @(lT(7\=BPrr+?Y?J)P(il0(^sd$$Ȁ|'h$# (;rrix9xхѧAdr?Xt=Ћ$ȌrG *`PaPT,@8?_??08Y8`wpH}?>s{hl`( HA47 0a $Ki?l,A\=_<_*<0;`xHa<xHE?]zh8!`|N |HB=A`lj!= C0=!?mAa!(nAH(dH(8 0|0P<ld E$Acȁ XdH(LA@$@>  L@@>_2 hL3@>t  @OXӂ@|X(=_jX(<* |h( xLh(($I<? t|8P| p8l;HP:?n l:AV:b $Kp}k H(H(022 ( h!!!~|P|P~h@~(PA}ESx>_ h}p||P|@@~0P}Cx|TZ8@ ~P|;x||H@ ~P} Kx<?=# `PM d \fPa8[9z~%z~5899A9ĐAȑ8H=ko8`(X@<$n *@ѡ</AD@`<Ɇn`L@@,=ai ЁL3@<m4Сd<?=l>A?nn=! 샐 TX(b !>? 0a L^O =1 XSz{ :@(KSzy PzX l*gzA (@0H(`A!AaAA2 haȀ|8@`=<a>&x\Gx~4@P 9~PPa 95|HwăaH$~PP<<_=_@P AA le|X@/@p} Xa P T`( +`(F(jzz LKQ PQ (Fjz (@(!Aء@0|O4}4A~'x4|o|fp|r|3x~ xHu||p})}'Kxr}{x~xHu8ap= 8Hs%8apHp8p?|ex[(zHw%9L8H8 Ȁ~591rHs V`:= }n.~x~fx8@a X $8apHr8apHp1:>|ixt 8H9pr8Hvaa8!~hN |B!`8@8PHr8<< 8d88Ho8}<_ 8@8HsA8!8`|HN |B}H|== ,؀iHp9=؁K,|Hn]|=? PHnI|<`Hn5|<DHn!|?\Hn |=lTHmAX|8!P}HHm|B|H|8QHQ!Ti8xHY;;{7@;a`|{8c<8X88H<cdxxH=?)9)A r =`C0=_ɊE<$l,a((`(h*04HA r04l,(`(h* $L;x88HHM 8a@x88H18a@8HY|}x?;\x:a@a:@|qx!Acx88<8>8PH;;x88LHL8a@x88H8a@8H|}x|{x9@8<9x@D8c888@<8> QHM;|{8c<8` Q8H=<cdx8H18!|N |a!B||x|#x|+x|;x= a)|HA<8ct8HH8aT<888H8PTxxH|~y@H8a@x8xHu;@|~8T88H]xdx8Xx8Ke8!|aN |a!B}Cx= a)|H@D LA@<`H  LA@$<`ސ<8c8HH,,A=?)9)k:  k:$k:( k:,;x88 HI8a@x8P8H8a@8PH |~x;@|c<888H;x88$HIq8|}*8cx Q8Hx8PH |~x|c<888Hi;x88(HI8|}*8cx Q8H9x8PH a|~x|c<888H;x88,HH8|}*8cx Q8Hx8PH |~x|c<8 P8H<cxex8H<c<8}Cx8HX8!P|aN ||@&A!B9:99ȑ̑Бԑܑؑ䑡쐁|= a)|H@ ,A(<`! <8c8HH ,@! (j=? 8( @=?)H9)A| r=`C0=_Ɋ=la`(h*āA| rl`(h*aA rl`(h*;|P| p}`x| Px88HF%8a@x88HM8a@8H u|~x=?: ,9@:@|qx!A8a`88<878PH;>|@|x08a880HE8a@888H8a@8H|~x;a`|{?;,9!@!AaA8a<9`a!A!@AD8c888@<87 QH=9;9;Px88HD8a@x88H!8a@8HI|~x|{8@!Ađ!pAt9@A!A!xA|8c8p8x<87 QH9;9|{8c<80 Q8H<cDdxH(,@,!|  (=?8(h@=?)H9)  2=`C0=_Ɋ=la`(h*A rl`(h*A  rl`(h*;|P| p}`x| Px88HC8a@x88H98a@8Ha|~x;a`?;,9!@!ȁAȁȃAa9|mxcx88<878PH;>;x88HB8a@x88H8a@8H|~x{8@؁!؁Aܑ!A9@AԐaЁ!ЁAԑ!A8{88<87 QH-9;9|@xA8a88HA8a@888H8a@8H-|~x;`|}=?9),!8@!A!A9@A!A! A$8c88 <87 QH}9;9|}8c<84 Q8Hm<cDx8HaH9`T:A|} R (j=?8( `@(A} R h(`@9`,@9`, A#9)!H ca9 !. =_AHa}+P9)!, @ 9 ȑ!; !A}*J| PP;|A=?IH:R=C0==90:!`>:,9`=?!W:A|}+R rl(h*!}kJ rl(h*}sx88H?M8a@}sx88Hu8a@8H|~x|q~x:@PT:xaX\8c8P8X<87 QH}9;)}{x88H>8a@}{x88H8a@8H!|~x|q~x;A@Aa;x8c88<87 QH |;&,F@!iD~$xH; ;7@@8a`88H>)8a@8`88HQ8a@8Hy|~x;`|}8c8@ QxH%9A|}8c<88H8`|`8c<8< Q8H!iD8`8H݁!9)ȑ!A| PA 9)!8a!| H@8,@h8!`|} N |Ԑ!B|#x|+x}Cx}+Kx& = a)|H@,A$<` <8cL8HUH=?) (,@ H=?) +|t;@7`A=?;W@:}  k:@!D9}  k:@!D8i|.k:@!D8I|. k:@!D8},P}c8P}*p}@Jx| PT<}jp}@Zx| PT<;, @;;, @;|(@|p|}@(P| Px||}cx4A?9$,A<|C`P9", @h| A\, @T|| `@ | A,,@$ |A8|}+}) , A |c}DPP}J*}k24AK\|p|}@ P}cx|8Px||4A?8$,A<|C`P9", @h| A\, @T|| `@:z,9=aH#x<8|x8@H#x<8vx8 H#x<8},x8"Hi#x<8xx8#HQ,A#x<8}Px8)H#x<8}|x8H#x<8}x8DH#x<8}x8 H#x<8}x8#H#x<8~x8#H,A#x<8~4x8H#x<8~Px8 Hy#x<8~\x8Ha#x<8~xx8HI#x<8~x8%H1#x<8~x8H#x<8~x8H#x<8~x84H#x<8,x84H#x<8`x8@H#x<8x8H#x<8x8;H#x<8x8?Hq#x<88x8.HY#x<8hx8.HA#x<8x8:H)#x<8x8@H#x<8x8KH,A#x<8`x8*H#x<8x8"H#x<8x8@H#x<8x8KH#x<8x8Hu#x<8x8 H]=?9)f;@}#KxHa=?ȅ=<`| |J|.p})p| P<8c,88HH#xxx8PH,@X=?9)f(}#KxHT<=|J<8c,88HaHE#xxx8PH#x<8x8Hu#x<8sx8H]#x<8(x8HE<cT8c,xH?T( ?H;\;||e||xH18}xHu |e||xH8} xH"a |e||xH8}xH 8}xK<cPxKE<cP8cxHy?P  |e||xH 8}8xH 8} xH #x<8sx8H8=?)А 8!|!N |!B|#x|3x= a)|H@`=? XhA@=? |`A0hA$`A! hA `@$<`<8cqL8HđH=?)Ѐ ,Ap;88<<8 <8 t<8 X<8 0|3x9! 9APHi ,@<8cqlx88H8aP8H|yx|a=?;q;P;`:xAȓa8co88<8 QHe;88<~x<8 <8 t<8 X<8 0|3x9! 9APH ,@<8cqx8:H8aP8H9|yx|a=?:q:aPaВ:@1x!ؒA8co88<8 QH;88:n,9=?!8VK:}+ rl(h*Đ0!}kJ rl(h*4}sx880H8a@}sx88H8a@8HA|~x|q~x:@:x8c88<84 QH}<;}{x884Hu8a@}{x88H8a@8H|~x|q~x;A@A a$; x(!,8c8 8(<84 QH9|;,F@!8ix~$xHy5;:R7@@;x8H8a@x88H8a@8H|~x;`|}8c8@ QxH|}8c<8n0 Q8H<cxx8Hx8!|N |!B}Cx}+Kx = a)|H@4,A<`H,@$<`ِ <8ck8HIHx=?I`=?) 94Ah8A@=?8U:}K}+" k: <}k* k: (-H.(M94@#U):8@}) @#U):}) C9`5JA|x88U`:} :Li<@ hA( `(X(h$ b H0U`:} :  A LHUi:}):9k5J@=?  * $8=?) |@|x=?  *(,4A8| x| QA=?I8B$ 9H=8aP8H¥|yx;p|}=?: Zl9P9-x8c88<8 QH;|}8c<8Z Q8H<cxx8H=?r$=?:ѡ$!=?x$:ѡ$88<8a$<8<8<8<8X|3x9! 9APH ,@<8cZx8>H; 8aP8Hi||x|xx!;=?:[4:Px88<88H<cxx8H_8!|N |!B|#x= a)|H@(=? 4 L@@$<`<8cV8 HH;`=?) l<C0=?ɩh(r=?h$x88H8a@x88H;`8a@8H||x|zxAa;=?;)W ;@ȓ!x88<8`8Hy<cxx8H^8!|N |!0B|ex|#x= a)|H@ #9)( @$<`<8cU8HMH;`x8H8a@x88H;`8a@8H||x|zxAa;=?;)U;@!x88<88Hq<c@xx8H]y8!|N |!!B}"Kx}YSxaAa = a)|H@,A 8Hl,A 8HXE, @'| A | H@ 8H,F, @(| A | H@ 8 +<`| A 8 N <8cT8!HHH9J}Jaցe}k}kR'})})Rk}kt |t}d[x| A؁F9J}Jaցe}k}kR'})})Rk}kt |t}d[x| Af9k}kaցE}J}jZ(9)})a}JJ+})t |t}$Kx| ATf9k}kaցG}J}jZ(9)})a}JJ+})t |t}$Kx| A8Hf8}`aցE}*})Z |t| @'})})Z |t| @t|kx8`9J| @ E9k| A$8 |a}*}) |t| A8`,@8 &|H@} Kxh8}`aցE}*})Z |t| @'})})Z |t| @t|kx8`9J| @ E9k| A$8 |a}*}) |t| A8`,@8 (|H@} Kx&9)})aցE}j}+J |t| @(9)})a}+J |t| @t}8`9k| @ 9J}| A$8 |a}*}) |t| A8`,@9*| @| x;&9)})aցG}j}+J |t| @(9)})a}+J |t| @t}8`9k| @@ 9J}| A$8 |a}*}) |t| A8`,@9*| @| x:h8!`|!N |Ha!|wx|#x|+x|3x!p}QSxx|= a)|HA<8cOH$,A$<`ѐ<8cO8HH=?)0 ,@ ~xH7}=?), ,Ah<c$<8P~x8HWm;;`;=?)=??_;Z-;@;> } }.i   }>9):<8c-H<8c88H~y<8c88H~e<8c88H~QH5;,I@s$x~x8HVq;;{7@(,@<c$8@~x8HVA<c$<8P~x8*HV%=?9)-;@}#KxH)<8c}kx8H}H<c$x~x8PHU=?), ,AT=?9)-Г}#KxHр <8c88H}QH5<c$x~x8PHUy=?)(9)r=`C0=_Ɋ뀀la`(h* rl`(h*rl`(h* rl`(h*=?9)-;@}#KxHQ<8c88H{<8c88H{<8c88H{<8c88H{<8c}kx8H{<8c~x8H{yH]<c$x~x8PHS;7Ap!p7AP=?),;9?_;Z.:A@:`97|I~z~q=?=_Ê=?é=?=??;{.>?,A8}29):z<8c.H |<8c88Hx}>z}) |t } }.i r : }29);{<8c.H<8c88HzH;,N@q$8@~x8HR=;;7@:7@,@<c$8@~x8HR8!@Hh|H|!`|qx|#x|+x|3x|;xAԂA؁a~x! = a)|H@0,A<`с! H=?) ,@ aH19=?)܀ ,Ap<c<8I8HQ);:;=?X=?p?;';=_A } j}.i   9a@}+9)<<8c'H<8c<88Hx1<8c<88Hx<8c<88Hx H;,I@ !Ԁi8@8HP%;:7@ ,@<c8@8HO<c<8I8*HOف!܁i;=?)t ;/:~:| @;|@:=?9)';@}#KxH!܀ |֐<8c<88Hw H<cx8PHO5=?)܀ ,A\=?9)(}#KxH)!܀ |<8c<88HvH<cx8PHN=?)9)r=`C0=_Ɋ0la`(h* rl`(h*rl`(h* rl`(h*=?9)((;@}#KxH<8c<88Hu-<8c<88Hu<8c<88Hu<8c<88Ht!܀ |֐<8c<88Ht̀|֐<8c<88HtH<cx8PHL! (=? @ =_ވ=?)Xi }XP9m<C0=ɫ0h(`$ ,@;؂~փ6Ax!܀  ցAԃ79At}ޱ=0=?!܁X9 =_Êd=ëބ=?I:R=?il=?I\=?)p>:(@=_A8=d8`4A95^Ap/}<9)}i||Z|A(9`,@}$B ,A9`}f[x}=B}):U):}) *95J@8c4@,A! Hm=@C0A($-a (LA@*H(|JЁA܁*X9) i|X@aЁ)|H@!Ѐ,@D =kX} Z}.i  z r;A@}:9)48<8c(@H<8c<88HqH;,N@ !iDx8HI;z79@6A_:R(X=?!=_d88`4A95^Ap/}<9)}i||Z|A(9`,@}$B ,A9`}f[x}=B}):U):}) *95J@8c4@,A aH>_txd>2xh=D=}Cxq|xxx`":x\PåT)+xؑx@ATxAdAPfT+:hHPaTd)|@P6 !PT|f@P|(P||tA:,A:????^xЁYx8x89~ɳx~xz: :88vaHH (<.y,,A/@P=lx+, A 988@plAhHp8:`: pal!hHT,@L=_x/A ;;;@plAhH888plh\nǀ`n>??C0ApnAlm=\d8(X`aXɁ`A\adtɡ`AX+((ٴb(!X({atH} j9`e $$@ ?<=Cxhx`e0P;[oDdȁ`d(,@*@$A=?y( /@:|@ >}h=ȳؔ> C0t:`n!`Ad8!`|0((*2PT|hP8@`h=p?at}!l?T?_~??=_|`Y||B} tXؔ`ؐx|y,>C0[x8|x4~x0}Sl`Adˡ`@(P*@hAPT}$9i|CZ}// AAt"HLTK:|.d8(r-P*PXTl} | X@ }i[xH|@|Ix]/A |ZHF|H}|HgH*8|}|9JB(:~s|AXH>? 8ȱټ(A0OYӂ@=8naHH H畀powE; PHyd`a`|+((H0$@X<?`C0ˣt;Poa`Ad>!`;a(3ؤz@H|;A:@C0d8`|ȡ`@(@ 8*2PThP8@At>?Ah=!l|`րp|T~ix|>?;P?=_<_=?(t2Uؔ|:8x|`ؐy,>`C0|x8bx4}  x0la`Adˁ`H(`P*hPT}D9*|CJ}o,Aat+HApTI:}.ê OYӂ@|H"HtAl L@@ 1HX9:9`,@@}I|KJ|@p|T:|BT. OYӂ@ | xH| x|KHP,ÁQ}+R|,A }UH]|H|XHFH(8||9A:}|AH>y(,@:@?<{y,?_}q[x|h}OSx>`C0tȺؔ:na`d8`| 0(`(*H2`PaPThP8@8at?_Ah?l|`Yրp T|t?<_=?}}U]ؔ`ؐ[x8|?C0bx4}ux0~l`Adˡ`@( P*a؁PT|D9"|CJTI:|I.8(rP*hPAT}"2|`@ }cxH 0@|3x],A |ZHG|H |\HHH+8|}J}9kBH:~|AH8>? 81ټHA0LA@\??8ybHlAp>8pb@ء (@`فHٝ8HHqapouS; HUd`ɡ`|M(h(P0$@X=?`C0˯t;Poa`d=!`;!(,ؤH:@HМ;A:|@=C0<<}tؔ: nd8`|A`j8(X0*2PT}hP8@At>h=l|`Qփp|p|aT}x=><_=?==_2|:(t|bOؔux`ؐ=C0| 9Py,ix8}x4 x0l`Ad`>H(P*@hAPT}d9K}#RU+:}. @OYӂ@}i+Ht!l L@@ ;HX9:9`,@@}{x|KJ|@p|T:T. OYӂ@ | xH| x|KHP,Á[}+R|,A }SHG|H|XH]H(8||9A:~1|AA>?=Qxx<}sxx89p!xA|8?:1H=_Ê=?=? i=?i=?I=_*>:`=?!=_84Ap9@5~AX}<*9)} <`| A<8c(<8 HtH ,@,A 8Hx ,@,A 8HX,@4|HA | @ 8H,,@2|HA | @ 8= a)|HA(<8c(\8Hs]>=)9)Б>H Tl(=? h @ =? =ka+ } HP9)m)!D<C0@@=ɫh(`$=kaŋ :ѡ` :ѡd :ѡh :ѡl :ѡ|! :ѡ! :ѡ! :ѡAdal*X(R`(.h(nZ`(gh(o (=?h@$(h@;@hH`l(<h@;@`|H8(=?h@;@hH;@|`h`&W{8a`8d8h8l8p9t9!xxHUp,A 4tj=? L@@8tHHtj=?  LA@,=? $t`hh*<rx8ah8l8|88p99!xHTep,A j=? L@@8HHj=?  LA@,=? $|hh*<r8a88|88p99!xHSɀp,A j=? L@@8HHj=?  LA@,=? $|h*<r8a`8d888p99!xHS-p,A `j=? L@@8HHj=?  LA@,=? $`h*<r=? *HL=?)a |@|x=? *PT,@8|xQA?C0=<Ƽ,~&:;.--/@&WZ=?ia;{$o D@@((~ @0aXL@@@<&nD@(dh(2h(h$8a8HDnD@ɡ@(haX(2X(,$h8a88Hal XL@@4oD@@(dh(2h(@h$H| A |H@ 8H,f,@(| A |H@ 8 +<`| A 8 N <8c8H]1H\(|x|HQAH>|x}`HQA(8|9}(R})2  95k@8c4@X8!P|N |!B|+x|;x}"Kxa= a)|HA<8c8H\eHL,@ ,A 8H,@ ,A 8H`=| A | A| @ 8H0(| A | A| @ 8= a)|HA$<8c8H[>9)N >Hx(|x|HQAd=| x}HQAD8|9|)}j2Uk:}kb}*U):}) h* 9J5@8c4@X8!P|N |!B|3x}Cx}|HA| A | @ 8H0<|HA| A | @ 8 +<`| A 8 N <8c8HYHp<| x|`HQA\>| x|HQA<8 |A|1}j"Uk:}k}*U):})* 9J4@94c@X8!P|N |!B|+x|3x|;x}Cx}"Kxa = a)|H@,@ ,A 8H,@,A 8H`>| A | A| @ 8H0&| A| A| @ 8 +<`| A 8 N <8c8HXIHx&|x|HQAd>| x}HQAD8|9|)}j2Uk:}kb}*U):}) r 9J5@8c4@X8!P|N |!B|+x|;x}"Kxa= a)|HA<8c8HWaHL,@ ,A 8H,@ ,A 8H`=| A | A| @ 8H0(| A | A| @ 8= a)|HA$<8c8HV>9)N >Hx(|x|HQAd=| x}HQAD8|9|)}j2Uk:}kb}*U):}) h( 9J5@8c4@X8!P|N |ܐ!B|+x|;x}=Kx}^SxaAcyxx = a)|H@,@ ,A 8H,@ ,A 8H`8| A | A| @ 8H0(| A | A| @ 8 ,<`| A 8 N <8cX8HTH(| x|@HQA8|x|HQAx8 }|`||}hbUk:}k:}(U):})*2}("U):})i}(U):}) 2rы94@9J4B@px8!p|N |А!B|+x|;x}:Kx}[SxaA#6x x= a)|HA<8c 8HSH,@ ,A 8H,@ ,A 8H`'| A | A| @ 8H0(| A | A| @ 8= a)|HA$<8c 8HR݁>9)N >H(|x|HQA5|x|`HQA8|}=?)8}@|@=? X|:T:||bT:|DfX* H@L}hRUk:}k}(U):}) `$ѫr`$H@}hRUk:}k}(U):}) h*2 }(bU):}))94c@H;4@x8!p|N |!B= a)|HA<8c 48HQiH$, @8h(=`k<`| A 8 N <8c48#HGHT8`8a`8hxH$T8d8ad8lxH$Ƀ<`|@8t8pl8<@cx~x%xx~dzx9p9!tAhH:|@D@2`28} p||T:}`|.2  28`4Ah|p|9@4ADTi:9)}i9UI8})})Z 2zѩ 9J4@8c4@]}|p||T:}.} )8<cx~x%xx8p9t!hAlH^8ahxH! 8alxH ,A$|p||p8`4At}c|p}9@5AL8 |8|}j"}k:Uk:}k}*U):}) ѩ9J5@8c4@|p|8`4Ax}c| p})9)}*Kx} QAL8 |8|}dPP}k*Uk:}k}*U):}) ѩ9J5@8c4@8!|N |A!B|+x}Cx},KxAaJ = a)|H@,@ ,A 8H,@,A 8H;|HA| @ 8Ht,|HA| @ 8HP&| P=|J*|H@ 8 H( '| P%|J:|H@ 8 +<`| A 8 N <8c8HCiH,8`}HQA;8|HQA`%}#J9)})ց]}DR}JJUJ:}Jg}cZ9k}kAց&}$J})ZU):}) 84@8c5@h8!`|AN |!B|;x},Kxa = a)|H@,A 8Hl,A 8HXE,@>| A |H@ 8H,f,@(| A |H@ 8 +<`| A 8 N <8c8HAHh(|x|HQAT>|x}`HQA48|9}(U):})R r 95k@84@X8!P|N |a̐!PB||x|#x|+x|3x|;x}Cx}6Kx}TSx胡a= a)|H@,@,A 8H,@,A 8H(| A| A| @ 8HX6| A| A| @ 8H( ,A 8H,A 8><`| A 8 N <8c8H@ H|T:`8a`8dxH98H`= C0=ɋllD!@@`(=h(rHL|p|lD@`(h(rHaL|p:|x}HQA`9@T:})*IV5|A8}#Kx9"})}$JU):})h*8B5k@85@x5|x~HQAP:@}3P9)| A9|5|HA9:|x|`HQA}3P99)}Iր| A(T:}k*}$RU):}) h( }"| A0T:}k*9)})}$JU):}) h* 84c@9"})ր})U):}):I|3yA@8|ց>} JU):}):T:}k* h* 84c@Ё>}P85A8}@|RT:}`:ѫ|} P9#| ATi:})* ( }$2| A(}dRUk:}k:U):})* h* 85@,Al4}Al8}=@C0=?ɉl}dbUk:}k:|P|">| P|AlDA@@`($ѫ84c@}fP||x}`XQA\8|`=C0=?ɉl}$U):}):|lD@@`($ѩ85k@}&P9)}$Kx|iQAl8}=@C0=ɋl}dbUk:}k::}) P})2| P|AlDA@@`($ѫ84c@8B6@8!|!N |!B|;x},Kxa = a)|H@,A 8Hl,A 8HXE,@>| A |H@ 8H,f,@(| A |H@ 8 +<`| A 8 N <8c8H8Hh(|x|HQAT>|x}`HQA48|9}(U):})R h* 95k@84@X8!P|N |a!B|+x|;x}'KxaA= a)|H@,@ ,A 8H,@ ,A 8H`<| A | A| @ 8H0(| A | A| @ 8"<`| @Ѐ(|x|HQA<| x}HQA8|=?P|=?iX9}*2U):}): `@}*U):})*iH,}jUk:}k*}*2U):}): h$ 9J5@8c4@`"<`| A8 N <8c8H6Ih8!`|aN |!B|3x}Cx}(Kxa = a)|H@,A 8Hl,A 8HX^,@&| A |H@ 8H,,@(| A |H@ 8 +<`| A 8 N <8c8H5IHl,A&|@HP8B|Bp|B(|x|`HQA484Ad8|aց~}eZ}kUk:}kR&}%HP})U):})R &}%HP})U):})Rѩ84@84cAK'|IP8B|Cp|c84cA&|x|HQAtg}dZ9k}ka}eZUk:}kR(}$HP9)})a}%JU):})R (}$HP9)})a}%JU):})Rѩ84@84c@tX8!P|N |!B|;x}'Kxa = a)|H@,A 8Hl,A 8HXF,@(| A |H@ 8H,},@'| A |H@ 8 +<`| A 8 N <8c8H2H=? | =? |h '|x|HQAp}P|3x} CyAL8|}'U):})* h(cn h(k. 85k@8c4@X8!P|N |A!pB|+x|;x}5Kx}VSx = a)|H@T,A 8Hl,A 8HXe, @'| A | H@ 8H,f, @(| A | H@ 86<`| @(|x@HQA2|xHQAp8`=?|`>;|T:>@ !@a@DH) >H}=U):});7@;97Z@x6<`| A8 N <8c 8H08!|AN |!B|+x|;x}"Kxa = a)|H@,A 8H,A 8Hx=| A| @ 8HT(| A| @ 8H0,A( ,Ah@ 8 +<`| A 8 N <8c8H/YH(|x|HQA=|x}`HQAp8|ր,A$}(2U):})b h(k. ,A$}(2U):})b h(cn 95k@8c4@xX8!P|N |!PB|+x|3x|;x}Cx}.Kx耡a #|  = a)|H@0,@(,@,@,A 8H؀,@,A 8H/| A| A| At.| A| A| @ 8H` ,A 8HL,A 8H8 '|Iց%| @ 8H'|H@ 8% +<`| A 8 N <8c8 H,H = C0=ɋ|lD!@@`(=uh(rHL |p~lD@`(h(rHL||p|P.|x~`HQA;}(iP|@|xaP~Z|@|x};P84WA}:Kx8`@yA8Tk:}kb};9)})}<`| A 8 N <8c8H%H0=?Ivt!aAH| !=? nX@=? n*j=? o@ L@@XA8!<@DHLPTaX!\`cx~ijx}{x}kx}sx! ~JxHtH!=?Iv|!aAH{  =? o0@l(88=? m@=? k*H=?kh@ h((! (! <!(h(2!zHx8!(h(2!zHxm (=? kX2!8!HR8|HQὡ!|+x|3x|;x}Cx}1Kx}PSxhlp!xaA!= a)|H@,@! ,A 8H,@a ,A 8H,@(|HA| @ 8HX,@1|HA| @ 8H,,A 8H!| ,A 84<`| A 8 N <8cݴ8H H؀?C0=?plTPP(=iX(XlTP((\88<~x}{x}sx}kxt9X9!\9AHw 2|HP,@m TPP((`lTP((d88<~x}{x}sx}kxt9`9!d9AHv(>| PlTPP($ѡ(>| PlTP($ѡH8<| P,@?C0=?plTPP(=iXh(dlTP(h(`88<~x}{x}sx}kxt9d9!`9AHum(<| PlTPP($ѡ(P($ѡH8?C0=?plTPP($lTP($a| lTP(m$ lTP($>9)m)!TɡP(hTKxaC = a)|H@,A 8Hl,A 8HX, @(| A | H@ 8H,g,@>| A |H@ 8 +<`| A 8 N <8cΠ8HQH|=? Z >|x|HQA\}P|3x} CyA88|}'U):})* h(k. 85k@8c4@X8!P|N |aĐ!pB|+x|;x};Kx}YSxȁâ = a)|H@,A 8Hl,A 8HXE, @'| A | H@ 8H,F, @(| A | H@ 8 +<`| A 8 N <8c@8HH8=? X Ad=? Y @h(|x}@HQA@3|x}`HQA08|}>U):}) 2 ;5k@;Z5JAK=?Xh@(|xHQAȀ3|xHQAd8`=?W:|T:=LA@Hd =H}>U):});7@;Z7AHK=?Wh@d(|x}HQA3|x}`HQA,8|=@?}>U):})I;5k@;Z5AK=?Xh@(|x}HQA3|x}`HQAl8}@=?W=?iX=?Y8|RT:}  hA $ H}>RU):})щ;5k@;Z5A Kx=?Wh@(|x~HQA3|xHQAP8W:=[!@a@DA@@DHcm =;7@;Z6AK(|x~HQAp3|xHQAP8W:=[!@a@DA@@DHb =;7@;Z6@8!|aN |aĐ!PB||x|#x|+x|3x|;x}Cx}6Kx}YSx胡#U)::><`| A<8c8H H܀,A 8H,A 8H|%, @| @ 8H\', A(| A&, @| @ 8H$lD<C0@@=?ɩZh( !`a`dHaU<`@8=?)Z$Ha= $=? SPLA@ =? Sp*HLH=? Sp(PT| x9`9@,AL,@$8}@[, @4q @,}JH$9@q A}JY})qA }kYK| A 8lD<C0@@=?ɩZh( !`a`dH`A<`@8=?)Z$H`) $=? SPLA@ =? Sp*PTH=? Sp(HL9`9@| yAL, @$8}@[, @4q @,}JH$9@q A}JY})qA }kYK| A 8><`| A 8 N <8c8HHh,@8T<XT<\8aX8\<8T&xxHxxex~x~gx(xxxH`== a)|H@:, @|}5p~,@| A\|KT<8U(<}p}85AlT:}KT:} |.| .  |*85A`C0=?ɉT84A9})P})ր})})"9)~9@5kAh8||T:}8 |ց=})0P})ր})})R9)}):U):})h*9J5k@84@d,A@}fUk:}k:|IlTaPP`($ѫ85@8c4B@̀8!|!N |!B|+x|3x|;x} Cx}C0=?QH=?LT}=U):})zi8l8(!\`( czo8(`(cz0(H!8`!9}%`P9 9@}+KyAKx}\Sx!aĂAȂ́ЁԂa؀= a)|H@,@,A 8H,@,A 8H,@ a+|HA| @ 8HT,@>|HA| @ 8H(,@ 8H,@ 83<`| A 8 N <8ch8HHȀ?C0=?Kdltpp(=D(xltp((|a8x~ijx~%x8x9|9!9AHda+|HP,@m tpp((ltp((a8x~ijx~%x899!9AHc(! 9| Pltpp($ѡ(a | Pltp($ѡH8:| P,@?C0=?Kdltpp(=Dh(ltp(h(a8x~ijx~%x899!9AHb(:| Pltpp($ѡ(| Pltp($ѡH8a8~x}{x~x~Fx~x}sx=?9)D}kxK,A,@8Ā>|x~ HQA=?Kd|Plt=`C0app(!jzp(Aja h*h*ѡH* P*kH*aP*сa+|x`HQA$8!| T:aZ::W:}88<@ADHLPTXa\8a888899)=_9JDH=8<@ADHLPTXa\8a888899==_9JDH=ѡaX*`*ѡѡX*`*ѡ;7{@;61AK0?C0=?Kdltpp($ltp($ltp(m$ltp($99)m)!tɡp(hT|x|`HQAla+|x|HQAH8!~In`<C0=ɫKdh(}>U):}) $84A[85JA=C0=?)KdlH(2=D|PlɡH(h:|PltppH(k:lakH(`X z@8*|PlɡH(h:|PlH(k:kk@* 0LA@P!9iHPa 0LA@X!9)HX!| AH| A<| A0| A$9)})}+JU):})j * 85J@t84@$;4@;4c@8!pH#X|!`B|+x|3x|;x}Cx}5Kx܂!ajH = a)|H@,@,@ ,A 8H,@ ,@!؀ ,A 8H:| A| A| @ 8HX5| A| A| @ 8H(,A 8H,A 8 +<`| A 8 N <8c88 HH5|x}HQA:|xHQA8}=?:L}#jU):})V84BAL>C0=?)A=? :l}=2lD@@H(@(2HL} HP9G85JA=C0=?iA=?I:l8||T:8 `8}#"lD@@X(P(HL} HP9)| AT| AH| A<| A0}iUk:}k}$U):})z k:85J@`84B@8c7@;5@`8!|N |Ha!`|;x}<`| A 8 N <8c<8 HHl,@09`4A =@?Ui:})I9k4@=? 58|=? 59`4A@Ui:})| `(k.| `(cn9k4@=? 58L=? 5P9`4A@Ui:})L `(k.LP `(cnP9k4@Ȁl<C0!=? :!( H@ =? 4LA@ =? 40*H=? 40(X| x9)!X, @ 8 XX\`2Tl<C0=?ɩ:h(T2ѡT9Hj9k|R8U@<l=}(JU):|Jl|BlT<}JQ}k:9k}jY|Zl|:l| x9)!lAp9'| I֐p|:p9}Aր}t`T:8a84xHq`T: 8a 88xHUa`Ui:9)9k})Y֑!8a8<xH-tT:8a8@xHlT:8a8DxHlT:8a8HxHف><`| @,8L88P<=?9)4P!@!D8TH8XL8\P8`T=?9)5!X;!d!\4`:hd8h<l@pDt8lxH|8p@8t8x<8c4xxfx~x~ȳx9!|9AH8a4xH‰8a8xH}8a@xHq8aDxHe8aHxHYx,AT:T:T: 8a 8xHmT:$8a$8xHQT:(8a(8xH5T:,8a,8xHad9k!h9)}kI֑a0<8A<0@D4HaLAPTX8\8`Ddhlptx<8c3$x%x4~x~x!89A0H#8a<xH 8axH8axH8axH8axH8H88a<xHx,@,<8c\x8EH<8cx8H@=?9);}#KxHU<8c38x8HHxx8PHŀ8!|N |H |!|qx|+x|3x|;x}Cx};Kx}SSxA8a<@DHPTAX = a)|H@Ā ,@,A 8H,A 8Hp ,@ L$ | A |H@ 8H@f, @%| A | H@ 8H(@ 8 *<`| A 8 N <8c8HHD%|x HQA0<D38=?),o@D=`C0a@@(( L$|xHQA?C0=?38=,<Ä,l8y=?i/=?oD@@((0!(!2(r2!zH9e !$,@tLA@*H!LH(P!T9), @| A, A}>U):}) h* HЀ,@*P!T9)*m D@@(-(, @H| A<}~Uk:}kU):})``( : h:H@, A}~Uk:}kH}~Uk:}k7U):}) h* ;7@\;Z79@8!|H|!B|#x|;x}'KxAa = a)|H@,@ ,A 8H,@,A 8H,@(|HA| @ 8HT,@'|HA| @ 8H(*|HA<|H@ 8& +<`| A 8 N <8c8H}H! ! ! ! '|x|`HQA`(| x|HQA@8|9j}ka}dZUk:}k}*U):})* 9J4@84c@X8!P|N |!B|nx|#x|+x}Cx}4KxAaAĂ!aAh= a)|H@,A 8H,A 8H́{, @:| A| HAw, @6| A| HA,A 8Hp,A :|HA,6H<:} HP9)|H@ 8H$6} HP9)|H@ 8><`| A 8 N <8c8H!H 8u9@5kA0UI:}) ,@!9)!9J5k@8,At6|x|HQA|P|#x|+yA88}}*})B ,@!9)!9J5k@84A@K;| P| x9)!6} HP9)|I֐,@ 8Hp!|H@ 8HX!|IT:8a8xHT:8a8xHT:8a8xHT:8a8xHŀT:8a8xHT:8a8xHT:8a8xHqT:8a8xHUT:8a8xH9T:8a8xHT:8a8 xH><`| A8H8<`| A 8 N <8c8H H|Ui:9)9k})Y֑!8a8xH)<U):9)!8a8xH T:8a8xHT:8a8xHрT:8a8xH<U):9)!8a8xH<U):9)!8a8xHu><`| @<9)!88<9)!8<@D<9)!8H@LDPHTX\`dhlĐptx~x%xfxx~ȳx~x~xH<9)!<9)!<9)!<9)!<9)!?;蓡8<@LDH8a8x899!JxK<9)!<9)!<9)!8<@PDH8a<8耡8|#x9|#x|#xK8axHa8axHU8axHI8axH=8axH18axH%8axH8!|N |ۡĐ!`B|#x|+x|3x|;x}Cx}YSx؀= a)|HA<8c8HԩH@,A 8HD%| A| @ 8H =? $ L@@ 8= a)|HA$<8c8H)>9)N >H<`@8=?)"H*a<|xHQA?`C0=?"=?éDW:oDa@@((h(h$P !PaPTH*Q !z=;7@8!|ˡN |Đ!`B|3x|;x}Cx}(Kx}WSx؃a܀= a)|HA<8c88HH,A 8Hx%| A| @ 8HT=? d L@A=? d L@@ 8H (@, A 8= a)|HA$<8c88H5;9)N ;Hk<@aDk:@!D9)|H@}>Kx|X@}`[x|xQA?@C0=?!0=?oLAHH((h(W:h$P8aP~xexHb !z=;7@8!|N |!B},Kx}BSx= a)|HA<8c@8 HH,A 8H\%| A| @ 8H8=? L 8L@A (@, A 8= a)|HA$<8c@8 HI>9)N >H ,Ax=?)cX, @t8`9`=_-9JI?C0=?i=?Ti:})R8lD@@X(2h:$ѩ8c5k@=?8 cX ,@%|x}`HQAd9)N >H%|xHQA?`C0=?=?éP=?W:oDa@!@!( !(!(!*!!$H! !z=;7@8!|ˡN |HY!0|#x|+x|3x|;x}Cx}=Kx! = a)|HA<8c8H%H,A 8HL%| A| @ 8H(=?hAh@ 8= a)|HA$<8c8Hʝ<9)N <H|=?  @08dxEx~xxx=?9)*xK-H<=?  @8!8<dxEx~xxx=?9)(=_9JKH=?)H 1 !2=? $$X<8c8X8`8hxH`$:|xHQA?`C0=?x=?ÉoTaPP((h(rp8ap8X8`8hxH!W:})`h: ;7@8!кH<|Ԑ!B|ux|#x|+x|;x}Cx}<`| A 8 N <8c8"HH,@=? L2,A894ATU :}) * 94A4K94A U :})ѩ94AKh(94A=?P=? `=?LU :})h(`((M0$ 8(@Q @(@B=?i,X*P*99) }+Kx|A,XUi:}) m*`9k4@܀,AU :})j(HU :})iz 94@8x8!p|N |А!B|#x|+x|;x= a)|HA<8c8HH;7`A??;9|+x|3xx|QA0~xUi:})R h@ }z[x9k4@|A<`| A 8 N < 8cz8HH/ yK`( [.( @.b(wK`(*[.(-H.b(.=? $LA@@`ad;{H@`ad= $ LA@H`Ad;ZHH`Ad=? $LA@$=? (`Ad:RH8`Ad= $ LA@$=?  (`d9H``d|A- |A-|A-|A-|@|x@09/})}2JU):a})Za H|xP,@po@l<C0hh=?ɩh(t59 8@9 8@9)8@9), @8@ 𐓡AH 8@( A𐓡ؐ!H$ ؐ!A𐓡(( 2(h$*(2($z`*8(= D2 X(2(H, @8@ 𐓡AH 8@( A𐓡ؐ!H$ ؐ!A𐓡(( 2(h$*(2($z`*8(=? D2 X(2(H4<8cLHH<8cLHH<8cLHHӁӡ |A9:})};JU):a})ZaH|xP,@*o@l<C0hh=?ɩh(t59 8@9 8@9)8@9), @8@ 𐓡AH 8@( A𐓡ؐ!H$ ؐ!A𐓡(( 2(h$*(2($z`*8(= D2 X(2(H, @8@ 𐓡AH 8@( A𐓡ؐ!H$ ؐ!A𐓡(( 2(h$*(2($z`*8(=? D2 X(2(H4<8cLHݝHۙ<8cLHݍHۉ<8cLH}HyӁӡ8ll<C0hh=?ɩh(9 8@9 8@9)8@9), @8@ 𐓡AH 8@( A𐓡ؐ!H$ ؐ!A𐓡(( 2(h$*(2($z`*8(= D2 X(2(H, @8@ 𐓡AH 8@( A𐓡ؐ!H$ ؐ!A𐓡(( 2(h$*(2($z`*8(=? D2 X(2(H4<8cMH}Hy<8cM$HmHi<8cM8H]HYӁӡ`( |A09:})};JU):a})Za h: 9: | A<| A0}:};JU):a})Zak: |A%9/})};JU):a})ZaH|P,@|x@|o`l<C0hh=?ɩh(9 8@9 8@9)8@9), @8@ WH 8@ VµH5T¹(( 2(h$*(2($z`*8(= D2 X(2(H, @8@ WH 8@ VµH5T¹(( 2(h$*(2($z`*8(=? D2 X(2(H4<8cMLH؝H֙<8cM`H؍H։<8cMtH}HyӁӡ|A09:})};JU):a})Zak: |A#T9:})}2JU):a})ZaHt|xP,@p= C0=ɫo`l!hhh(`o@lhh(@;@;@;@;,@@ WH @ VµH5T¹(( 2(h$:*(2($`*(=? D2(2`(H,@@ WH @ VµH5T¹(( 2(h$:*(2($`*y(= Ds2(s2`(H$<8cMHH<8cMHH( n LA@d,@LAA,@,L@@ 8ҁА!ЃЃ`ҡЃ!9 @9 8@9)8@9), @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(=? D2 X(2(H, @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(= D2 X(2(H$<8cMHӱHѭ<8cMHӡHѝӁH 8aА!ЃЃ`ҡЃ!9 @9 8@9)8@9), @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(=? D2 X(2(H, @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(= D2 X(2(H$<8cMHѕHϑ<8cMHхHρӁH L@@|,@L@A,@8LA@,8ҁА!ЃЃ`ҡЃ!9 @9 8@9)8@9), @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(=? D2 X(2(H, @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(= D2 X(2(H$<8cNHEHA<8cNH5H1ӡ(H x8aА!ЃЃ`ҡЃ!9 @9 8@9)8@9), @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(=? D2 X(2(H, @8@𐓡AH 8@(A𐓡 ؐ!H$ؐ!A 𐓡a@(P( 2@(h$* P(2 @($j`*8(= D2 X(2(H$<8cN(HH<8cN})|JT:|. ;5J@Ё4} HP9)!T4} HP9)!P7U):})9)!89=}1IU):})T:})9)!9)N >H =?é@A A x!=h h(cn!(!(?>Hځ !@L @!ЀaЀAЀЀHڹ !@ =? *H 8=? h=? μ2r*m(``(@`*=? @L@@LAA$=? L@@LA@*=? L@@LAA$=? PL@@LA@*=? L@@LAA$=? TL@@LA@(=? ЀL@@LAA$=? XL@@LA@( ؐ=?I\!ЀaЀAЀЀH1`=? @@=? {* А=?I\!ЀaЀAЀЀH@=? @@=? Z*ؐ Hö: HA z3:zА Hױ: H Uz:sz=? L@@4h(nh(nh(n.HD=? L@@Dh(nh(nh(nnh(mH=? ЀL@@4h(nh(nh(nnH0h(nh(nh(n.h(m=? L@@4 h(cn h([nh(m.HD=? L@@Dh(n h([n h(k. h(jH=? ЀL@@4h(n h(Sn h(k.H0 h(cn h(Snh(m. h(jCxdx~x88xK-x$x~ex88xK-mCxdx~x88xK-Qx$x~ex88xK-5p!t9)|H@!p!t9)|H@!p!t9)|H@!p!t9)|H@!=?\rh(h( **ѡCxdx~x88xK,=x$x~ex88xK,!Cxdx~x88xK,x$x~ex88xK+pt;pt;p!t!pt;| A!|HA!|HA!|HAa}|XQ@ |xQA\88<8@DHALP8TX!!\`Cxx~x~fx89Hl|@|9=|H@} Kxx88<8@DHALP8TX\`Cxx~x~fx899!9AxH|@x|@| x!x9<|H@} Kx|}{x|@| x!88<8@DHALP8TX\`Cxx~x~fx89x9!|9AHM!|H@9)|H@} Kxx!|H@} Kx|}{x|@| x!x88<8@DHALP8TXaa\`Cxx~x~fx89|9!9AxH|x@|9/|H@} Kx88<8@DHALP8TX\`Cxx~x~fx899!9AH8!LH |Hսd!|+x48}Cx!@}XSx!LPTa\A`dhlcaX=?), @;;?-;{?@C0= =?éT=`W:8lDA@@($P !`a`dH =;7@=?8 8|x@HQAWi:4})X(!8 a@+|xHQAl=È@=?i=?I=?)è8!X I=T=`=C0=?-;=?dW:})(?=zHΕ@0 @!`a`dA``dH H =(@!(@ !(H@!*h($$2-z2L@@T,@t}>U):})z9)}*Kx=-9kLA@*HLH(PTT:H}.k: H؀,@`PaTm`D= C0!@@`dɡ`h((}>U):})zUk:}K`(}k. 2bH :ѩHL, @@W:z!2 P!`a`dHU H!z=;7@;{7Z@X8!dHl|!B|hx|+x= a)|HA< 8c78Hv 8`H$8( A9@ 8`|#yAL, @$8|`S, @4q`@,|cH$8`q`A|cQ}kqA }JQKp|xP<ff`fg||pp| P PH< 8c78HuU8N1xX8!P|N |H !}0KxA$,048<@LaPTaXX\ = a)|H@̀,@D,A 8H,A 8Ht!I, @ '| A | H@ 8H@F, @(| A | H@ 8H(@ 8 +<`| A 8 N < 8c68HsHDlD<C0@@=?ɩ0h(= (9@4A(8UI:}i})9J4@,A4D9@4A 9`UI:})i9J4@(|x@HQAWi:$})B! a+|xHQAH8\9=hd=?éaX Y<Ç=H> C0>@}>}) ,@W:}) /!((2!zH  !$@,@LA@*H!LH(P!T9)U+:}+|T:(}@: h* }+ * ,A,}+ h:H,@ *P!T9i*m`D=C0@@!`AdɁ``(-(, @dUj:}*|T:(}:( h: }* * ,A}*2k: Uk:}+|T:(}@B h: }+ * ,A}+ 2hz ;7@;{7Z@!D9@4A=k=(d=?I8UK:}  X@H}+ h$ ,A}+2`<X($ H(KnH8UK:}+ P@,}+ h$ ,A4}+ H(UK:}+9 ,A }+ 9J4@@!Di9@5kAX=C0<g0=?IUI:H})m@D@@X(k8 9J5k@8!H||H-!P|zx|#x= a)|HA < 8c08Ho=?)H=h@ 8H$,A,@, A 8%<`| A 8 N < 8c08HnH<,A=?), @;;`??-;9?C0=?ɽL=Ë=?éW:8lD@@($2rP !`a`dH =;7{@=?8 Ȁ,@:=? @l=?-9)= !2= LA@ = *HLH= (PTT:.H=?鶀H,@= @=?i`PTlD<C0@@=ɫLh((=-9kTT:=?`(}K.H!LU):})Z 2bHH=부H<, @0:!r=? !2 P!`a`dH) 8!H|Ht!|{x|#x|+x4|;x}Cx}.Kx}RSxHLPT\ahl!pxCTx= a)|H@'!((2!zH=!((2!zH ,@!` ,A 8H4,A 8H = C0=ɋHlD!@@`( AD=k| XA4lL!HH`( A X@ 8H= C0=ɋHlT!PP`( AD=k| XA4l\!XX`( A X@ 8H(=?hA h@ 8'><`| A 8 N < 8c.8Hj H5ö!(XB(!paptApptHy`=?4{*2!(NB(!paptApptH=*<!(]B(!paptApptH !*(=? |@=? *!(= |L@@=? !*&WA H=? ( 2=? |LA@ = *`!dH=? (h!l9)3a` | @8!d H8ad =? $=? 4(= 2,@P HM  H@m({$($,A=?4(H=?4( H HM <2Ø;7Ah!l9I| @| xh!l9)| @| xW:}}9 }(}*JU):})z ,A0t}(}*JU):a4})Z)H9 =**rnx;7@(!H=?I_J(AD}.X(H(P(с@nd<C0``=_ɪh(|(h*= l(mJmRbh(=HA@!9)!Bh(nW:}),@HAa}`p|T<|X@ P };U):}) A8;};U):}) @H88H2=?HhLA@H=_ʩ|h|Ax;a <Hh@p=ȩlKd=?lp8*X\U :}K (<2}+: h(=?rL}k:22}*k(aL>(!H=?I_J(ADX(H(P(с@md<C0`ɡ`= (hh(@*8*th(*8*JP:`:}J}Rb<|@=? l@U :}) @(Cn`j.H?L=_rDrL@A!(H  <HLA@ !*H H (D`$`XP8AL!H@=ȩHP L@A, LAA J @: 8:(.(m. 0A `$`P4@!, A, AApPX\V:A} R| .h(=rL} :2}.2} }. (=2=*)(!L(H=?ik(aD}.H(@(X(ѡ@8lt@R(LJP*A|jѡx`Z=_ l *kh:axBP*X:x JP*)@:!x=? rx8al8p8t8x8|9=?9)Hـl,A@ ,@lnd<C0``<ɧh(|(h*=l(LH `:D `:@`:(ѡK`<8cHv=Ht98Hp,AX,A<8cHvHt HP<8cHuHs8H0<8cHuHs8H<8cHuHs8K8!`THz|!|kx|#x|+x|3x|;x}Cx}8KxA8<@D8HLP8`}d[xxxgxHx)x xK 8!|N |!8<@DaHLP8`|3x|;x}Cx}'Kx}HSx!AK着x8!p|N |!88<@DaHLP8`888899 9@K=x8!p|N 85M |P9@4A0UI:}i| . @ }.9J4@85M K|ۡȐ!pB|yx|#x|+x|3x|;x}Cx}8Kx|#x|3x|N!xxN! r=? 8LAA=? @H(7At=?é=?ɏr*@8a@xN! L@@ @hA @ 8H7@88!|ˡN |HwQt!@}Cx}6Kx! A$(a,a0= a)|H@T,@,A 8H,A 83<`| A 8 N < 8c 8HFH9!( !2h(!r2!zH ! $!9)a+| @8 < 8c 0~dx8?H9< 8c p~dx8AH98H8 h(cn`( . `( .A h(k.`( `. `( `.;,@:@|@x}Cx! ;4A(9@W:}iK})I;4@a *=? 2=?) H] r*! $9@88P88U@:}`2L\}h}. hA0} |.`(X(h$ |c| lH4U@:} |. A} 2\HUI:})2L9J4@x~Xx~QA=C0=ˋ=?I9P=?)=`Qaka =?9)d!$= 97!(a+9)m)!(@=?)o((9@9`U@:}  LA@|. L@A,U@:}  L@@||. LA@lUI:}ir L,A \,A}) 9`HdU@:} r|j@ l`(hPh$8H C0=?˩=ko!(( a8#xx888 99!9AH !!( !2h(!r2!zH9 (! h$* h$H!8!8|+xa+|H@} Kx|3x|QA<`C0=?I=k8!|I|T:| 0@$m@aP(H(H,| (@,8 laP(($H$ X(bUK:}+} h: }+ * ,A}+2k: 9J4@D;7@(}2P;a |X|6pp| P|@!$<8cdH>E<8c88H!oɡ(h2!(m ($h<8c88H!iH9M}sx~dx8PH2M;6@!i;5kA<=?W:}  `@}  h$ ;5k@ԁ!i;5kAP=@C0=?ɩ=?W: })oAh(`( ;5k@8!tHn8|!B}=Kx}^SxaC = a)|H@,A 8Hl,A 8HXF,@(| A |H@ 8H,g,@=| A |H@ 8 +<`| A 8 N < 8c88H=)H8 =|x|HQAh}P|3x} CyAD8|Q}'U):})* hLA@,9),85k@8c4@X8!P|N |Hlm!0|{x|#x|+x|3x|;x}Cx}(Kx a A$a(CXx = a)|H@L,@,A 8H ,A 8H= C0<ɇlD!@@`( AD<g XA4lL!HH`( A X@ 8H|= C0<ɇlT!PP`( AD<g XA4l\!XX`( A X@ 8 +<`| A 8 N < 8c8H:H((<:H $ H $`!d7| @8H 8<zz;7A`!d9I| @| x`!d9)| @| xW:}}9 }(}*JU):}) ,A(}(}*JU):}))H =**;7@Tw9@5kAL=C0<ɧ=?UI:})m@\XXh(`( 9J5k@8!кHiD|Hh鿡̔!p}=Kx}^Sx!ȁ)<`| A< 8c|8H8H8((`(`h(=r>H $$;<:H ${$ @!@a@DA@@DH=? @@=? * ؐ@!@a@DA@@DH =? @@=? !*!(=? @@=? !*=? @=? p@ 8Hl=? tA=? x@ 8HD=? @ A=? @@8H 88!HgP|ۡؐ!pB||x|+x|3x=? |@=? A=ȅ9`9 0H=?|$=ɨ(=r=? !$-(Hr=? 20*=2@aD9k=? 2@!D9) }`[x(=_ɪ, A@=ɨ, @ ($| @|p|2p A2|q@h9@= @9@=ɨ@h hh9)9)8 lL<C0HɁH=(~0*l[z2j=$h$@2=L@A$| XAgH* 2- 2 ($, Ax, @>H پ]ɾ=? 2پ=? @=r!PaPTH>ɽ=? 2ٝɼ= @ `P8!|ˡN |!B= a)|HA< 8c8H45H=? {h*@!D9), A H| Adm L<C0HH=ɫ`h((= ~*U):})*= {h(i2jH$U):})* h8!`|N |!B}+Kx= a)|HA< 8c8!H3)Ht(h(Th(h*X8P8aKxԀ|C*= a)|H@,@ ,A 8H|,@!Ȁ ,A 8HXm, @'| A | H@ 8H,f, @(| A | H@ 8=<`| A 8 N < 8cL8H%H=? iv!́)}3p~s:~p~!Ё)}/p}:)~1p~1!܀ !)|x~@HQA8P|p@}sx}w}) | @| x}/P;}H A*|x`HQA܂~XP|P|@~x}}| @| x}3P9=? ɉux~yAl|XP|;x|3yAP8|}<P9)|i}jUk:}k},PP})U):})* r*9J4@8B5@ X@``A蓪!;7{@4:6R@Ԁ8!|N |HT!!0|tx|;x}=? d@`8PHs) (=? d2r!(!2!r;ohzHP=? d@88=? d2rP`:ѨH 88!|!ˡN |!B}+Kx = a)|HA< 8c8HH8c `A,h(X(h$k<`| A 8 N < 8c8HH=? c=? c9`4A@Ui:}) h(cn h(k.9k4@9U):}) 8āy9@5kA,UI:}))|H@!9J5k@܁9|H@!ā6| @| xU=:;; |֐8a8xH)|֐8a8xH 8a8xHT:8a8xH݀T:8a8xHT:8a8xH8a8xH8a8xH}><`| @$X8\<@DHLPTaX\8`!d8Đhplptx|}kx<~x&xGx~hx~)x~JxHy8axHI8axH=8axH18axH%8axH8axH 8axH8axH(8! |N |!0Ba萁쐡|3x|;xAA(08JU):}) ;4@W:}) ~;7{@,@H;z, AP~Jx9>| qT:})U):| T.*|.;5kA K;,A 9>}C0=? ia|AW}8o`D@@(2 Hh] |=. Hg <95`AH|BT<|A,T:}  *ro<|.oщ95k@{7@T8|P|p||x4A8U :}K|PT:} |.P| .  94@95wA(}(U):U:|.P| .95k@8!HAp|!ܐ! B|#x|3x|;x}Cx}>Kx = a)|H@,@,A 8HT#|H@ 8H<T<%|H@ 8 H lt<C0pp=? ɩ_0h( !aHf<`@8=? )_8Hf $=? XdLA@ =_ X*x|H= X(!9`8, AL, @$8|[, @4q*@,|H$8q*A|Y})qA }kYK!| A 8><`| A 8 N < 8c48HaH<UU`UVa| }ipP8}`XP, @`8|p|| x8|}T:dx|T:|U:|8a888HYHD!} HP, @08|p|T:8adx|H,@7A~xT8!|K֐| x8|}}(}I|}eT:|8T:|8U:}9U):})9)UJ:}J9JT:|88Uk:}k9ka<@DHL!PATXa\A`d8a8xHe7@,8adxHـ,Ax88fxH)8!|!N |!ܐ! B|#x|3x|;x}Cx}>Kx = a)|H@,@,A 8HT#|H@ 8H<T<%|H@ 8 H lt<C0pp=? ɩ[Lh( !aHb<`@8=? )[THb $=? TLA@ =_ T*x|H= T(!9`8, AL, @$8|[, @4q*@,|H$8q*A|Y})qA }kYK!| A 8><`| A 8 N < 8ch8H }H= UUa)UV} H|pHP,Acx88FxH8aDxHu,@T87A^x|p|!|K֐| x8|}}(}I|}eT:|8T:|8U:}9U):})9)UJ:}J9JT:|88Uk:}k9ka<@DHL!PATXa\!`ad8a8xH97@(!} HP, @X|p|| x8|}T:Dx|T:|U:|8a888HH<!} HP, @(|p|T:8aDx|Hـ8!|!N |ۡ!B|mx|#x|+x|3x|;x}Cx}2Kx}OSxX\= a)|H@,A 8Hl,A 8HXf, @(| A | H@ 8H,g, @2| A | H@ 8><`| A 8 N < 8cΘ8HuH QpZp3p}jXP9k<ff`fg| |p}ip}iP, <@9`<2} HP9)<ff`fg| |p})p})P, <@9 <}KP|P@A}IP|P@A}}Z|X@a}~Kցk}`XP9kY})Qm)!D<C0@@=? ɩJDh(`KS;`7ZA84A=? Cx9`5Ap|ց6}J|HZ^85JA@|ց=|`J8|}#"})U):})* *85J@9k5@X$ `(cn84@`;{7Z@H8!|N |ؐ!B|3x|;x}+Kx}^Sx!= a)|H@,A 8HĀ,A 8H], @(| A | H@ 8HG, @+| A | H@ 8HX^, @(} HP9)| H@ 8H,Y, @+} HP9)| H@ 8&<`| A 8 N < 8c 8HqH0=? B (~HP:>~Kցk}`XP9kY})Qm)!D<C0@@=? ɩGh(`KS;`7ZA84A=? @䁙9`5Ap|ց6}J|HZ^85JA@|ց=|`J8|}#"})U):})* *85J@9k5@X$ `(k.84@`;{7Z@H8!|N |Ԑ!B|3x|;x}+Kx}^Sx!ă= a)|H@,A 8HĀ,A 8H], @(| A | H@ 8HG, @+| A | H@ 8HX^, @(} HP9)| H@ 8H,Y, @+} HP9)| H@ 8&<`| A 8 N < 8c8HHL=? ?x=? ?(~HP:>~Kցk}`XP9kY})Qm)!D<C0@@=? ɩEh(`kS;@7{A84A=? >P9`5Ap|ց5}J|HZ^85JA@|ց=|`J8|}#"})U):})* *85J@9k5@X$ `(k. `(cn84@P;Z7{@88!|N |!B}>KxaC = a)|H@,A 8Hl,A 8HX, @(| A | H@ 8H,g,@>| A |H@ 8 +<`| A 8 N < 8c8HH|=? < >|x|HQA\}P|3x} CyA88|}'U):})* h(cn 85k@8c4@X8!P|N |B}H|=* )A @(=* A02!$ `L@BM K=* A0 M LALBBM $!2 LALBB@N |ؐ!pB|yx|;x}Cx}((2!zHDÙ>((!zHD =? 8T@P@H(2$*@h(2$h*DcxDx8@8DHH=? 8T@cxDxxxH$=? 8T@xx%xxH` ؐ8!!H|B}H|(b=* 7( @-(!`$H8h@=* )6Hh@ =* )6pN |B}H|-:=* 4x A 2 :=* 4x A2r :N |!B},KxAa = a)|H@H(j=? 6< @ 8 +<`| A 8 N < 8c8HYH(8 (c 2@rKS8,H( (h(=? 5Tr*:<rP<`| A 8 N < 8c<8HHx=? 3h@t<8cxH ;< P!PaPTHA LABA <8cxHU r;LABAK=? 8h@ 8H=? 8h@8;H 8;,@l<8cxH !PaPTH? !* PH?<8cxH =? 6!2H?q rH<8cxHu<8cxHa *=? 2p(=? 82=? i4=? I2pH8<8cxH<8cxH !*!(2r$ !PaPTH>  PA$,@, H> !z=? 2l!*H4=? 2l<H>} *=? 7*@D,@;x8!H0|a!@B|yx|#x|+x|3x|;x}Cx}5Kx}WSx#U):; <<`| A< 8c,8HH@,A 8Hx,A 8Hd%, @| @ 8HD&, @| @ 8H$lD<C0@@=? ɩ5h( !`a`dH=A<`@8=? )5H=) $=? / LA@ =? /@*HLH=? /@(PT| x9`9@,AL,@$8}@[, @4q @,}JH$9@q A}JY})qA }kYK| A 8lD<C0@@=? ɩ5h( !`a`dH<-<`@8=? )5H< $=? / LA@ =? /@*PTH=? /@(HL9`9@| yAL, @$8}@[, @4q @,}JH$9@q A}JY})qA }kYK| A 8<<`| A 8 N < 8c,8HH,;|IlD<C0@@=? ɩ5h(|p,@8T<XT<\8aX8\< 80~xxKЍ,@8|}^.|.^85A\8| P|1}.}`K}%1}L.}Ij X(|. h* X*}M.P(Ѫ85@#x~ijxExfx~gx~xxxH= a)|H@H:, @<,@| A\|KT<8U(<}p}85AlT:}KT:} |.| .  |*85ARU):}) h* ;5@l84A K,@aX a`+|x|HQA?C0=? I0= +)plP(H(h(h*!})8.9`|A|HA9`, A!T a\+|x}HQA?C0=? ɉ0= k)p8!|Io`(X(h((h!})9I89`| A| HA9`, A49*})}'JU):})}~"Uk:}k h* ;5@`84AxK,@d*= )t( *=? )P LA@@`l<C0= ɫ0h((HH`l<C0=? ɩ0h((= )t*=? )t0((at *=? )P LA@@`l<C0= ɫ0h( (HH`l<C0=? ɩ0h( (= )t*=? )t@(aX a`+|xHQA?@C0=? I0= +)p=? )PlA((h((( LA@ `!})8H`|.9`|A|HA9`, AxaT a\+|x|HQA\?C0=? i0= K)p=? ))P8a|YoX(P(h(h*P( HLA@ `!})9IH`}@89`| A| HA9`, A89j}k}gZUk:}k}>"U):}) 2iz 9*x9| A| XA9,A4}j}gZUk:}k}>"U):}) 2j: ;4@9'n9@| A| XA9@, Ap!T a\+|x|HQAT?C0=? )0= )pSr=? i)P8a|YoH(8(P(X*8( LA@ `!})9IH`}@89`| A| HA9`, A48 ||T:}>"U):}) 2}.iz|.9*x9| A| XA9,A0| |T:}>"U):}) 2}.j:|.;4@87A KT,@8* *=? )P LA@@`l<C0= ɫ0h((HH`l<C0=? ɩ0h((= )t*=? )t0(*at *=? )P LA@@`l<C0= ɫ0h( (HH`l<C0=? ɩ0h( (= )t*=? )t@(aX a`+|xHQA |>C0=? 0= k)p=? I)Pl8((h((( LA@ `!})9IH`}@89`| A| HA9`, AlaT a\+|x|HQAP?@C0=? i0= K)p=? ))P8 8a|YoAX(P(h((P( HLA@ `!})8H`|.9`|A|HA9`, A0}gUk:}k}>"U):}) 2iz 9'n9| A| XA9,A,|T:}>"U):}) 2}.iz|.;4@9*x9| A| XA9,Ah!T a\+|x}HQAL?C0=? i0= K)p=? ))P|8a|YoX(P(h((P( HLA@ `!})8H`|.9`|A|HA9`, A0}g"Uk:}k}>2U):}) 2j: 9'n9@| A| XA9@, A,|"T:}>2U):}) 2}.j:|.;5@87AKl,@( *=? )P LA@@`l<C0= ɫ0h((HH`l<C0=? ɩ0h((= )t*=? )t0(*at *=? )P LA@@`l<C0= ɫ0h( (HH`l<C0=? ɩ0h( (= )t*=? )t@(aX a`+|xHQA4?@C0=? I0= +)p=? )PlA((h(h*( LA@ `!})8H`|.9`|A|HA9`, AxaT a\+|x|HQA\?C0=? i0= K)p=? ))P8a|YoX(P(h((P( HLA@ `!})9IH`}@89`| A| HA9`, A89j}k}gZUk:}k}>"U):}) 2iz 9*x9| A| XA9,A4}j}gZUk:}k}>"U):}) 2j: ;4@9'n9@| A| XA9@, Ap!T a\+|x|HQAT?C0=? )0= )pSr=? i)P8a|YoH(8(P( (8( LA@ `!})9IH`}@89`| A| HA9`, A48 ||T:}>"U):}) 2}.iz|.9*x9| A| XA9,A0| |T:}>"U):}) 2}.j:|.;4@87AlKTA88<@!t!D!HLPATX!\`dhlcx~ijx~xTX\!`~jxH88!0|N |H! |+x|3x|;x} Cx};Kx}WSx!$A04!8<@aDHaLC = a)|H@Ѐ,@ ,A 8H,@,A 8Hp,@-|HA| @ 8HD,@;|HA| @ 8H99)( @ 8 +<`| A 8 N < 8c8HH a8}CSx}Cx~%x~x~x~hx=? 9) XxK`!(!, $h$,@;|x}HQA (<C0| =? ˉ$=? i x=? I Xl@T| PP((h(o(! @h**LA@X!\;)HX!\LA@X!\:IHXA\~Kx|@| x x1|H@} Kx|xXQAh<C0|=? ˩$=? ) ||@(lT|PP((H0|@08lT}(!PP(( $H!$ ( Hn-|x|HQA?`C0=? ȩ$=? x=? i Xl`TaPP(( (h(i (@h* 8* LA@PX!\9 HPX\LA@@X!\8H@X\|;x|@| x}Cx4|H@} Kx| x}`XQA=C0=? $=? i |8||T:|| @@$m@TPP0(P(H,| 8@,8 lTPP0((8$H8$ X(b9*})}%JU):}) 2k: 9J5k@l8c4@`87@8B5AK,@;|xHQA?`C0=? ȩ$=? x=? i X=? ) |l@TaPP(( (h(( (M* LA@0PX\lTP(( (H4PX\lTaPP(( (*@( LA@PX!\9IHPXA\39`| A| HA9`, A؀-|x|HQAHP9)|H@}5Kx<}6HP9)|H@}'Kx|P|@|x|P0| @| x|;x|HQA~u@P|b~x~dyA8@8}y}}E89`| A| HA9`, A=9`|A|HA9`, A0}jUk:}k}%bU):}) 2j 9#}8| A| XA8,A0}jBUk:}k}%bU):}) 2k: 9*x8| A| XA8,A=9`|A|HA9`, A,| T:}%bU):}) 2}.j|.9#}8| A| XA8,A,| BT:}%bU):}) 2}.k:|.84@P8B4@ (8! |N |HaĔ!|#x|3x|;x}+Kx}]Sx!)<`| A< 8co8HHhh{(Ë( H H <*:!!*!)8!aHt||@&A! B|+x|;x}Cx}3Kx#U)::)89`H9k|p|9 ,A9 , @a}i[x9`9, AL, @$8}[, @4q @,}H$9q A}Y})qA }kYK|@8<UU`UVa| }ip~P|8P |9U}KPP!J }@Q}p|t| x|p|p})&;79A:@-9:~wxU0:-9.A|AD||րpT:|*tT:|2|8ap|||ƺ|HEH,A(||րtT:|*8at||HD@7A8~~x}|T8|!||K֐x|xT<}}(}I| }`:T:|2|T8|:|U:}B}U):}=J})UJ:}]R}JT:||8Uk:}}Z}ka0(*| .*| .(| .(| .H(| E.*| E.H*| U.(| U.;7{@d;97@ H,A.8i|cp|c:4cA9|p|;4A`8}}L8W:}k~ D.T :})~)D.~T.T.*| E.*| E.(| U.(| U.;4@:4c@|,A/8H8; 94A| @@;|+yA48}}LW:})~ D.| T.| E.~ U.;5k@@H P|p|9 |@9 , @994@8!$Hd|a!pB|;x}Cx}=? dA$L@@|=_ j݄LAA`k$a@42 hLAA `@ !Di0$( `(k. 2(,X$H0,ALA@0*(,,LA@P885ALT:}+ ,@,}kT:}Iѫ})j r 885@84A$T:}iz}) 84@~x~x~ųx8$GxHE4 !<9)!Kx}\Sx! Aa!)<`| A< 8cM8 HH|;h@;h@;h@;,@ @ hD¥H$ @ hF£‡H'H¥ƒ~(( 2(h$*(2($`*X(=? ͜2(2`(H,@ @ hD¥H$ @ hF£‡H'H¥ƒ~(( 2(h$*(2($`*yX(=? ͜{2({2`(H$<8cH)H%<8cHH(hLA@,@hLAA,@L@@8\АȐ 9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cH H<8cHHӚH 8{\АȐ 9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cH)H%<8cHHӘH x L@@,@L@A,@LA@8\АȐ 9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cH H <8cHHӻ(H \8z\АȐ 9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8c0H!H<8cDHH ӷ(Hp,@\АȐ h9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cXHAH=<8clH1H-Әӷ\АȐ 9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cHmHi<8cH]HY((H\АȐ h9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cHH<8cH}HyӚӻ\АȐ 9`P@9`P@9k P@9k, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H, @ P@``(hHP@ `h`(H HH` h` (@(X( 2@(h$* X(2@($k`*P(=? ͜2 X(2(H$<8cHH<8cHH((8!к|H|!ܐ!B|}x|#x|+x|3x|;x}Cx = a)|HA< 8c;8"HtH#2!zH5;2!zH`=? @ 8H=? @8HL8=!$$X$X$2!k:!@a@DH] 98!|!N |H$!aHL|+x|3x|}!`Adhl|p| 8`9@ 9a 9T`:} Z ,A H0T`:} Z ,ATi:})Z |p| 8c5J@!)aL })֑!=? i:@;X|p|`4A |T!`| PaXa|Z|[֑!d4A 4Pd|P!T!|J|K֓h4A Lah| PP||֑al4A H!l| PaLa|Z|[֑!p4A PDp|P!H!|J|K֓t4A @at| PD||֑ax4 A(C*DP*($P(`(8*e`*8(fh(@*h*K@(* * (((**( (2 *2(*0*(((,P(2(*0*(( (94B@l!9)!:Ra|XAU2<:R!~6s@H!D5)!D@da@}ka<4<@!a8})Z!474@̀!0|Ja,5ka,@(!$5)!$@4a }ka4@!|a})Z!|7@x!|Jxa 5ka @Ptt!5)!@ap}kap4@!la})Z!l7@lh!|Jha5ka@ dd!5)!@ԁa`9ka`7@8!0$H#988 |p|9@4M |P@$UK:}k"U :})" ѩ9|8A UH<}GSx9J4M K|!Ѐ 9@5`A,9 UI:})B |p| 9J5k@| x ,A 9a 9 U@:}+.9J4@8h|p|p4Ad!p| P!h!|J|K֐pt!5)!A`!t| P!d!|J|Kցt4A@\| P!`!|J|K}4AX})| P!\!|J|K֐| |!5)!AT}(| P!X!|J|K֐|x!5)!APP!x| P!T!|J|K֐x|!5)!AL!|| P!P!|J|K֐Ā|!5)!AH!| P!L!|J~`Kր6sATD!| P!H!|J~@Kր6RA@!| P!D!|J~ Kր61Àc`g| |~p}ip| P= a) 8|I|XP=?, k=k9k}KP}JZ}Jp}`p}@PP}JA}jXP=?,i|<"`a| |~p}ip| P= a)8|I|XP=?, 89`?,;|?tc.<``c<,8=>cag<` 8<,8<@C0=? ɉ=? I\=? i`}j[x*=)9)| |J|p}+p| P|}@HPgk9kn| `|~p}ip| P|!}`XPgT:})*m@DA@ɡ@`(hmkaLAHH`(j 85@d]8=,9k| =9<t`.||B|p} p| P= a)|I}@P =,9k耀8n<>c`g||~p|p| P= a) 8|I|8P<,8脁fk=k9kȕ=@"aJa| P|~p}ip| P= a)8|I}`XPfa}FP}J~p|p}@PP8=?,9)T:}kJk<C0=? ɩmLHɁHh(`lD@@h(=? \cz=? `r Xh8!`|N ||@&A! B|+x|;x}Cx}3Kx#U)::I8p9`H9k|p|9 ,A9 , @ap}i[x9`9, AL, @$8}[, @4q @,}H$9q A}Y})qA }kYK|@8<UU`UVap| }ip~P|8P |9U}KPP!J }@Q}p|| x|p||})&;79A:-9. ~vxU1:-,A|CxDx8p|ƚK|Cx|K@t7A8~~x}t|;֐xT<}:}(:}I:| :}`:T:|2|T8|:|U:}B}U):}=J})UJ:}]R}JT:||8Uk:}}Z}ka$!$+*H5 ?rHl=? ALLA@ =$2!2!H >@0>$=:=rH H H =r>8!Hq|HqU!a(,048}Cx}3KxADPXx!!aV= a)|H@,A 8Ht,A 8H`n, @-| A | H@ 8H4!Ti, @ A\*| A | H@ 8;<`| A 8 N < 8c 8H@MH!d=? -(!nHe;@;7A|=? ÉW:}+ ,@T}+2@W:*AHA8L<@!T!DHA\ALhP!l!TApAXt\`!dh!!lAAptx!!|AA!!!aa(,048~x~ixADH,@h85AD8|}gUk:}kT:}I}) h($ 85@;Z;7@8!Hn|Hnm!0||x|#x|+x|3x|;x}Cx}0Kx}USxa a!=? É8#85YAt=? T:}i}) 9f}+}&JU):}) h@|@}y[x|@T:})ѩ85J@,@84A}DP8T:}k}*}&JU):}) h$ T}JSy@L94A@8|U :}k}(U):})Tk< 94@84@t84A0T:}+)U):})}k 84@:@84A0T:}I}i}) r 84@xxex8P~'xKPh(=? @rL@A=? é|A84ADT:}+)}kU):}I}) Ph$r 84@Ā84A=? 5F@D95JA88|}hUk:}kU :}) `:95J@T:}k`(9&})}&JU):}) $ѫ84@xxxx8T~'xK$T$$84Ax=? 95FA4| }hUk:}kU :}) `:95J@T:}+)}kU):}) $ 84@xxx8X~'xKX`$=? @=?@ h(cn$ (n(ѵ=? @XPh$:R=? h@=?Drh(o.5H5 !T84A,T:}i})Tr 84@ܓa8!<xx}{x~Ƴxx~x~x~jxH84A0T:}I}i}) r 84@xxex8P~'xKTPh(=? @r L@A=? h@TL@@ hAh, A`84ADT:}+)}kU):}I}) Ph$r 84@Ā84AT:}i}) h$ T9&|HAL}(Kx}IQA@8|U :}k}(U):}) Tc| 95J@84@xxx8T~'xK9$T$$=? @h(on=? @h(nh*h(onKP,@ 88!йHg|!Ba8|#x@DH}Cx}%Kx}ZSxaX!\`adAl!~x~x = a)|H@,A 8Hp,A 8H\n, @ Ah*| A | H@ 8H,s, @2| A | H@ 8 -<`| A 8 N < 8c8H6%HX84AP=? iT:}* ,@(}jX(}*}* :ѫ84@A8p<t@xD|HLPTXAA\`dha@Fxgx}sx~ixAh}N!85AT=? T:}* ,@,}j}* h(}*h$`* 85@A ,A9;H!#8aH ,A!D ,AA@ ,AȀ2|x|`HQA(ah+|x|HQA8|}%9)~i~y}(})2 ,@P8T:}J}(b})U):})}hUk:}k (}(U):}) $Ѫ94@84cA|KT2|xHQAdAh*|x|HQAt}%9)|i8||y8T:}J}(b})U):})}h2Uk:}k (}(U):}) $Ѫ94@87AKla@ ,A2|x|@HQAAh*|x|HQAt8|}%9)|`}(})2 ,@<8T:}J}(b})U):})}hUk:}k h( 94@84BAKl2|x|`HQAah+|x|HQA\}%9)|ɩ8|8T:}J}(b})2U):})}hUk:}k h( 94@84cAK!D ,ATA@ ,A2|x|@HQAHah+|x|HQAt8|}%9)|`y}(})2 ,@<8T:}J}(b})U):})}hUk:}k h$ 94@84BAKl2|x|`HQAAh*|x|HQA\}%9)|ɩ8|y8T:}J}(b})2U):})}hUk:}k h$ 94@84cA Ka@ ,A2|x|`HQAAh*|x}@HQA\8|}%9)|ɩ}(}): ,@(8T:})}hb}k2Uk:}k 95J@84cA|K2|x|HQAdah+|x|HQA@}%9)}I8T:}k}(b})RU):}) 94@84@8! 94A,U :}) Ah: 94@܁a8 ,@D=?9);}#KxH-< 8c~d8H]H)Ax}kx8PH"A(8! |N |H^! |xx|#x|+x|;x }PSxA f;7Al8|)T:W:|xx|8}sxK}~}> }>z ,A }>;7@ |@|x;6AP=? iv ,Ax x|QA8~xW:}kBUI:})B @x;4@| A94AL~Ƴx8|8 |}h*Uk:}k2}(U):})2 щ94@UJ:P} W:}+ } z}+z ! }kJ}JJ 8}_:R>:s~Tx~uxW:})AP9>})}>JU):})b LA@,`$?!:H~Y @$jHL9>})}>JU):})W:}k $?!:H~ `$K9>})}>JU):})W:}j 2zѩ}J h: 2Ѫ9>|HAX}*Kx} QAL8|}jUk:}kUI:}) 2k:2 `8 ѫ9J5@;7@W:}K9=})}=JU):}) }k ;7@Ā;5gAT=? q$W:}) h@|@8|@W:})ѩ;5k@,@;4A}>8P;=? q$8|AD| x}8QA88|}jUk:}kUI:}) `:9J5@W:}i `(})h$ ;4@|;4A0W:}+IUI:})}k ;4@8!HU|!B= a)|HA< 8c8!H%MH,=?,A<8cTHJ8X8!P|N |!B= a)|HA< 8c8H$HHX8!P|N |A!@B|kx|#x|+x|3x= a)|HA< 8cX8!H$iH8< 8ck< 8|< 8l0}f[x8x9 Hр,A8HP<8cHX,@$< 8ck88Hm,@HMI<8cHXq|~y@(< 8ck88H9|~y@ HM|~x,@;a;@<8cHX),@$< 8ck8@8PH,@HL<8cHW|~y@(< 8ck88H|~y@ HL|~x,@Lcx8H?a< 8ck8@8fx8x9 P9@H ,A\,A@<8cHHM8!|AN |!B|+x= a)|H@4,A 8'!H8@H@,A8*< 8c8H"Ih8!`|N |!B|xx= a)|HA< 8c8 H!H,< 8cih88x8PH>; : P::::@P: ::a 9 9 P9 H$P;\~x8PEx8Hm~x< 8<8P8PH"U,@X;|cx< 88L8HHy|}x;,@~xdx8P8H"Cx8PH<8HP;\~cx8PEx8H~cx< 88P8PH!,@;|cx< 88I8HG|}x;,@ ~xdx8P8H"ACx8PHb9P}:J;x< 8T88H,Adx< 8X88H,ADx< 8\88H,A$x< 8`88H,@P;x8PH6i,@(x8PH6U88aP88PH H08aP< 8d8P8PH< 8cx86H ,@L< 8ciX8Px8PH)I|A(xHw,@< 8cx8DH I;97@8!|N |!PB|kx|#x|+x|3x= a)|HA< 8c8!HiH8< 8c`< 8< 8a0}f[x8x9 Hр,A4<8cHD-< 8c`88HHB8H$<8cHC,@HA<8cHC,@HA888,@8a8@888x9 P9@HE,@@,#Ax<8c$HCu,@08a@8PH45|ex< 8c`8@H,@HAA<8c8HC5,@$< 8c`8H,@HA !9)!,A<<8cLH=U8!|N |!B|xx|#x|+x|3x|3x= a)|H@,@ 8'!< 8c8HUH =?)L ,A `88=?L:=? e= _=?9)`!=9k\aĒȒ̒=? 9)!= 9k a=? 9)$!ܒH a|P6|H@ Ha, A4|}x7A(8}|{|yxExH ;7@! !})9)m)!=`C0aɡ(hla($h 8a< 8(8P8PH8a@< 8x8P8PHm8a< 88P8PHU8a< 88P8PH=8a0< 8h8P8PH%8a< 88P8PH 8a< 88P8PH8a < 8X8P8PH8ap< 88P8PH8a< 88P8PH8a< 8H8P8PH8a`< 88P8PH}8a< 88P8PHe8a< 888P8PHM8aP< 88P8PH58a< 88P8PH9a@!i<8c`H-< 8c^88HH8a@x8PH/E;8;::x8PxH8ax8 8PH(/@ (9@ ;H8!9)!|uJ8c~x88Ha~xx8H.,@,@8a88 HH!9)( ^A<8ax8H.u8a8P88H18a88 8PH< 8c(x8H8;x8 H.,@x88x8 H3,A@,A Hx8|H@a |HPHXHP,BA ,U@$a+| P,AlH@,C@!Ā !`|  HD,E@aȁ+H؈,FA ,D@ aH,HA ,?@@;::}P|u8cx8PHI;86AKԈ,N@!Ѐ 8a< 8,8P8PHA8a@< 8|8P8PH)8a< 88P8PH8a< 88P8PH8a0< 8l8P8PH!ԑ!89aa<@8"D9 P!H9`&aL< 8c^< 8^< 8eX|fx< 8= 9_9!|jxH1!А 9`aH,QA,SApA:!!`Ad::`ahl8a8`8h< 8_8H78a888H5,@ !9)!, @,8H؁9pt:9x|8a 8p8x< 8_8H78a8 88H,@ !H,>A ,<@L8a< 88 8 Ha!#| 89`a<8'@9 !D9`PaH< 8c^< 8< 8^< 8|+x= 9(|+x9AHE8>:\=?)L9)!> :889!!<9aa@8DHAL9 P!Pxx%x8899!=_ 9J^HE,A!9)!a+| P5 A9 }=KxQA(8}|{|yxExH;7@8a`< 8H88Ha8`|`8c< 888H8a`x8Hm88<@9 !D9`=aH8L< 8c^|dx< 8^|+x< 8|+x=? 9)|+xH=H< 8c(x8H89 !,AlKhaHa+|JHH8|xHQA(8}|{|yxExH;7@89)!9`!| @9`, A:8:A@;`P>b;,Aa\`xxK,A#x8PLHS-~x$x8P8PHU8a8PPHS ~óx88P8PH18 <8cHE~x8PHE|ex< 8cB~xH~óx8PH%|ex< 8cB~ijxHܥH8<8cHHq,A`#x8P~exHRi8a`$x8P8PH8<8c H8a`8PH|ex< 8cB8`H%H8<8c8HmHA8<t@aDaHaL< 8cBxExX89=? 9)C9AH;88< 8cB< 8C8~Fx8xx9@PH|@x8H,@,AH;#x8Px8Hx$x88PH]x< 8t88H},A$x< 8t88H],@: ;:Hd: 8a88x8HY,@<;:8aP< 8t8P8PH< 8cB8Px8PK=,AL,A8!܁aL | AaP | A 3H;H ܐ,@$:,@adhx|K,A88!0|N |!pB|3x|;x!Aā̃ЂAԁ؀= a)|HA< 8c8KH88;`,@:>:;!`>:0>:sH:@;P:?@cZ8,Aax}kxK݀,A0,A4<8cH 5<8c0H3<8cHH-H8|dxx~&x< 89`=? 9)>9A0H;8< 8c>`< 8>80~x84xx9@PH|@x8H,@,@|HP;x< 888Hq,A$x< 8,88HQ,@988;`H 98a88}{xx8H8,@$,@aĀxKI;`8,A@8!|N |!B= a)|HA< 8c,8KH#$X8!P|N |!B|mx<@|3x}Cx}<`| A 8 '< 8c8KH|88P<< 8cxex~x89`x9@H#,AD88P<< 8cxex~x89`x9@H#,@ 8H8 8,A;:p:a>b>bxDx8P&xH􁓡8<@AD!H8PL}kx<@}{x< 8;x}sx9!9AH>~x8Px8PHa~cx~x8P8PH|A|A|8!<~cxxex~x8Hxx9@PH",@Ȉ,$@px8PH ,@\< 8cx81KUx8PH 88a8xH8Cx< 88%x8HUHp8aP< 8<8P8PH98a< 88P8PH!< 8c;8Px8PKٙH$,@< 8cx8AK䥀,@H=?) ,A@<8cxHF <8cH Cx$xH |ex< 8c;xDxHUH(8! |N |a!pB|}x|#x|+x|3x= a)|H@,,@4|#x|3xH U,A 8'1< 8cd8 KMH=?)T ,@x< 8< 89Hfx8`x9 xHV`,A 8*< 8cd8 KH=?)T8 =?)T8 $ Hh=?)T ,AT88 <8@DH< 8c7< 8< 87< 8|+x|3x|+xjxKm8!|aN |a!B|}x|#x|+x|3x= a)|H@|,@|#x|3xH 8'1,@T=?)Ԁ ,@hx< 8< 87x8@x9 jxHUA@,A 8*< 8c 8 K}H8=?)Ԑ x8!p|aN |A!B|zx|#x|+x|3x|;x= a)|H@|,@|+x|;xH 8'1,@T=?) ,@x< 8T< 89Lx8@x9 jxHTQ@,A 8*< 8c\8!KH=?)8 ,A<8clH <8cHiHe<8cHYHU<8cHIHE<8cH9H5H,< 8cx8EK}< 8cx85Kix8!p|AN |!B|lx|#x|+x|3x|;x}Cx}:r:!;@P>`bs;,AaexKy,Ax8PH.i~xx8P8PHԹ8a8PH.E~x88P8PHԕ8 <8crHѩ~x8PH5||x;~x8PK|P< 8cx8H ~x8PH||x;~x8PKU|P< 8cx8HH8<8crHH̝,Ax8P~ExH-m8a`x8P8PHӽ8<8crH8a`8PH]|}x8`;|x8PK|P< 8cx8H1H8<8crHyH!8a<Đ@ADAHAL< 8c ~x%x89=? 9)`9AH 88< 8c< 8`8~&x89ix9@PH|@t,@,AH;x8Px8Haxx88PHux< 888Hѕ,A$x< 888Hu,@8 HD9 ! 8a88fx8H,@ < 8cdx85Ké;:,AT,A@! LA@ ! L@@ ѲH;H ,@(: ,@aexK,AP8!|N ||@&A!B|+x|3x|;x}Cx}:Kx!~x = a)|H@T,A 8H %, @| @ 8:<`| A 8 '< 8cX8KH;< 888xHx}ISx9@ H],@8a@x88 HA;7At: ;;!? ;t;a@ؓ8a@8K9aW(4}9J9)!蓁acx88< 88H;7@:8a@8K|}x;7A;;a@.;!:`8|)x8|*~xH^cxx8P8HU@l#x88@xH^u#xdx8xHa,@T,@,:cx8PK=|fx~xdx~%xHH$tH< 8cxDx8KH;7@D,@ 8h8!`|} N ||@&A!B|yx|#x}'Kx}[Sx(A,A8= a)|H@H! ,@! ,A 8=<`| A 8 '< 8c8K1H:|p|:x|0P=`ffakfg}X}p|p}@P =@QaJ|P|.p|p| Pd|0P}`X}kp|p|XP<b`M||6p|p| P} 0P}IP}J.p})p}IPPA!*| Q>:sk>:l:99P9>b|0P.:--;,Aax0Kq,AlcxDxK,@<8`<8ckHcxDxK|ex< 8cdxHUH48a`< 888HqH8`<8clHɁH8| ,i@ T:=?)| .H,l@$T:=?)}) АH,r@$T:=?)}) H,sA ,u@|T:=?)})p=?)9)W:J=k9k9)J|0Pa|Z8H!}}`XP9k!i8h8!`|!N |AȐ!pB|yx|#x|+x|3x|;x}Cx}7Kx}ZSxȃâAԀ= a)|HA< 8cܐ8 KH8 xexH |}y@H=?},A,8c}Tc(4=?)9)|cJ$x8 fxH%}=?)9)>| I,i@T:6}=.H,l@$=?)9)ԁi,Uk:}kJH|,r@(=?)9)i\Uk:}kJ Hx~xExx~GxH,@0=?)9)tiUk:}kJ=?) HH=k+9)+H08H$=?)9)>~|H| @, i@W:=?)| Y.H,l@ W:=?)}) HĈ,r@ W:=?)}) HW:=?)}) p@=?) a@| @ 9)U`:}`J}). |HPH @T:=?)})  x| A;7AX=?i;{=?;!@U):}))}=J:||u888H;7@=?)9)Ёa@Uk:}kJ9i4~x 4|@|xkH8a@xH=x~xExx~GxH},@(W:=k}k=?) pH8=?)9)>8*|IH < 8cܰx80K88!|AN |!!B|yx|#x|+x|3x=?iK, 1A@+|J,A\8  ;7A;k=?;|}||c888HQ;7@HH=?i+|J,A+9)+;7AH=?i;{=?;|}||c888H;7@=_J9JjUk:}kR*9)+*})* T:}J*H8H8h8!`|!N |А!B=?)X9) ̐ :7 A=?ɯX:X:~x~ճxV:}*i|XP7@@L}* }~[xQA8=?iT;{|x|zP|c|88H;7@V:} }Jh }`XP9k849)*4}kx4h:79@\x8!p|N |!Bc, @=?)D | @ 8'< 8c48"K=H=?)Di9ki| x}XQA@=?ɮD8D8UI:}i2| 0. }i:| 8. 9J5@=?)Li9@5kA\=?H8>=?ɮL8t| 8,sA ,u@$U@:}2(| @ 8 9J5k@ĀX8!P|N |!B|xx|#x|+x|3x|;x}$Kx}PSx}OSx= a)|H@,A 8'< 8c 8KHK|yx:::9H:|Ah8`;Hp;8`;=?Ix=?;H$8{|88HU |`;9 ,@|A9 , @8,A|@8,@xx,AtH;8`;=?Ix=?;H$8{|88H |`;9 ,@|A9 , @8,@|@8,@x:,@x:||֨P8a@888H,AD:3| @(8 |oI|m8@~x8HH :8,A|@8,@,(8! |N |AȐ!B|~x|#x|+x|;x= a)|HA< 8cҸ8KH8|;xKYa,@\x< 8Ԁ8H|ty@, A=?9)[H =?9)[,8 }#KxH< 8c88H}Ha,AP=?9)[D 8 }#KxHq|cy@< 8c~x8H1|cy@dHH\=?9)[\ 8 }#KxH!|cy@$< 8c88H|cy@Hi,A:`8a@x8xH;7AH;@}<)8 (A$||8 8c888H;7@8a@< 8؀8H|~x8a@< 8܀8H||x8a@< 88H|{xx|@x|@`x,A 8a8@8HH,@T,@;8a8@8xHр|0@8a`8@|"8|0PH~^PH,@,@l;8a8@8xHy|0@(8a`8@|"8|0PHU~\PH(8a`< 888H1:@H 8a< 888H;H;@|~8c< 888H!,@P;8ax8xH8||0P8a`888H~[P:RHt;@|~8c< 888H,@;8ax8xHU8||0P8a`888H1~[P:R:`,@4|a8c< 888H5,@;;H;,@H;x< 888H,@$x< 8 88H; HX,AP,@H8a=? ;I|yx!A;x88< 8 8H5;,A\8`=? 9) !8A8ԓ8a@88< 848H}=9)!H4,@ 8a@88xHɓH8H<, A=?9)[tH =?9)[8 }#KxH< 8c88H9Ha, AT=?9)[8@ i8 }#KxH)|cy@< 8c~x8H|cy@hHqH`=?9)[8@  8 }#KxH|cy@$< 8c88H|cy@H,A 8,A ,A=? rH8!@|AN |!!B|yx|+x= a)|HA< 8c8KqH;;=?it=?p;H0W(4#x|Ex8 H!,@ ;H;9 |A,A9 , @;,@xxh8!`|!N ||@&A!PB|yx|#xАԐؑ}'KxAa胡!A= a)|H@H!Ѐ ,@!؀ ,A 8=<`| A 8 '< 8c<8KH;|p|:x|0P=`ffakfg}X}p|p}@P =@QaJ|P|.p|p| Pd|0P}`X}kp|p|XPT<b`M||6p|p| P} 0P}IP}J.p})p}IPPAT!*| QT>:sS>:S:`9:9P>b|0P.:AP-9P-;,AaЀxKY,AlcxDxK,@<8`<8cSHcxDxKͽ|ex< 8cdxH=H48a`< 8T88HYH8`<8cSHiH풡8q8a`~DxH$@,}kx8exFxHA8a`}kx88H8a`dx8FxH9cx8`Ex8H08a`< 8X88H cx< 8TEx8HH@~Cx88`8HA;`x~Dx88Hx< 8X88H,A$x< 8X88H,@;;;H;,Al@$~Cx88`8H=9cx~DxH0@$}kx88`8H@acx}kxH cx8`Ex8H X! ,@$,@a؀xKi;,A8!|} N |a!B|~x|#x|3x|;x= a)|HA< 8cʈ8KH<8a@x8HQxxxfxH=x8@ex8H)h8!`|aN |!B= a)|HA< 8c8K%HѤX8!P|N |! B|zx|#x|3x|;x }4Kx}OSx!A $(a08= a)|HA< 8c8 KHxKe|{x~x,KU|ux,A,Ax;}x|@|}x;7A@,@,|z|8c888H,A;;7@,@|@Cx< 8x8H |~y@p|@ ||ިP~Cx8~x8H~Cx< 8~x8HE,@~xDx~ex8H@~x< 8~exH(~xDx~exfxH~Cx< 8~x8H8 ! ~#x< 8䀡48H8! HP,@~xDx~exxH~x< 8~ex8Hu;P~xH;|z||"8c888H},AP||@P,@HH 7@ |P}z9 ,@U`>(0A(9A9 , AK;,A H;;}:;||"x888H,@Hx< 888H,A(x< 888H,A;,@P;;,@}:;x< 888HU,Atx< 888H5,AT}7;x< 888H ,A,x< 888H,A ;H;,@X~xDx~exxH,@(|P8|2|P~#x848H~#x< 8䀡48HA||@H;`|Px|8|0PHx8}sx~Ƴx8Ki,@H\8! ||@l|ܨP8a@|8|0PH8a@8}kx~Ƴx8K ,@ 8H8-|H@ 8H8! H8! ;`x8Kā|}x8a@8Kq|@$8x8KU!iH 8,@~#x< 848Hm|~y@p|@ ||ިP~Cx8~x8H~Cx< 8~x8H,@~#x~$x48H,~#x< 8䀡4H~Cx< 8~x8Ha8! 8!|N |!B|+x,@ ,@=?9)GH,@=?9)GH,@=?9)GHЀ,@=?9)HH= a)y`|H@=?9)H H= a)|H@=?9)H8Hx= ga)i|H@=?9)HPHX= a)|H@=?9)HhH8= ea)6|H@=?9)HH=?9)HH , A=?9)HH,cA=?9)HH܀,A=?9)HHĀ,'A=?9)HH= a)|HA=?9)IH= a)B?|HA=?9)I(Hl= a)|HA=?9)I@HL= a)|HA=?9)IXH,= ;a)|HA=?9)IpH =?9)Ii}#KxH!< 8cx8HHX8!P|N |!B|#x,A< 8 }e[x8H< 8}e[x8H}X8!P|N |!B|+x=? @=? X @=?9)FH=? \ @=?9)FH=? ` @=?9)FH=? d @=?9)GHh=? h @=?9)G(HH=? l @=?9)G@H(=? p @=?9)GXH=?9)GpH=? h@ =?9)Gi}#KxHMH=? t @=?9)GH=? x @=?9)GH=? | @=?9)GHl=? @=?9)GHL=? @=?9)HH,=? @=?9)HH =?9)H0i}#KxHq< 8cx8HHX8!P|N c<`| A$<`| A<`| @ cN | p}#x|iP<h`||fp|ip| P'|`PN |!B|wx|3x!AAa= a)|HA< 8c8KH:;p::0=9E=9E=9E>:E:!;@P>`bs;,AaexKu,Ax8PHA~xx8P8PH8a8PH~x88P8PH8 <8cEH~x8PH]1||x;~x8PK|P< 8cx8H ~x8PH\||x;~x8PKQ|P< 8cx8HH8<8cEHH,Ax8P~ExHE8a`x8P8PH8<8cEH8a`8PH\Y|}x8`;|x8PK|P< 8cx8H-H8<8cEHuH!8a<Đ@ADAHAL< 8c~x%x89=? 9)\9AH88< 8c< 8\8~&x89ix9@PH|@t,@,A H;x8Px8H/xx88PHqx< 888H,A$x< 888Hq,@8(HD9 !(8a88 fx8HI,@ < 8cdx8:K;:,AT,A@ɡ ! LA@ ! L@@ ٲH;H  ,@(:(,@aexK,AP8!|N |!B99:`:aa|rx|#x|+x|3x|;x!! = a)|H@$,A,,@ 8'! < 8c8KHh;x8}e[xKA8a@x8P8Hi,A,@ 8a@< 88P8PH9H8a@8PK]|@ 8H|@\P7AP= 9T;@}kxa;@P; !Ax88< 88PHå7@,A,@~Cx~xK,@\~x~$xK,@H~x~$xK|ox~Cx~xK|nxA!A!AHH~Cx~xKU,@ ~Cx~xKA|fxa~DxH~x~$xK%,@ ~x~$xK|fxa~xHa< 8X8H|~Cx~xK,@p~x~$xK,@\~x~$xKa8a@8PKa~Cx~xKa8@ԒAЀa88< 8H~Cx~xK],@L8a@8PKI|wx~Cx~xK9|vx:@~Sxaa88Hp~x~$xK,@p~x~$xKa8a@8PKݐa!A!A9A@Aaa葁a88< 8؀HIH$8a@8PK|fxa8@H98! h8!`|N |!PB|vx|#x|+x|3x|;x}Cx}=Kx}YSx= a)|H@8%9)( b@ 8><`| A 8 '< 8cP8"KHx< 8tx8H,A$x< 8xx8H,@D8a`< 8HX< 8cx8Kxx%xK8HLx< 8x8H%8a`< 888H;: :`?@cZ?;=X:`:`: :@,AP8|H,sA ,u@ W:=?)9)p|cJxK=?)i9kixXQA=?);9;U>;u>=? ;酴:ԂɅ:;tW(4|d|8 8 H|Ю|ٮ,i@W:} |.HD,l@W:} |.H,,r@W:} |. HW:} |. ;7@|8H8x8!p|N |!PB|zx|#x|3x|;x= a)|HA< 8c48K H8a@8`88Hf%8a@< 8T88H8\,A8/CxxK||x;`;7A4|z8c888Hy,@x;7@|@#x|x|PH#x< 8hx8H8!|N |!`B|yx|#x|3x}Cx}/Kx}MSx= a)|HA< 8cD8!KHLK|zx;;7A8|y8c< 8h88H,@x;7@,@;\~x}{xKU|~y@h.{W{#{,@H=? ; h7x@D:UxHL}sx8@8H< 8|}kxHH}sx< 8h}kx8H|AT};P:}sx}kxK|sxaHL}0:I}sx!@AD}sx8@8H< 8|}kxH58! 8!|N |ؐ!B|+x|3x|;x}Cx}&Kx}XSx!= a)|HA< 8c8KH,@|#x|;x'xH#H|#x|;x'xHL%x$xK,@Pxx$xK||x@D~xxAHaLx8H8@< 8'xH-Hx~ijx%xH)8!|N |a̐!PB|{x|#x|+x|3x|;x}Cx= a)|HA< 8c8K H;|;xK,A HcxxK|}xcxxHMAP;|A`cxxHM%||x;cxxK|P~xx%x8H5,~@ ~x< 8%x8H|~y@~x$xK1|~x;x~x88Hxx8@Fx89H,A< 8cDx85KeH8a@8K|}x~x$xKP|@d~x$xK|~P:8a@8K|ux`d}7::a@ahl~x8h8`< 8ذ'xHH 88!|aN 89!8   h1 |iN |А!0B|vx|#x|3x|;x}Cx}7Kx x = a)|HA< 8c8!KH8'|xHQA48~|u|txKm|@a;7@Ԁ:| P| x9)!|IlD<C0@@=? ɩh(=? =? @k:HLX8\@cxK|~x95cA 9A@};B | A95k@;@8:8aP88XHM8a`8P88H=`;` 8a 8s 8ah8< 8PHx8h88H`  8ap8< 8dHix8p88HY`8ax88Hx8x88H` !"#8a88Hx888H`$%&'()*+8-|x ,A 9A@9` }(Ri94@8 ?=?9)3,  }#KxHމ< 8c 8@8HHa9@9|x HQA;7A;@8|t?_;Z3@}j}; 9J, @H79)7<8c3@H< 8c 8@8H}H9@;7@;79@d, @t}HSx!j, A 9A@8}(R 95k@79)7=?9)3T  }#KxHY< 8c 8@8HH179)78!|N |AȐ! B|ux|#x|;x}Cx}2Kx}YSx! )<`| A< 8c8!KyH'| P| x9)! (| P| x9)!|IT:lD<C0@@=? ɩh(=? ״=? k:HLX8\@|#x$K|{x9@5cA 9@}>R |Q9J5k@;@8:8aP88XH98a`8P88H)`;` 8a 8i 8ah8< 8Hx8h88H`  8ap8< 8,HUx8p88HE`8ax88Hx8x88H` !"#8a88Hx888H}`$%&'()*+8-| x ,A 9@9` }*Bi9J4@8 ?=?9).0  }#KxHu< 8c8@8HHM89|x@HQA2|xHQA;@8?;{.DT:}k}<U):}) 8,@H79)7<8c.DH< 8c8@8H]Hե8;7@;97Z@X,@x|;x!g, A$9@8UI:})B 9J5k@79)7=?9).X  }#KxH5< 8c8@8HH 79)78!|AN |!B|}x|#x|+x|3x= a)|HA< 8c8"KmHX< 88@H=?9))H  }#KxH}< 8c8@8H HU>9)>X8!P|N |!B|rx|#x|;x}Cx}0Kx}YSxe!)<`| A< 8c$8"KHH'| P| x9)! (| P| x9)!!})9)<!`C| |J|&p})p| PT:l<C0=? ɩh(=? =? ,k:Ȁ̐8\@|#xK|{x9@5cA 9@}>R |Q9J5k@;@8:8a88H98a888H); 8a 8l 8a8< 8Hx888H  8a8< 8PHUx888HE8a88Hx888H !"#8a88Hx888H}$%&'()*+8-| x ,A 9@9` }*Bi9J4@8 ?=?9)(  }#KxHu< 8c 8@8HHM;`;9|x HQAԀ0|xHQA;@8@>:(W:}k}<}) |t ;,@l8a@H;Wi:})i;{,@H49)4<8c(Hҥ< 8c8@8H5H};`;7@h:79@4,@Lx!~, A$9@8UI:})B 9J5k@8a@HW`:}!i<;{,@xjx ,A$9@9`UI:})Bi9J4@49)4=?9)(̀  }#KxHѽ< 8c8@8HMHΕ49)4h8!`|N |AȐ! B|ux|#x|;x}Cx}2Kx}YSx! )<`| A< 8c8!K}H܀'| P| x9)! (| P| x9)!|IT:lD<C0@@=? ɩ0h(=? =? lk:HLX8\@|#x$K!|{x9@5cA 9@}>R |Q9J5k@;@8:8aP88XH8a`8P88H~`;` 8a 8r 8ah8< 8ƀH!x8h88H~`  8ap8< 8ŐHx8p88H}`8ax88HUx8x88H}E` !"#8a88Hx888H|`$%&'()*+8-| x ,A 9@9` }*Bi9J4@8 ?=?9)#   }#KxH,@$< 8cL8@8Ha,@Hʡ89|x@HQA2|xHQA;@8?;{#4T:}k}<U):}) 8,@X79)7<8c#4H!,@$< 8cP8@8Hȩ,@H8;7@|;97Z@H,@|;x!g, A$9@8UI:})B 9J5k@79)7=?9)#H  }#KxHy,@$< 8cP8@8H,@HA79)78!|AN |!B|}x|#x|+x|3x= a)|HA< 8cX8KxHh< 88@H=?9)  }#KxH˱,@$< 8c8@8H9,@Hy>9)>X8!P|N |!B|}x|#x|+x|3x}+Kx= a)|HA< 8c8!KwHl< 808@}i[xHy=?9)T  }#KxH,@$< 8c08@8Hi,@Hǩ>9)>X8!P|N |!pB||x|#x<@`BA< 8c8KwHl;`x8@x88HH%x< 888Hw/Al8a`< 8088Hw/A$8a`< 8D88Hw/A8a`< 8X88Hwe/A 8a`< 8l88HwE/A8a`< 888Hw%/A8a`< 888Hw/A8a`< 888Hv/Ad8a`< 888Hv/AD8a`< 888Hv/A$8a`< 888Hv/@ 8H(8a`< 888Hv]/@8H< 8c x8@Kh< 8cLx8EKh< 8cx8AKh< 8cx8EKh< 8c x8FKhm< 8chx8GKhY< 8cx8GKhE< 8cx8FKh1< 8c8Kt8+8!|N |!B||x|#x|3x|;x= a)|HA< 8c|8KtEHK%|{x;@;7A8||8c< 888Ht,@x;7@,@ |@#x|x|PH#x< 8x8Humh8!`|N |Ԑ!pB|xx|#x|+x|3x|;x}Cx= a)|HA< 8c8KsQH}CxK-,A < 8c8Ks-8'1H8@XxxH/}|}x;xxK|}P;caHL;AX;=!PAT8a@8P8H< 8ƺ8HU8a@~x~ųx~x8H!8!|N 9 (0A(9A9 }#KxN |a!B|{x|#x|+x|3x< 8|x8HsxxK;7A\}< A!A8 (@|{8c8AH9) |{!@8c8@88Hsy;7@x8!p|aN |a!B|~x|#x|+x|3x= a)|H@l|#x< 8|3x8Hs=?9) }#KxH|cy@$< 8cdxxHS|cy@Hu,A8*< 8c8Kph8!`|aN |!|}x;;K|`x,@8`9`4cA`/}=Z 5 A, @9), @9 , @@, @ ;9)W 6J9k4c@,AxX8!P|N c99@U :|ip})U <|Ph || !.}#Kx95JM K|!|}x;xK|`x,@8`9`4cA`/}=Z 5 A, @9), @9 , @@, @ ;9)W 69k4c@,AГ@@ h8!`|N |a!B|{x|#x|+x|3x< 8t|x8HpxxK;7A\}< A!A8 (@|{8c8AH9)|{!@8c8@88Hp-;7@x8!p|aN |!!B||x|#x|3x|;x= a)|HA< 8c8Kn HK;`;7A8||8c< 888Hn,@x;7@,@Cxx%x8HCx< 8%x8HoAh8!`|!N |!!PB|{x|#x|3x|;x= a)|HA< 8c8Km-H;`x8@88H>Ex< 888Hm8\,A8/cxxK;;7A4|{8c888Hm,@x;7@,@Cxdx%xxHCx< 80%x8Hn8!|!N |ܐ!pB|zx|#x|+x|3x= a)|HA< 8c 8KlH|3xK,A < 8c 8Kk8'1Hh8@X;CxxK|}xHL;X[xaPT8a@8P8H< 8Ƴ8H!8a@~x8Hq8!|N |!@Baؐܐ}Cx}(Kx}SSxa 4! )!H= a)|H@L! ,A 8HA$ ,A 8H,@Ȁ,@,@! ,@A 0|HA,! (|HA8A*|H@ 8H! A*|H@ 8H`,@0,A 8H@ ,@,A 8H ! T<+|H@ 8 ><`| A$=)9)>< 8c,8KiHh! ,A,A*})P9)!P3~P:H3!PA! ,A4A*})P9)!\A*})P9)!XH!)!\AJAXA\UI<9)P})Qր})k [;8|Y} HP}J֑AL}zpZ}<p;,@H,@:=98 !H~ I=_ D= ˶! }7P,@ 3})P;i|@H0}.I})AL})PP9)^x|H@}>Kxa؀ <8cH|cy@D;7A4W<|< 8cP88H%|cy@;7@HU,Al!؀ 8<8cH),@D;7A4W<|< 8cP88H,@;7@HP;!܀ ,A4;5ZA(W<})ji i;5J@|AA |Aa ,@PW<}) ,@<};U):A0})RlD=`C0a@@(* H@}{Uk:0}kW<}) lD= C0!@@( ;:79@ԁAT9JAT6R@DaP}+P9)A |H@} Kx!( aXA\}*XP9)a$ |H@} Kx!, H < 8cHx8.KX8'8!|N |!@Baؐܐ|;x}3KxAa , H= a)|H@D ,A 8H ! ,A 8H,@Ȁ,@,@A ,@! 0|HA,A (|HA8A*|H@ 8H|! A*|H@ 8H\,@0,A 8H< ,@,A 8H!) | @ 8 ><`| A$=)9)>< 8c 8KcAH ! ,A,A*})P9)!P3~P:H3!PA! ,A4A*})P9)!\A*})P9)!XH!)!\AJAXA\9*P})Qր})9)k [;8|Y} HP}J֑AL}z[xZ;,@,@a+A 9`aT~@HQAx! ,A(A*a } HPAT}*HP9)H!T0:79AaT9>: |=9 8 !H~ I=_ = ˰,! }7P,@ 3})P;i|@0}.I})AL})PP9)^x|H@}>Kxa؀ <8c |H]|cy@@;7A0|< 8c88H|cy@;7@H,Ah!؀ 8<8c H,@@;7A0|< 8c88H,@;7@HP;|A! |AA܀ ,@L}< |u@<};U):A(})RlD=`C0a@@(* H@}{Uk:(}k}< |tlD= C0!@@( ;:79@ AT9JAT6R@aP}+P9) |H@} Kx! AXa\}+PP9)A |H@} Kx!$ H < 8c@x8.KR8'8!|N |!@Baؐܐ}Cx}(Kx}SSxa 4! )!H= a)|H@L! ,A 8HA$ ,A 8H,@Ȁ,@,@! ,@A 0|HA,! (|HA8A*|H@ 8H! A*|H@ 8H`,@0,A 8H@ ,@,A 8H ! T:+|H@ 8 ><`| A$=)9)>< 8c8K]EH|! ,A,A*})P9)!P3~P:H3!PA! ,A4A*})P9)!\A*})P9)!XH!)!\AJAXA\UI:9)P})Qր})9)k [;8|Y} HP}J֑AL}zpZ}<p;,@X,@La+A 9`aT~@HQAԁ! ,A(A*a } HPAT}*HP9)H!T0:79AxaT9>:=98 !H~ I=_ = ˪X! }7P,@ 3})P;i|@X0}.I})AL})PP9)^x|H@}>Kxa؀ <8cHQ|cy@D;7A4W:|< 8c 88H|cy@;7@H ,Al!؀ 8<8cH,@D;7A4W:|< 8c 88Hm,@;7@HP;!܀ ,AD;5ZA8W:})ji ii i;5J@Ѐ|AA |Aa ,@PW:}) ,@<};U):A0})RlD=`C0a@@(* H@}{Uk:0}kW:}) lD= C0!@@( ;:79@āAT9JAT6R@4aP}+P9)A |H@} Kx!( aXA\}*XP9)a$ |H@} Kx!, H < 8cx8.KLE8'8!|N |!B|;x}'Kxa = a)|H@,A 8Hl,A 8HXF,@(| A |H@ 8H,},@'| A |H@ 8 +<`| A 8 ' < 8c~l8KWH=? =? L '|x|HQAp}P|3x} CyAL8|}'U):})* h(cn h(k. 85k@8c4@X8!P|N ||@&ۡA!ϰB||x0l|+x|3x0x}Cx}4Kx}RSx00000A0a0/= a)|H@X,A 8H$,A 8H!0xi, @4| A | H@ 8Hh, @*| A | H@ 8H,A48<8cH< 8cx8H8QH~H|,.@ 8 Hd!0 ,IA,iA 8!HD88 (@8, A0<8cH< 8cx8H7H~q83<`| A 8 '< 8c|8!KU)H84a0x ~HP:2~HP:=),@,~cxKť!0 |cxa/1#| /H 9`a/,A$;/8a<xdx00x~'x~x~Ix9A/K=?9);`}#KxHSE< 8c8/8H6HNx~dx8PKG=?9) }#KxHS < 8cx8H6HNyx~dx8PKGy,@=? H = /hLA@ ѰH /=? 9)|!8?:1|A(a0x+}:J})rU):0})H,@x (LA@*/a/H(/a/, @9`| h@ 9`ak, @=kW<})iNH؀,@p LA@*/a/H(/a/!/| H@ =`ak/| @ =`akW:})iLH` (LA@*/a/H(/a/, @9`, @9`}4iO;|@A8;5YA,9`W<})BiN O NiO;5J@,@|!0l a/А  <8cxHa/,@@;7A,;W<|"< 8c88Ha/,@;7@H,@x!0l <8cHa/,@;7A;W:|"< 8c88Ha/,@;7@Hp!0l <8cH!a/,@L;7A8;|< 8c88Ha/,@;7@Ha/59)5;/,@,;Z7{@/~R6@,@P,@4x|QA9A`9`W<})RiN;4AlK,@4x|QAP9A`9`W:})RiL;4A0Kx|QA 9A`9`}*iO;4@,@|=?9)́a0l  }#KxHa/,@h;7AT;W<|"< 8c88H)a/,@0;7@H,@=?9)a0l  }#KxH9a/,@;7A;W:|"< 8c88Ha/,@;7@H< 8c}~dx8K;< 8c}~dx8FK:< 8c~~dx8K:< 8c}~dx8K:=?9)`H\< 8c}~dx8K:< 8c}~dx8FK:< 8c~~dx8K:}< 8c}~dx8K:i=?9);`}#KxHE< 8c8/8H)EHA)x~dx8PK:)< 8c~(~dx8BK:< 8c}~dx8K:!0H=?9)a0l  }#KxHa/,@L;7A8;|< 8c88Ha/,@;7@HAa/59)58!0 0X8!0P|ˡ} N |! B|#x|+x|;x= a)|HA< 8cm88KEH(8@8K!8a@xx8xK8!|N |a!@B||x|#x|+x|3x= a)|HA< 8cl8KDHT|#x|3xK`,@L=?9)P }#KxHoݐa,@TxdxK`|ex< 8c@xH'H=?9)d }#KxHoa,@ Hma,A< 8clx8GK7< 8cm8x8JK7< 8cmx8K7=?9)x;@}#KxHB< 8c@88H&uH>Yxx8PK7Y< 8cmx8BK7E< 8cmx8K71< 8cl8KC8+8!|aN |A!B|zx;8 @A|#x;|AP}:;x< 8l88HD!,A x8A88HD,@ ;H;,@|@;xx8!p|AN |!B;@;`AaA a$A(a,A0a4A8aP9)!(a(,a~x88< 8Ɗ(8Hda !| |PH>!H}!9)?!D8a@}#9)!@A@aDAa}7P9)!<}>P9)!8a8Ia < 8k 8H>18 ! H\8a`< 8k88H==,@x,@p9 @(AA (Z@@(aA(zA9 , A8=? :k:@:`:@Aaa88H8a`< 8k88H<,@A,:@,@9 @(AA (Z@@(aA(zA9 , Ap=? 9k9@: :!a88< 8Ɗ(Hbɀa < 8k 8H<8! H8a`< 8k88H;,@h8aA< 8k88H;|~y@H,@@a8@8HP9)!x88< 8ƊP9)!hahla88< 8Ɗ(8H_]!8|2|Pa 8? 8H9M8! 8Ht;@|}|P8c888H8Q,@P8@9!!AaAa!|9`ax!xA|!Ax88H;@|}8c888H7,AP8@8}=9)!!8}>P9)!x88< 8ƊP9)!AaAa88< 8Ɗ(8H]a < 8k 8H78! H8 a8@8H78!|N |А!`B|tx|#x|+x|3x|;x}Cx}9Kx = a)|HA< 8c^8K5H8Ph;|#xKQY|}xX\;h[xa`d8aP8`8X< 8}88H\#x< 8^܀8H688ܐ<~xx~x~Ƴx~x9P)x9AHI8!|N |Ԑ!B|+x|3x|;x}Cx}9Kx}[Sx = a)|H@,A 8'1 < 8c]8K4mH8;7AlW:}>8 ,AH}>|u:|.8c~ijxfx|P~xHKA}> ,A99)9;7@x8!p|N |А!pB|+x|3x|;x}7Kx = a)|H@,A 8'1 < 8c\8K3uHh9@9`4A4Ui:})B ,A9JUI:})i9k4@Ԁ; 6A8xW):}) T:} |2|.8a@88|PH484|xHQA;aW:T:} |2|.cx88|PH4Mcx8@88H3q,@4xT:} |2|.8a@88|PH4;7@x|A$W+:}kKW :}) I;96@8!|N |a!`B|}x|#x|+x|3x= a)|HA< 8c[08K1H|#x< 8[L|3x8H3ExdxxHK-;`x8@x88Hx< 8[P88H29,@hcxxKM!;7AP};;x< 8[d88H1,@x< 8[h88H2;7@8!|aN |!pB|kx|#x|3x|;x}Cx}>Kx}\SxAȂâԂ؃a܂!~x= a)|HA< 8cZ@8K0QHl8<< 8cw}d[x~xx}GSx~ȳx~xjxK5,@,,@<9`4A 9@Ui:})I9k4@H9`4A 9@Ui:})I9k4@;7AD8|9֓8<~xx~ųx~x|:Hx~ixjxHI};7@~x~$xKK),@08!<~xx~ųx~x~xHx~ixjxK98~xx~ųx~x~gxHx!jxK8!|N |a!B|~x|#x|3x|;x<@`BA< 8cXd8K.H8a88|~x8a`< 8V088H+I,@ ,A`,AtxdxKF!|@8ax88H>a|~x8a`< 8V088H*,@ ,@xxex8Ht,@x8HXxxex8HL8a`< 8V088H*,@4xdxKEq,@ x< 8VDex8H+H 88!|AN |A!B|zx|#x|+x|3x|;x= a)|HA< 8cS8K(HX|#x88@9HY,@8a8@exx8Hx8@x8H*]H8!@|AN |!B|~x|#x|+x|3x|;x}Cx= a)|HA< 8cSH8K(9H; KDa ,@ uH 8aPx8 H):9:`;P: 9 a a ;@W<:|~Ha |}8c{< 8Sh88H(,@$8w8|8 8 8 9HDHT ,@H;P|} |c8c{< 8Sl88H(5,@;@}|! 9)+ L! 9)! 9`,A L! | A9`, @4W :9!PJ L,@y|i8c|KB} LW :9!PJ L,@@y|i|c8c{< 8Sp88H'},@= L9)= LH,@ :H;9,AL;9W':|:}B8< 8co< 8o|#x< 8St89|~)x9@H),@$ ,@$~x< 8S~Ex8H'H~x8P~Ex H' ;`7A;P?_ ;ZS; ;}>J9)|! A  W}: L !  ~x8 8 < 8o~GxHL5 L})9)5;{7@ x8! p|N |ؐ!B||x|#x|+x|3x|;x,A8  0 |#xKI|yxa 8  ;;@H8a |~8c< 8P88H%,@$xx8 8 8 hxHAH ,@؀a |~8c< 8P 88H%-,@! | A , @8H0a |c< 8P 88H$,Ah! 8|~*8c< 8P$|HP8H$,A:??;9?+;;H;`W@:} )|.x|8|0PH!x< 8A88H<|{x,@<8a@x8 8H~x8@~x8 H ,@ ;Vx;Z9 ,@|A9 , @X,A=9kV:} Z}K. =?)U):| X.PP}CxQA8??+;9;9:x||{|88H5;{7@=?)~ڳx}vHQA,=_9JW@:} R| .|P ;Z5k@=9k+9)+?;޽,A?;T:}}.|Z,?A<+8c8cx=? 9)Aܑ!tph8da`|k8p8`< 8] AH;E~9k~Uk:}+)}3J})9)}+.H8H,@;;@>:ֽ??;9>+::H;`W]:|.x|8|0PH}=.HPx< 8A88H:!|{x,@88a@x8 8H~x8@~x8 H,@;;Z9 ,@|A9 , @P,A|P8|2|P~x8_~ex8HĀ,@| p}:xIP=?)|HA;`?;W\:|<+88|.x|"8|0PH}<.HPx< 8A88H9|{x,@D~xx~x8Ha|P~x|~ex|xHE8H88!|N |HA8@!|#xE|+xcHk|cyA~8`}X8!P|N |A!|zx|+x;;7A4|Cx888H,@;;7@xh8!`|AN |A!B||x|#x|3x= a)|HA< 8c!@|H@ ,A ;H(;H ,@ ;,@}x}5|A ,A,2,A};P9)1H,A ;H;9 ,@|A,@9 , @,A;9;H;9?;c|@ ; H,A.:9 ,@|h@9 , @48!|N |!B|~x= a)|HA< 8c58KH|?8<c< 8688H -9`}}}}8=?)i=?)iixHـX8!P|N |!!B|{x|#x|+x|3x|;x}Cx}=Kx}GSx!8 = a)|HA< 8c58KHd=?) ,A xH̀= a)|H@4=?򸄞=?)9)|0P8a@|J88H>| P| x9)!Ѐ,A$8a8@8x8K88a@< 8N 8Fxxx9 *xHi,AL=?i+})9) | @ 8 =?) ||Z H<Cx< 85%x8H58=?)8  8!|!N |!B:@:`AaAa:: !!Đa8|#x|+x|3xHLAT`l!\)<`| A< 8c48KH|3x~xK |}x,AaHdK q|~xH; ,AaLhK M|xxH;||,Kx}GSxA = a)|HA< 8c,88KH=?)萀 ,A xH= a)|H@?萅=} HP9)<=?)9)|0Pcx|JEx8H8,Axdx8@xGxKҩx8!p|!N |!B|+xɥ=? I @=? K @=?9)HHɥ=? K @=?9)H(ɥ=? K @=?9)Hɥ=? K @=?9)Hɥ=? K @=?9)H=?9)H=? ɩIh@ =?9) i}#KxHHɥ=? J @=?9)8Hl=? ɩIh@=?9)PHL=? ɩIh@=?9)hH,ɥ=? K @=?9)H =?9)i}#KxH< 8cBx8HܡHX8!P|N |AȐ!B|~x|#x|+x|;x= a)|HA< 8c)h8KH48|;xKax< 8)8H |sy@, A=?9)H =?9)8 }#KxH5< 8cA88HH,AP=?9) 8 }#KxH|cy@< 8cA~x8Hu|cy@dHH\=?9), 8 }#KxHe|cy@$< 8cA88H%|cy@H,A:@8a@x8xH%;7AH;@}<)8 (A$||8 8c888H;7@8a@< 8)8H9|~x8a@< 8)8H||x8a@< 8)8H|{xx|@x|@`x,A 8a8@8HEH,@T,@;8a8@8xH|0@8a`8@|"8|0PH~PH,@,@l;8a8@8xH|0@(8a`8@|"8|0PH~PH(8a`< 8)88Hu:H8a< 8)88HU;H;@|~8c< 8)88He,@P;8ax8xH 8||0P8a`888H~P:Ht;@|~8c< 8)88H,@T;8ax8xH8||0P8a`888Hu~P::@H8H|a8c< 8)88Hq,@;;H;,@H;x< 8)88H5,@$x< 8)88H; HP,AH8a=? ;I)|yx!A;x88< 8A\8Hy;,A\8`=? 9))Б!88ԓ8a@88< 8Ap8H%}=9)!H8a@88xH, A=?9)DH =?9)\8 }#KxH < 8cA88H֕Hy=?9)t8@  8 }#KxH|cy@$< 8cA~x8HM|cy@H,A 8,A ,Aɵ=? I2ٵH8!@|AN |!!pB|}x|#x|+x|3x|;x}Cx= a)|HA< 8c#@8K%H|;xK,@(,~@8a@8`x8 HHlx< 8#\x8H 8,@@xxK,@(xxK88a@88 HIH8H 8a@dxExx8 (xH8!|!N |A!|{xT| p}>xP;;&p|T 6} P, A|{8 0H |{8 W@8c8@88H&p;7@&p|T 6} P,A9>, A8 0@H 8 WAx8!p|AN |A!B|}x|#x|+x|3x}Cx= a)|HA< 8c!d8"K-H8\K ||x8`5|A}= |8c5k@8:80 8i 8a@8exK]8aH8@88HMH 9!H       9<| P}#Kx4A9` }#i8c4@:})8 x8!p|AN |hx8`9@9`9 U`:|.,A|cRUJ<9k5)M K|A!B|}x|#x|+x|3x}Cx= a)|HA< 8c8KuH8\K M||x8`5|A}= |8c5k@8:80 8r 8a@8exH8aH8@88HH 9!H       9<| P}#Kx4A9` }#i8c4@:})8 x8!p|AN |!!B|}x|#x|+x|3x}Cx}:Kx= a)|HA< 8ct8!KH`8\K |~x8`5~A}= |8c5k@8:80 8s cxDxK aaH8a@88HK8aP8@88HP 9!P       AH8`5JA$}#})}{ 8c5J@!H}>J9)| P}#Kx4A9` }#i8c4@9})8 8!|!N |HA|#x!P|+x8@|3xHO},@0H8@^T&,@@8H]H 898!|N |HA|#x!P8@HO 8,@ta8!|hN |!||x|#x|3xH,|x888Hux,A$;8,A8,@8|xX8!P|N }`&|HBАAa}Cx! |ux}Cx|#x|+x|3x|;x}7Kx}XSxHN|{y8A H(8H8z8H88a@HN}xHN58;.cxHM|}yA;8PxHM,AHC, @$=8hɈHDAx<8gɸHDH4HCi#/ @=_8jHTHCMc, ?@=8lH8HC1,AHC!/@<_8bDH <8dtHCH<88ʤxHM,A<x8ʨ8HL,AXUU&ii@} !*|QU0A`Z| @88T:|`],A,x@X|;,@@x::cxW:~.HL8a@HLq8!~} N |!Đ!B|ux|#x|+x|3x|;x}Cx= a)|H@8|;xKq|wxx~xKa|{x,A ,@,8'1< 8c$8KMH8H;; ;;@~X: |@8|x|P8c< 8D88H1|}y@h}=;H\8r< 8D88H |`v,@T|P|ƸP|}||P|ƸPH |`vH(|AD,@|,@(~xx~ex~xHQ |`vH|u|P^P8c888He8|cy@}#P9)| @8H|@;;9H,@88~xx|3xH |`v,AP;xHH|u||PP8c88xH |cy@99;H 6;@,@L8!|!N |HA|#x!|}x88a@HI8,A4a@,A$9!@x8,@8X8!P|N |ؐ!B|+x|3x|;x}Cx}A`,=AX,/AP,,AH,:A@,;A8,%A0,@A(,-@~óx$x8pHju,@!;i|A||P8a`88 8H~Cx88`8 Kj;x~Dx8 8Hڵ;,(@Hx< 8 (8 8 H,A$8a< 8 H8 8 H٥,A8a< 8 h8 8 Hم,A8a< 8 8 8 He,A8a< 8 8 8 HE,A8a< 8 8 8 H%,A8a< 8 8 8 H,Ad8a< 8 8 8 H,AD8a< 8 (8 8 H,A$8a< 8 H8 8 Hإ,A8a< 8 h8 8 H؅,A8a< 8 8 8 He,A8a< 8 8 8 HE,A8a< 8 8 8 H%,A8a< 8 8 8 H,Ad8a< 88 8 H,AD8a< 8(8 8 H,A$8a< 8H8 8 Hץ,A8a< 8h8 8 Hׅ,A8a< 88 8 He,A8a< 88 8 HE,A8a< 88 8 H%,A8a< 88 8 H,Ad8a< 88 8 H,AD8a< 8(8 8 H,A$8a< 8H8 8 H֥,A8a< 8h8 8 Hօ,A8a< 88 8 He,A8a< 88 8 HE,A8a< 88 8 H%,A8a< 88 8 H,Ad8a< 88 8 H,AD8a< 8(8 8 H,A$8a< 8H8 8 Hե,@;,AHu8|s|PD|`8~%x8H-;|y8c< 8hH79)7}:P9)!w}ZUk:P}+T}KX}k9ka8wUk:\}k9ka<@DH8 L8P|Ta088`~x<99)9JHU;|y8c< 8l88HQ;|y8c888H5!;I!9)!7@|A؁79)76}:HP9)!|w}ZUk:P}+T}KX}k9ka8wUk:\}k9ka<@DHv}zXP9kaL8P|Ta088~x<99)9JH=;|y8c< 8l88H98!|N |!B|#x|+x|3x|;x}Cx}2Kx}[Sxax|!!x8!<8@8D|+x|;x}Cx}&Kx}GSx~hx9!9APKѥ,@`,sA ,u@=9)=5}8c|x|t8Px8HA=U):}) Hp,'@p|~8c< 888H5,@\8s=9)=5}8c||ր|t8x8Hҹ}Uk:}k09)+H< 8c~x84H;Px8Px&xKax< 8(8P8PHё,@8l8HH;x8Px&xKaax< 8x8P8PHI,@8l8H<x< 8%x8H],Ax< 8%x8H=,Adx< 8%x8H,ADx< 8%x8H,A$x< 8%x8H,@D8rx8~ex~x'xK,@p< 8c~x82H@8ix8~Ex~x'xK],@0< 8c ~x86K•x~xK…8H8H8!@|N |!B9`9aȑ̑aБԐaH|#x|+x|3x|;x\!`Ad!h!lpatxA89~xHxdx888x xH!cx< 8Ȁ8HU,@x88xdx< 8889x xH9|B,sAh,uA`U:||Ȃ|}8A<@8DHL< 8c88889~Ix~xHH\8!9)!8}=J ,r@ >U):})B H0>}=J ,i@ >U):})2 H~}=Z ,u@Ui:})i8c|{|v8`xgxKU`,A 8iHD>U):})i8c|{|v8`~exxgxK)`,A8rHh|BU:||Ȓ|}8<@8+D8HaL< 8c88889~ x~*xH8!|N |Ԑ!@B|}x|#x|+x|3x|;x}Cx}VSx < 8cXx8KxxKu,i@@< 8c`x8 KU=?9)_;@}#KxH< 8c`DxH,l@L< 8cx8 K ,A< 8cx8H< 8cx8 H,r@X< 8cx8K=?9)_;@}#KxH < 8c`$x8HHyxx8PH,s@< 8cx8"H ,u@P< 8c$x8 K9< 8cDx8K%78i|xU):})|uxH< 8c`x8,K8! 8!|N |a!|#x|3x%} HP%|xHQA4|||"|"8c888H;7@Ԁh8!`|aN |A!|3x}Cx}Cx%9)%|xHQA08~|{||z|"xxH9;7@؀h8!`|AN |!B9`9aܑؑaa葁aa99 ax|}8KxAaaAAă!̂!x88|3x|;x< 8l8t8x9|ixA`K!x9)!xa|8c|z|x< 8Ex8H],@蒁8;x<@8DaH;L!P}{x~x~x~Fx~'x~ȳx~ix~xKm,@H8<@8DaHL!P}{x~x~x~Fx~'x~ȳx~ix~xK,@ xW:!A!aAH5 =H a|8c|z|x< 8Ex8HM,@88x<@8D8H8LaP;T!X\}{x~x~x~Fx~'x~ȳx~ix~xK̀,@l8!x9)!p8p<@8D8H8LaPT!X\}{x~x~x~Fx~'x~ȳx~ix~xKY,@ Ј,i@@,i@4!xU):})9I!}`HP| A9`jH Ԉ,r@H,r@,i@x< 888Hz%,@!pU):})ax|HLx< 888Hy,@,!pU):})9i9@!|x| @Hx< 888Hy,@,!pU):})9i9@!|x| @Hx< 888Hy],@!pU):})|axHx< 888Hy%,@,!pU):})9i9@!|x| APHHx< 888Hx,@,r@x< 888Hx,@(!pU):})|&THx< 888Hx=,@$!pU):})OH@x< 888Hw,@,!pU):})O|&THhx< 888Hw,@,!pU):})OB|&TH x< 888Hwm,@(!pU):})|&THx< 888Hw),@!pU):})|&THW>,l@x< 888Hv,@(!pU):})a|Zx!@| HHx< 888Hv,@0!pU):})a|Zx1`}K}@Sx H< 8cDx8?Kh8H,s@x< 888Hv!,@PpW:8o|x8|!U:}kU:})|u|"Hu |`H0x< 888Hu,@LpW:8o|x8|!U:}kU:})|u|"Hum|cHx< 888HuM,@X!pU):});8o|x8|!U:}kU:})|u|"Hu8,@Hx< 888Ht,@TpW:8o|x8|!U:}kU:})|u|"Ht1#| Hx< 888Hti,@`!pU):});8o|x8|!U:}kU:})|u|"Ht8,A8Hlx< 888Hs,@LpW:8o|x8|!U:}kU:})|u|"HsTc}!p};J8l !p9)!ha8<$@DHAL8PT~#x~x8h< 8 hx~Ix*xK!l9)!d8ad< 8PGx}kxKŀ8!|N |!0B|zx|#x|+x|3x|;x} Cx}4Kx}QSx!  a$,488|3x|;xEx8d8h9lix~ xK͒88h<@8pDaH;LP~cx~Dx~x~&xx(x x~xK,@X8!h9)!`8`<@8tDaHLP~cx~Dx~x~&xx(x x~xKA,@<Cx< 888Hq,@(!hU):})9)9`p,AXHDCx< 888HqU,@8||*8c< 8\|HP8HoU,A`>8||*8c< 8P|HP8Ho),A4>8||*8c< 8T|HP8Hn;`,@܀~|c< 8(88Hn,A(~|c< 8,88Hn,@ ;`H>;9 ;`HX}<;x< 8(88Hnm,@Dx< 8,88HnM,A$x< 8L88Hn-,@ 9 H}<;x< 8088Hm,A$x< 8488Hm,@}<;x< 8888Hm,A$x< 8<88Hm,@L}<;x< 8@88Hmm,A$x< 8D88HmM,@;`9 ;8,@, A8,@cxh8!`|aN |B<EY|#x!P|}x8bXHE8`8@H,@\aL898Uj,8@UIv`!LaHŀx8`HϕL8`8@`8LHϙa8!|hN |!B= a)|HA< 8c8"Kk)H88=?)Z, =?)Z(8 8, 8 @ h8!`|N |!@B|#x|+x|3x|;x|;x= a)|HA< 8cX8KjH8`x;7A(8~|||vdx~xK];7@=?)Vp ,Ap8c|||vdx~xK5;;=?IVp;Z )Vp< 8cdxex8H x< 8p88Hj,A4x< 888Hj,AcxK=,@ < 8cdx8K\cxK^cxH 5~óx< 888HjI,AL,@`;,A(8|!< 8cX|"ex~xKix< 888Hj:@p8c|||v~xK|qx!hAl:x09)}xP;;&p|T 6} P, A|{8 0H |{8 W@8c8@88Hb&p;7@&p|T 6} P,A9>, A8 0@H 8 WAx8!p|AN |!B||x|#x|+x|3x|;x}Cx= a)|H@0|;xK|),ACxdxK|,@ 8'1< 8c8K` HxxK{|xx|~x;H4||8c< 888H`,@ ;H;8,A,@8,@,@,A |@8H$Cx|ex|PH`Q |`yh8!`|N |!`B||x= a)|HA< 8cl8!K_H=?J؄,A<8c DHa8 ,Al< 8cx8KR-=?9) P;@}#KxH]}< 8c@8 8HA HXxx8PKQ< 8cx8KQـ8!|N |Ԑ!0B|xx|#x|+x|3x= a)|HA< 8c8HH=kI+$9)+< 8cKE~x< 88|88(x~ɳx9@Km|,A H,@ <|x,@;;7AL;aP;A;cx8x8KMxdx88H_;7@;x< 888H^,@,@;x< 888H)|}y@d8a`x88H^x8Kx|@(8|28a88 H^]:H8a888HH8a`888H^-,=@8a8KxI,@ 8a888H]:H,@ 8a888H]:H`< 8c$x8;KOu=?9) t;}#KxHZ< 8cL<I8$8H>IHV-x$x8PKO-|A$|8a8l88H]EH`< 8c$x89KN=?9) ;}#KxHZ=< 8cL<I8$8H=HUx$x8PKN|@8a8|"H8a< 8P88H\?I}(Tc(4=?*9)|cJ8`8 8H\;x8KvapU:=?*9)8880|H@||>8B|/@H>|H8@ H 8aX8!P|hN ||~x!|#x|+xH}HcC,@8`~H08,Ax8,@X8!P|N |!B|ux|#x||}/Kx}NSxAA!AĂȂ̂aЂAԂ!؃8=? 8 =? L@A=? LA@<8cHHH,9)( @<8c\H,,8"9)( @<8cpHb8,| X@}i[x8 | x9)!59)( @<8cH|1ց0| @<8cHT<:| (A | @<8cH|T<9| A | @<8cHT9|H@!}P}FP|Q֐ :}%HP9)y}dXP9k| Z})Y֑! | ֐|2}h}k:|Q֐| x9)!|X@a|A֐| x9)!!})B9)a }kIց!})ցP|Q})})U)<}kJ}kB}@R! |X@<8cH8! |P@<8cH LA@<8cH LA@<8cH܀9`4A=? Ui:A})R `L@AUi:}I})R A @<8c8HtUi:}H})R A @<8cLH@9k4@t,@4| (A| @<8c`H}PT:}) U:|.|;x}G@QA,U`:} }. L@A9k5J@܁2| A| @<8ctH}FPT:}) U@:|.|3x}FPQAdU`:} }. L@A<9k5JA}$J}bHPT:}@:U):})Uk:}k ($} B( zѩh(2}.85@8B4@DN ||@&HzQLA!aHLPTX\̂a!L}sx= = T= ˒(= «t= ‹8ê!hi!lI!p !t !9)! | x:!|)!4!)!})i}8JU):})ZI;4@;5@g9 !05HAA09*a@}I[ր | "| Y}`HP| | ~Z0T:}):,AW:\}=BAX}=R 2aP|Za88889PK]Ta88889pK9; 4A<9AP9x}kq}|ZUk:}k*W :})R ;4@;4A89AP9x}k}|ZUk:}kW :})R  ;4@Ԁ;4A$~+x9@W :})ZI;4@8; 4Al8PW :})"|+x;4A<~(x8P9JUK:}kBW:}):  2 ;4@|;4@~x!;79A= :W :}) AV:!|J8a888Ha8a888H$!|HAl;@8|xHQALV:;ZW:|8|1T:||8a888H#;7@;79@8h:W:})*KL080H5H@=? Ȁ;4A0aW :9)| L.L@A;4@Ѐ;4A0aW :9)| L.hL@Al;4@a܀88~xHYĐ;4AA܁aW :9)| L.$| M.;4AdK!Ā||J|$| A<;5IA؀W :}i*})2 ;4AH9>}i!}xZUk:}k:})i}8JU):})B ;4@;5J@!9I}*8̐8U):L}):9)!<@UI:}):9)!Da88Ȁ9~x9AH;4A(aW :9)| L.$| M.;4@䀁h*,@!H ,AHAax (L@@ L@@HAL!| A8;,4A,9@W :}izKa})ZI;4@804APT09%a@}I[8 | Y}`HP8}+"9)!| ~ZT:})*,AH=? i~x;A 5jA|98})q}})}}i!}xZUk:}kB})i}8JU):})R ;4@ȁ!9)}>Kx| QA4a9@9>})A}8JU):})ZI;4@;4@HA|x} Q!TA}P;A(5JAXA= kȀ;4A$~+x9@W:})ZI;4@;4AD~*xW:}kR9=})!}/JU):})* 2 ;4@a8|~z~x0QA < |PA|@|x@,@HV:|B8a888H m8a888H,A;7APV:;W:|8|1T:|"|8a888H7@;5zA$~*xW:} R| . ;5k@WI:.:79@;X4X@4;T4T@A,|x(|(Q\A }P;5`A=? iȀ;4A$~+x9@W:})ZI;4@9@;4AH~(xUK:}kB9=})!}/JU):})* 2 }J;4@a|P|~~x0QA < |PA |@|x@,@HV:|B8a888H A8a888H,A;7APV:;W:|8|1T:|"|8a888H7@;5zA$~*xW:} R| . ;5k@WI:.:79@;`4`@(;\4\@< Ȁ;4A0aW :9)| L.L@A;4@Ѐ;4A0aW :9)| L.hL@A8;4@a88~xH%ĐH!āa| Y|J|Z$$|(A89I}*Z8̐8U):d})B9)!<@UI:})B9)!Da889~x9AH );4A(aW :9)| L.$| M.;4@䀁D805A(09'a@}I[| Y}`HP| ~ZT:}),A< d~x; 5gA|98})q}})}}6JU):})R ;4@؁a+U):})96a }9Kx~QA,=? pa YP|@~:x@AW=:!|J8a@88D8HK8aD8H8L8H 1,A;7zAW7:~Xx;W:||T:!|J|ƺ8aD8H88HW:}) x7{A})}6JU):})R ;5k@:4@; a:4A؀܀aV:8 }. L@A;9W+:}Kr})" 9k|.|].:x;`~޳x;|@~| @~)x~ʳx; 4 A@a9JUI:})r }9}6JU):})Z lX<;94@V:8 |.})r `$ :;5@h!h$a+, A;5 AW:})r `9>| @~)xx; 4 A@a9JUI:})r }9}*JU):})Z lX<;94@W:8 |.})r `$ ;5@l9@!:4A؀= kwV:9)}L. @9J~ܳx! |@|x}[Sx9v;4Ad9kUi:9)|L.hL@A49>})}+JU):})B Wi:})r lX:;{;4@V:a})ZX :4@4=? IwЁa :5A؀-V:8 |.HA})" `! }6P| @~)x, AP;4 ADA}vUi:a})Z }>}6JU):})R lX<;4@V:8 a})Z|.h2 X(X(LP::5@<P!h* 8!|N |B}H|=* g0hA@HP(-2f P(r2!X(!`$H``(rlh(k2(2#)2G 2!z r k2ZzB!h$ P=* g0hAHN e 2zѦ2kcxeN |B!HxHH1<c HveKA8`Hv99 9`|t8/ +  |@A4A@8c9"Ј9k|t/ 8+  |@@8c|tK/@ |p|@*x|P|p|c8N $N |B8<<==_=?<_= 4 0 ,J () $B k   |N |B|zx|#x|+x!;`??*/@tH] 9<<T 6}i.|J+$A<_Ui:8Bp| .|| N ld\LLTDDLLLLLDDDDDDDDDDDDD+!}i[xA<_U):8B,| .|| N P<0`<9 KX9 KP9 KH9 K@9 K89 K0=?<_) <B <c 848cHx=?) I/Ax<_B THtU8d8`d8!`|N } <_B x8+9)+K} <_B l8+9)+K} <_B l8+9)+Kd} <_B p+9)+K@} <_B t8+9)+K} <_B t8+9)+K=_ J <_g*B 9k9)U :g}.*K<_=? ) U:|I.8B/|I.@=_<_J B j U`:9k}".j9)(K\/<_=?B ) 8E} K A<_B /A<_B |B|IN!,AK/A= I8BIK<_|+xB B|IN!/@Ё= I8BI;{A8!`8`|N <_ <_ gUj:|J@./@/A$=?=) 8k 8@)|+x| A.xK})%xN!/A@h<_B " /A<_B THqE88`K=_ J <_g*B 9k9)U :g}.*K<8`d8XHK=] k 8*K9)8B*KKP= 8 I8BIK4<_B B|IN!K<<8`8`H8`K$<_B "HpU8!`<8`x|H|888!8a88Ke8!P|N |B|yx|#x|+x!8<_<<_*;bˌ8c<8|3x/+U= 6A48 ^ =.8!p}#Kx|N <h8Hoy8<_BbH<8!p^ 8 =.}#Kx|N |AB|~x!/ @/ A/(;8`@?_ZЁ"9)/"A8`88K/A /AD|x/ @~/ A|itx/)A+xx;a8;A8<_U):8B| .|| N t@<PDDDDDDDDDDxx<_B" /AHl58d8@/[@X8@8x;KU@|}x88`8K];|Bt9"+9A<_U):8BH| .|| N h pdXh pdX<_xB8P8"9)"KP|~x88`8K|dy8`A xKu|~yA0/ ADc|`t/,AP/)A/@8`/A08!A|N ~/ @~/ AK~K<_B̐KL;;x8<8K-|}yA]|Bt9"+0A<_U):8B\| .|| N \4,\4,8888`K;a8KD8888`!KK8` 888K<_*Tc 68Bʤ|c8^~/| tA}`[xH/A|tH@|tHAK8888`K1KP|t/lAP/LAH/rA/R;A8}8<8K-|}yA<x88;KK|t/sA/SA/pA/P;Ax888KK8`888K;|t/zA|/ZAt8888`KEKd8888`K-KL;x8D8KQ|}yAD/A(/.A8H|t/EAt/eAl0||cDTcH8c8KK;; x8D8K|}yAD/Ax88/.@Hx8D8K|}yA\D/Ah/.A8HH88`KKhx8D8KE|}yAD/A/.A8HH88`KK]/ @]/ A8+ Ax8D8KՀD|}x/A888`KyK;#;$K; ;"Kx8D8K|}yATD/A`888`K)Kt8!8`A|N 8}8H8K9|}y@ 8a8KXZЁ"9)/"A 8`888K8~K\<_8B88`K8~K8KxHA4^B |B8BА^| N!//|`x/9A=?<_)B영)})N!<I8|BxTC8!P|N |B!=?*9) I8BI|t/A8!P|x|N =_=*=?<_*J>?*pP91 8@8`8I >i:@X:h; :`~׳x~۳x~x| ;N!/+|~xA$/-A0/0A\<_L<_XH;{| N!|~x+W:|@@AD4pA8A;9K<_X;| N!/0|~xAK|&Tk*!"|I|I9A`x @|19|I|y@@/-A[~óxH]:`<_.B\~׳x~۳x~xb;X| N!/+|~x@䃽N!|~xKؘa@:A~x;AiN!|~xK<_<B88p"iHrm8!|} N /.A<_|P;}>;@IpI@/A p@@=?<_)TxB)})N!@@Ќ;/0@;9/0A.@;~óxH\qr@<_BH"A|P@/@/A@{@AW:@8 |Bt8B|Cx|BpGgA\8|;x|P| 8 W:}h|Bt8B|Cx}|Bp }gZ}L}+&FB79AD<_*;98B )b9 },@}LA }LSx} J}+KxB"B@/-@9q +K j|IKkH/@UXB|IN!|C|~xpA /-A4UXB|IN!|~x+Ax=?W:)L|BJ4pA\<_?X;}4Kxc| N! +Tb:|~x} |BA4pA;@<_<B88p"iHoK,/@X| N!|~xA <_L<_XH04pA@;9;{| N!|~x+W:|@@@K=?8@)H8`Ii/APP88`K|/,A//A/A,k @|k !"|I| y@/ A<_BD/@<_8B@8`K<_<B8(8s"iHn]K/0@;;9| N!|~xK<8{88%xHNKd;@K<_<B8@8p"iHmK/A =PK9K|B|sx|#x!`|+x|3x:/@>Uh/@<_Bd/@>W℀/@8<_?Bx[ B|IN!9#|kx+0A<_U):8B| .|| N \<_=?B|}c[x)B|IN!+Ax<_V:8B| .|| N XX88  <hX8<<DW8`/@/@?H| N!/ A/ A/,@W℀/@$<_=?B|)B|IN!Uh/@<_}/@<_Bx/A+A<_V:8B| .|| N H(hhH<_B؁" /A8<_BԀTHH88`8!|N W8KUh8K<_*8BH"B:} SyZ@<_Bp"Hz7℀I/@ 8 ?Z>lI/A 8 :A08!8`|N HT/At}HSHG<_B<8x"iHiqK<8`8xHfK܃8`/A?>;8Px)})N!/(|ixA ?^l/@8+ A }#KxK/A <_Bb/AHSi/@<_<B8ր8p"iHhK샗8`/A?>\8Px}/@T8`; HG|~y}A ?[ B|IN!+|}xA=?Tb:)t|BJ4pA8А;~;H[ B|IN!9#|}x+0A,<_U):8B| .|| N                                           8`8KE,A<<_BԀTKX8`8K8`8K ,AK4<_Bp١8<K<_Bp١8<Kd<_DxB\~ExbHKH<_Bp١8<K(<_Bp<_B`K<_Bp<_B`K<_BpK<_BpK+A t=?W:)t|BJ4pA X;W;") })9)Б"@l\;<$x}HO/}ApKD<_=?B|)B|IN!78px8@ 8`8KK@w℀ /@ <_8Bl "/A(<_<B8֐8p"iHdK;;A[ B|IN!9#|}x+0A<_U):8B t| .|| N <_=?B|x)B|IN![ B|IN!/'|}xA4/"A,=?8I|C"q @$h` 1`|K} 9@/A<_Bl/AԘ~;;Kd?>80x8@I| N!+|kxA =?Tb:)t|BJ4p@@/.;A/TAA/FA=?8I|Kp@T K!"|I| yA<_=?B|}c[x)B|IN!8`Klpx<_=? )\<_=?8 |t; H| N!|}xAqK<_=?B|x)B|IN!K<_B؁" /At<_BԀTH>88`K/fA/t@ <_Bl/@=?<@?)p8`8Ii=?Px=?;ɡ| N!|Cp@ /@<_=?B|)B|IN!K8?<_=?b;| N!|CT/@???Y|8B|IN!^l8`8K|iy@XPx/AX>?=?Qpi<_;| N!|Cp @/,@d<_=?b;| N!|Cp @Y|8B|IN!8`8KA|iy@Px/A8<_=?b;| N!|Cp @/)A(<_<B8ְ8p"iH^K<_<B8ָ8q"iH^]K~ N!88`K}#KxK|=?<_)|B)})N!Uh88`KH | N!/*A4<_Bb/AHHi/@<_<B88p"iH]K<_Bl/@H=?8@)pK[;B|IN!|kxKK| N!/*@hN!|kxK<_Bl/@<_=?B|}c[x)B|IK샸\;<$x}HGe/}@L<_<B8|8q"iH\KN!/(@xK<_=?B|)B|IN!Px8 9 8`>K<8`8HY8`K}c[xx8@K/Aa@Kt<_<B88p"iH\ KP}c[xx8@KM/@KhX\KtY|8B|IN!8p<_<B8"iH[K<_<B88p"iH[Kȁqp<_B`9 9@l8`<_*8BH"BK<_7℀Bl8@I/KT<_<B88p"iHZKD|Ba|~x!?/AH\A<_π?+c0=?=)<_k}G2T8B48IH9@ A|0.=?=<_/)kp8B ] A@\T=?)D8`b K/IA8!`a|N 8`8H!/A/ATH78f8`fK/A 8H78e8`eK<8`e8<]HV8`eKl/A([TH7y8g8`gK<<8`g8DHV8`gK$<8`f8DHVi8`fK |B|~x8!==?<_kd)lBp  K,@?=]x==_=?<_͠(k/Jʹ)ЀBͰhbji@l=xI$/@<==_==?<_8`؁Jȁk͜)B͘jI8!P|N |;xHT=/A/A8<_B TH5|}xH5H5cKH5݀c<8lHTH5ɀcK<_B$" /A,<_B TH588`K@<8`8lHT8`K(|B8`!<_˨]$/@<_˘~HA%/A8!P|N ~HA8/8`A<_=B $K|Ba8`!<_=?B8@)jI $/@P<_}[Sx<_P;K/ /A<@~H@/A[$8`8!`a|N 8!`8`a|N |B;;c!<_ʈH 7A0|~.|^;0/A(/AH?7@8!P8`|N |Ba||x!<_BɌp@/cA|<_0b|./AT,/A\/A|t/DAd/dA\(/A/@p88$8!`8`a|N <8`8HQKT~H2~/AH?~H18K|}.H2q~H1KxH~Kl|B!<_"` pAL<_*T8b C/@08C|}x;x;Km/c@8!P|N |(P98}D2(@DP@|#x}cB@, 9)K P@|t9k|Bt@A8hN 8`N 9(K܃;|B|kx|;x!|#x|+x||x|;x9@$ˡ|Ѿ2ˁN !(!2H3PP8!pˡn|-.>$ў2ˁN |Bہۡ|#x <_ ɢ||x|+xh!@H2}=! 8H2%: H+Ir H+8!p!rˁ|ˡ<N |B|~x!?_t/AHG==_=<_9 J8kxB"(*+K|}yAx8!`|N =?0??<==_=?<_續kJX)|Bغxỳ |.|B|#xK/A`<==_==?<_纠{TJhk)pBjIK{<<(<==_/==?<_l{PЁ{LJdk{H)TB\ j @T98`I$/A8xI/AZtTH"88`KxH@/A/A0TH"U|}xH"MH"AcK4H"5c<8HAMH"!cK/A<TH!8d8`dK<8`8HA8`K<8`d8H@8`dK|B!??=I$/A8<_=?B8)8!P8` |N ^bH-I/ /A@]88!P8`"<_ $=?B8) |N |!K)8!P8`|N |B!K8!P<_B" $h0@|b8c|N |B9`!<_]$/@|<_¶~H,5|khj 0 |@Y1j| Q|\9/ |kx@\A]$/@~H,q9`/AH]8$9`8!P}c[x|N =?8!P)}c[xI|8BIN H-A9` K|Ba|#x!??*v`8\=?A8IvDAT<@ivDH 9|}yAp>v`x| @@ | P| 9)8BB;v`8~AH 8!`a|N 8 vDKh<8`q8H=K|aB|+x||x|#x!%/AH<_ BuX8|x@H<_}#KxB=?)ut|xb}%Kx+HiM8!`xxa|H=(K><_ B}#Kx=?|x)utb}%Kx+HhK|B!|~x!??/AH@~<_B8+cA=?k0)4<_B;A@| H.J/A~/@H~ /A$8@|t/zA/ZA] 8`8!!|N ;A@ ExHhCx8PHhɀ@ APA^8>8a@ADH!@K,@^ 9 /A|t/zA/ZAx^= /@H>/A |t/DA/dA 8~/A` ExHgE@/AH>88@/],$(AI|Bt9"+%A<_U):8B| .|| N |t/fA/FA8K9 K<CxtH/AHCxH 8cH/}ADxH)1^/A0|8<_c;btT:|.CxHy,AȐ}H=8 }CxHfA/}A/A0/@^/A|t/aA /A@}888H'/A/AYTH88`K<8HCxHQK<_W:8BtCx|.H,AD8K}888H'mKX/ATTHM8e8`eK08@] K ]KCx8H'/AD/@Hxc<8TKeHcKCx8H'/@/AYTH88`K8<,8c\H'-|{yAcxH/A<dxCxH&Cx<8dH&CxH&/AH&e/AP/AЀYTH88`K<8`e8TH7%8`eK/AYTH8q8`qK/AYTH8k8`kK/AЀYTHu8l8`lKX<8`8TH6}8`K@|.CxHA,A88@(]KYTH|}xH HcK<8`q8xKU8`qK<8`k8TxK98`kK<8`l8TxK8`lK<8ctH%5|{y@ <_;b|K/@THqc<8TH5H]cKH<8`8TxK8`K,<8`8TxK8`K|BA|#x|{x|+x!`;@<8xH8PxTXH /<_k{ `8a\`/8aP8BA <_8BܐAd<_8BA <_8B?8palWAhcK8!A|N |B|}x!<_=?«)l~}$KxH}c[x@,<_8 Bl 8!P|N KY~<_8!PBl 8 |N |B||x!<_=?BɪB @ |Dx^<_8dBkl@/<_k"A !;8<_H~;|ctH倜xH!xH1@A8!P8`|N KUK||Ba|~x!<_Bp@~/@8;+c@>p|x/`PA01`|K|9@1|| |8yA8 ^/A/A0|T>/A$<_<B,`|BP|B&p|B֐I^/A(/@/A(/A8 /A /@(/A|/@(|T1$|I!|K9A,/A /A<,8cH]̀0/A(/A/@<48cH]8/A(/A/A<<8cH]m@/A(/A/Ap<D8cH]=H/A(/A/AP<L8cH] P/A(/A/A@<T8cH\݁~X|1+|IYT |@H9A  \0]|| H9A0/@$|H|x|pH`8`|T1$|I!|K9A,/A  /A<d8cH\58!p8`a|N <_0B,K;@ x;H[x8@H\I@<_|}xB,89`9 H 9)0A|IR9k/ c@| P./A؀ @@|\xK<8`8H/K`/9 A/A9 "Kd<8cH[AK ,<8cH[-K`8K耾$H[KT<8cH[K($8a@HZK<48cKD<D8cK<L8cK<<8cKDT<8cHZK|BA|{x!<_Bp@|+cA<_0|~./A<](/A0/A/@H888H8$8`8!`A|N <8`8H-KxcxHZ|~.8(K/A$TH%8e8`eK<8`e8,H--8`eK/A$TH 8j8`jKT<8`j8,H,8`jK<|Ba|}x|+x|#x!<_B?[|)ց"jI|Z @ /@<_B/A`<_}CxBxxH ,@p[}(րA@A\8`8!`a|N <_xBx}CxH 8`8!`a|N @@|@P|c8||cH8`K<_B" /A,<_BTH Y8n8`nK<8`n8H+a8`nKl<_B" /A,<_BTH 88`K,<8`8H+ 8`K|B|~x|#x|+x!<_B/Al=?)4<_|!րBxiB|ZP A<_BH A8@@8!P|Cx|N =?)x<_|)րBi|Z H )8!P8@|Cx|N <_Bā" /Al<_BTH 8n8@nK`<_Bā" /AD<_BTH }88@K <8`n8H)8@nK<8`8H)m8@K|B<_Bx/A|K0|K@|B8`8!<_4<_Ÿ܁<)/A`<_8BP|@HPAD?|Ex$|Dp}H}}HU\|x|pH]|`#y8`@8!P|N <_<B8$8`ȁ" /A$TH 8Ȑ8`KH(!8`K|B8<_Bؐ|K|Ba|}x!?۞/AH+}9+cA4<0(?=_<|8.==?=/J8@|:)8kJ HEA<_B<i/b@ /A/A ]/@D 8B8||H\8`$8!`a|N |ex88`Ke/Ap/AxTHY8h8`hK/A 8H18e8`eK<8`e8H&58`eKh/A[TH8f8`fK8/A[TK\/A[TH8r8`rK/Ap[THe88`K<8`f8H%m8`fK<8`h8H%U8`hK<8`r8H%=8`rKp<8`8H%%8`KX<8`h8H% K|B|}x8!<_B K,@h<_B " (}#Kx/A`H"E/AT/A`<_BȀTH]|}xHUHIc8!P|N 8!P8`|N Hc<84H$-HcK|B|}x8!<_B$K,@$<_B8" (}#Kx/@8`8!P|N H"/A/A8<_BTH]|}xHUHIcKH=c<8,H#UH)cK|B|wx!>t0p<_<_B`@+cA/AL|./A؀$/A܀(/@H/@xHa|#x|xx|p|xx|xHW9 |`#yxx|&T| x||iHS8|#x|xx|x||]|"||H 8`8!p|N <8`8 H" K88`KK88!p$8`|N /@888xHx888a8HY8x8| x| p |HYKL~xHN}xH Y/A/A<TH!|}xHH cKx:H:|zx|#xXx|#xyAT/x#xAA8@8`@#8xx%xxH=xA@@@@8Hx3H u/ xA@A@AԀ/ATTH588`K /APTH 8e8`eKHc<8dH HcK+@AK<8`e8dH8`eKHA|#x|uxK4@~yAx~x~ųx8HyKl/A<THY8j8`jKD<8`8dHa8`K,<8`j8dHI8`jK|B|+xc/Al<_B@X<_Tk:B8P"|KH.@(/A@8P8B8A|N 8<_P8BK@}EPP8 }I8B|N |B=?<_)|BiN |!K8!P|cTc|N |!K8!P c|cTc|N |!Ke8!P8|xT|N |!K18!PTc|N |!B8`HW<_)BoLC<_B<_B<_)BoTC 8<_)BoP/A 8X8!P|N |B}H|<HHE<_"I,/@ <_8BHa@@"<_BH/@ <_BH=?)H@H<_B"/A8<_BHA$<_B }N!8`8 HK<_B /@<_B }N!<_BI@/A\<_B /AH<_BI=?)H@0<_B/@<_B/@H18`8!0a$}c K0|!B8`<_Bp/@<_†pK5/AX8!P|N |!KKKX8!P|N |B}H|8@W@1@x8``c+@CxHMTb H <_B8WB:|B4|b8/A4WC>+@ HH$<_B8Tb:|Bb4HCxxH<_B4?08?;ED` W@8<_BE8<cE@|bDx}N!|{xT8<_BEt/@؀<_B,A<_EHH/@@/@XH`WB8|B/AL<_BE,/@PHـX8!P|N |ؐ!B?;>}<8csx>}H<8cs|?}Hu<8cs??}Ha<8cs?_}HM<8cs?}H9<8cs?}H%<8cs}H<8cs}H<8cs}H<8cs}H<8cs}H<8cs}HŒx8!p|N |!B<c|K<c}(K<c}KX8!P|N |B}H|8|cyA|t/Al<_o`H~>/AP} t@|t@4| N!,AL/ @8` ~>/@8`8!`a|N <_BoB|IN!8!`a|N ;@<_bo`H;b@| N!,A/ x;@8` K=?<_BoIoLc*|@| HP@|8`JK4<_BoL8!`8`a"|J|N <_#Bo8!`8`<_BoLa} HP9)|"N 8` K}&.|Bؑ|#x|xx!|+x|3x;`;@4?]lB|IN!,/ A@;.@/A/A/A䳘A`7A(?l| N!,A`7@H!8!p8s8@s|Cx} |N 8!p8@|Cx|} N 8!p|bx|Cx|} N KT/,:ADA,/ A8/+@$H4K(xK/-A8+ A|x|p;.A<_=?llHD|Y)p|hx|gp|}|I||y|@Z}C@}"93i;.A| N!,8/ + A@@8/A(p|\|A}9||||@J|[x||xKh`, @|hb !"|I|IyA ;./A#{K;.K:K|B|{x|#x|+x!?\jD/@8>|^xjX| N!,À^8B/^A܁)94Ep;` 0/A|/;x::A<_)jX:Ep| N!,Alh`, @|hb !"|I| y@|V}; ||xA/@/@<_}~P8B,X8 "|p*x\x/9A|Y99B@ @P8@IJ;}JBB/8@AX@|W<P<_)8Ep~;|G}'X|Bt8B9)TB 6|BKxJ}JBB8@|CxK$#xEx8K >x@h;@|>sjXH;b@`| N!,A/ x;@8` K;=x@@>jXH;b@$| N!,Al/ x;@8` Kȃ/@4>SjXB|IN!,AP/ ;@0/@H8t8@t|CxK9@>jX}{x}{x;hw::\|IN!,A/ ;1=|I|&T| 9@/+AT/-A<@/;A0SjXB|IN!,A/ K?^j|@ZA|<_Bjx/@@<_)Bj|J>j|jD K|8@ KK<_BjB/A/@<_Bj0" /A4<_Bj,THq8j8jKDQ;@,>sjX| N!,At;A;@>jXH;b@| N!,A,/ x;@8` K<_;e;|tH8| ];|Ct/@<_;e;|t/A<<_)9"Ep8|CJ | ];|Ct/@K <8`j8^Kq8jK$|Q| @8 ;B8`KX;o;x/ASjX;B|IK/0A / @p<_Bj /A;{/;AhSjXB|IN!,@|bx|CxK|А K<_ Bjt8|x|pbHmK/0A@<_Bj /@<_BjH(/;A؀SjXB|IN!,At+A =?Tb:)j|BJ4p@$/ @<_8`0Bj /A@@Hx;K<_jX/;A| N!,A/0A/ K(;{KH8` /A|P;/ A /,@D@@<H ;{/0A|Q@Px}{xH!/A8@KH8u8@uK$@~xx@ |^P|I; 9JB~xK/T;AHA/.@/;@/ASjXB|IN!,A/T;@8/A/A/;@T<_jX| N!,Ah` @|hb,!"|I|Iy@/;A8@K/@>jX| N!,A07AKq`A8TEp7;}"8@9)*A}JBK`/+:A/-@0:/;AXSjXB|IN!,A/ @<_jXH | N!,A/ @/;@H8s8@sK<8@ɡhK/.A9#+:Ap<_U):8B | .|| N \P Ij ;}s[xb1~~~H/ @/@h/;Ah>})N!,A,+ATb:|B4pA\ 8|B;A8| 9AKt8`0K{K|B}&8|~x|#x<_!8B|+x#2;@/A$|yx2;@H/@~@|^PT6|B|TTB<;@P/@(>zx[8`*| N!7Z@8!p8`܁|} N Q@;{>A$[8` ;{| N!@7A$<_[8`0| N!7@T 7A|<_=?[;H ~T>|}|ct| N!T>|}|ct| N!@8!p8`܁|} N <_7[T>8B|b)|ct})N!A~KT/|BA!A/Ac7;?_@$Y;8` | N!A/A0ZY8`TB|IN!8!`8`A|N ZY8`FB|IN!8!`8`A|N cKl|tK`|B!<_=?BXЁ)X/8 @/A@@`<_=?BX Xb( }I@<_BXbHA<_X8` | N!7A8`8!P|N /@<_=?BXiXB @D} A|PKQ@<_X8` | N!7AK<_X8` | N!7AK`@\<_BX*}~JAl<_BXH@"jK(=?<_BXiX+H@"<_})BX/+|@<_BX" /A<_BXTH8n8`nK+KXAL<_| XPBXQh"|J@l<_X8` | N!7AKH<_BXH|K,<_BX" /@P<8`n8LK8`nK<8`n8TKK|B!9%+ AP<_U):8B8| .|| N \00000@<<cTH8QL8cHí8<_BUĀbKy<_BVB|IN!8!P|N <_#BV08!P8`<_BUԻ} HP9)|"N <_BUԀ/@<~|t/A@<_U|ct@|t@| N!~/@8`8!P|N <_BUԃ/@/;A<_U};|ct| N!/;@8`K=?<_IUԀBV0c*||kHP@@8` K\<_BU8!P8`"|J|N j8`K K,@XKK,@HK0/|B|#x!AT/Ap/At|x|p|3x888xHux<_BIԀH/AH8!`8`|N xK8!`|N /A$THe8e8`eKH<8`e8T>|STi>|@Q|x}!}b8PU`| Kx@@@$}k280@A@@@ 8}k2}hXPTi>| S|@Q| x}!|XPT|Kx@@@ |29J0@A@@@9JT| SxH/@ 8|3|4/@|8PT>9TĄ>H |P0|,0TĄ>},#|b,0|P0|xT>|cP0T>x|#x|I!}%Kx} }B`PU@| [x@@@$}J280@A@@@ 8}J2}HPPT>| |@|x}|BPPT@|Kx@@@$|B280@A@@@ 8|B2T| ;x|P|#Ti>|@!|x}}b8PU`| Kx@@@$}k280@A@@@ 8}k2}hXPTi>| #|@!| x}|XPT|Kx@@@ |29J0@A@@@9JT| SxH08@9 A } 4/@ @@A0@9 A9 H }P0|,0|,0|Hx|b,0U>|P0},#|xU>|cP0|P0T>|I!}>Kx|}B`PU@| [x(@@$}JB;@@A(@@ ;}JB}EPPT>| #|@!|x|}BPPU@| Kx(@@$}JB8@@A(@@ }JB8W}EPP| ;x}i0P@| 1AP@@@9)9/!aA |caN apt!p; /@!D}#; !pAt/@Aa!C}"!A;Ap/A@P@@|4/A  }B0|0|0|Jx|0TDŽ>T>| ;T>|@9|x}}bPPU`| Kx@@@$}k280@A@@@ 8}k2}hXPT>| ;|@9| x}|BXPT@|Kx@@@$|B29J0@A@@@ |B29JT|P|Sx;H/@ 8|3|4/@}FPPT>;Tń>H# |0}L0Tń>},+|0}@0| xT>UK>~x|0|+x|I)}=Kx|}`PU|[x8@@$}2;0@A8@@ ;}2}@PUI>||@| x||B@PT@|Kx8@@$|B29J0@A8@@ 9J|B2W|Sx}GP| +T>|@)|x}}bPPU`| Kx@@@$}k280@A@@@ 8}k2}hXPT>| +|@)| x}|BXPT@|Kx@@@$|B29J0@A@@@ |B29JT|P|Sx/A|08@ĐAHP@@ 8A;H}4/@@@@A0@8A| }HQ8|x/;ADđAH0# }0|0}L0|Hx|0U>}B0},|JxU>UK>|0|0|I}||@| x||8PT|Kx(@@$|B9@@A(@@ 9|B|8PW|cx|08@|E1A8@ @@}&|8}"Kx/;A,}" }@9}"0}@0}I0|x!/AAЀa!C}"!БAԀaЀԻ!N |!B|ex<c;T8c<88H8`H1|!BH|~y@<8c8KxX8!P|N |!B/A HH |#xHY|~x/@<8c8LK9xX8!P|N |!/AH1X8!P|N |!B|~xT`>@HT`1@@+@Hp`H <_B<Tb:|B4p8`/@8;<_B/A <c xHq/A;xX8!P|N |!BH^QHH]H%<_B<T$<_B;/A<_;H/@8<_B<<c@LT@1@D|Ix+@HT`H <_B7U":|B4T/A;xX8!P|N |!B;Tb>@LT@1@D|Ix+@H%T`H <_B7$U":|B4T/A;xX8!P|N |!B|~xT`>@|T`1@t9 a)+@HTb H <_B6Tb:|B4}"8/A4W>+@ H=H$<_B6Tb:|Bb4HxX8!P|N |!B|~xT`>@tT`1@l+@HT`H <_B5Tb:|B4T/A4W>+@ HH$<_B5Tb:|Bb4HxX8!P|N |!B;Tb>@TT@1@L|Ix9`ak+@H-T` H <_B54U":|B4}`8/A;xX8!P|N |!|}xH8cKxHX8!P|N |!B|}xH<_<_)8<_B4`X8!P|N |!B<_B<8`/AT=?)<<_)B4| |t/@HKH(=)9k4+<_B<|H9)+|tX8!P|N |!B8` K=?)9) <_)BC<_BCiX8!P|N |!B<_bL/AH1=9kL8 <_)8BD=?)9)@i/A   H<_BL/@<_B3tTfX8!P|N |!B|~x<_)B 8B=?)9) AT?); /@8 8`KaH(?); <_)8B 8}K}=)9k K=?)9) IQ9JKI8|QX8!P|N |!B?); ~/AH88<_) <_) <_b/AH}8<_<_)8B Đ<_B1T$X8!P|N |!B<_B1TpAK8`Hl<_B1\/A4?); ~/A,H8cK倞H K!H<_)8 ,<_B1T`8`X8!P|N |!B<_B0p@K8`HX=)9k x+<_B0} HP9)+<_)B h8|I<_B0T$8c8HX8!P|N |!B|~x<_)B /@KQ<_B0pA0HQ<_)8B ؁"9)"<_)B 8|IH@/;A4?); Ȁ}H]8cKiHK/;@8`X8!P|N |!KqX8!P|N |!|~x|#x|+x/AH)xxHH8`X8!P|N |B}||jyM 8 +AX} t@U 1@|+@HiT`H <_B)Tb:|B4T|p|@x|P|@@8|{+@ HAH<_B)Tb:|Bb4T`H |T|||t/@;H/M@ ;H0/C@;x;}{}it8/?AUc>H@U`1@|+@HT`H <_B)Tb:|B4T|p|@x|P|@@8|{+@ HYH<_B)Tb:|Bb4T`H |T|H9>+HA<_8BDU):| .|| N xxxxxxxxp$08@HPX`h8|Hp8K8K8K8 K8 K8 K8 K8 K8\K;;|[|Ix8B+A9`W8} t|B;;};8 +A/9k@H;9`;<_B)pHdW 6|[|Ix8B+A}"t|@;H8|[|Ix8B+A}"t|@;H|[|Bt|@;;|[T@1@<9 +ATB:|BR4tA9 /A/9k@`/@;x;;;||u@48|8`h8!`|!N |!B;|~x8+A0<_)8B8\8M8-;T~nHD/Ap`@<_)8B8\|;8C|;8-|;``@T>@|T`1@t+@HQT`H <_B$ȀTb:|B4T/A+@ H1H<_B$ȀTb:|Bb4T`>H c@T>|xc@T>@|T`1@t+@HT`H <_B$ȀTb:|B4T/A+@ HH<_B$ȀTb:|Bb4H c@@c@T>@|T`1@t+@H)T`H <_B$ȀTb:|B4T/A+@ H H<_B$ȀTb:|Bb4T`1HW1@c@T>@xT`1@p+@HT`H <_B$ȀTb:|B4T/A8c@T>+@ HyH$<_B$ȀTb:|Bb4Hc@9 a)+@H!T` H <_B$ȀTb:|B4} 8/Ac@T>@|T`1@t+@HT`H <_B$ȀTb:|B4T/A+@ HH<_B$ȀTb:|Bb4Tc>H c@T>+@ H9H<_B$ȀTb:|Bb4Hc@T>@xT`1@p+@HT`H <_B$ȀTb:|B4T/A8c@T>+@ HH$<_B$ȀTb:|Bb4Hc@|~xHt8+A |8M<;WnH/As@/A|8C<;c@T>@xTb1@p+@H)T`HTb:|B4T|p|@x|P|@@4c@T>+@ HHTb:|Bb4T`>H c@T>|xc@T>@xT`1@p+@HT`HTb:|B4T|p|@x|P|@@4c@T>+@ HuHTb:|Bb4H c@@c@T>@xT`1@p+@H T`HTb:|B4T|p|@x|P|@@4c@T>+@ HHTb:|Bb4T`1HW1@Xc@T>@hT`1@`+@H}T`HTb:|B4T/A0c@T>+@ HeHTb:|Bb4Hc@9 a)+@HT` HTb:|B4} 8/Ac@T>@lT`1@d+@HT`HTb:|B4T/A4c@T>+@ HHTb:|Bb4Tc>H c@T>+@ HEHTb:|Bb4H|c@T>@hT`1@`+@H)T`HTb:|B4T/A0c@T>+@ HHTb:|Bb4Hc@|~xH$/@|8C<;;?/@|;;eH/\A /"@ |;;=/@8xx8!p|N |a!B|{xH5;<_BB/AT<_\W:|^.bdxHM/@\|^.bH ;<W:|H./@8`h8!`|aN |B|||#y@@|W1@t+@xHT`H <_BW:|B4T/A8W>+@ HiH<_BTb:|Bb4TcHW|}xx<8H/Ac|t/'A /"@hcxHrAW@.|x@9 !A|cyA$|{|t[|Bt@#8a@8<_B0KHhcx<8 H|cy@<CW@.|xB8Bd8`<<_B0KHcxK|dxxKm8`x8!p|aN |a!B|{x;<_BH/A@?;Hx cx|.Hx/A; |./@8|xh8!`|aN |!B<_8Bc .x<8xH/@<_BbH7HDx<8H}/@,<_Bt/A 8H8<_BX8!P|N |a!B|{x;<_B /A@?; x cx|.Hx/A; |./@8|xh8!`|aN |!B;|~yAH|t/A8<8HHq/A$|t/1@|t/@;xX8!P|N |!B|}x|#xK|~yA<xKM<_8B > })Ib pA<xKH0xK|~yA =?9)^ |BJ/@ 8`H$<_8B> })x}N!X8!P|N |!B|~x<8L8H5|cy@(<_B=?)XI<_BDbHDx<8D8H~8/@(=?)x<_BX"<_BD8|xX8!P|N |!B|~yAX|t/AH<_Bb/AHmxHm8cK xH|-<_Bb8`H8`X8!P|N |!B9 d|byA$|t/AHz |iy@9 <_B"8`X8!P|N |!H8/A H8|xX8!P|N |!B|~yA||t/Alx<8H~A/Ax<8$H~)/@ 8H\x<8(H~ /Ax<8H}/@ 8H$x<80H}8/@8<_BX8|xX8!P|N |a!B8|}yA@xHl 8cKxHz=|~x<_Bdb/AHj|t/"A /'@T| t8@;`|x||uA|HAt8@|x||uA\H@HP8@;`|x||t/ A0/ A(8@|x||t/ A / @;@?dxHkTc<8cK|dx}|~8@K=A@xHi8|xx8!p|aN |A!B|zx;<_B\/AH?;\xW8Cx|.H{/@ }H;W8|./@̈zh8!`|AN |A!B|zx;<_B0/AH?;0xW8Cx|.H{E/@ }H;W8|./@8`h8!`|AN |B|||hx9 @|T`1@t+@HuT`H <_BxTb:|B4T/A+@ HvH<_BxTb:|Bb4T`>H c@T>|xc@T>@|T`1@t+@HuMT`H <_BxTb:|B4T/A+@ Hv-H<_BxTb:|Bb4H c@@c@T>@|T`1@t+@HtT`H <_BxTb:|B4T/A+@ HuH<_BxTb:|Bb4T`1HW1@c@T>@xT`1@p+@Ht)T`H <_BxTb:|B4T/A8c@T>+@ Hu H$<_BxTb:|Bb4Hc@9 a)+@HsT` H <_BxTb:|B4} 8/Ac@T>@|T`1@t+@HsaT`H <_BxTb:|B4T/A+@ HtAH<_BxTb:|Bb4Tc>H c@T>+@ HrH<_BxTb:|Bb4Hc@T>@xT`1@p+@HrT`H <_BxTb:|B4T/A8c@T>+@ HsH$<_BxTb:|Bb4Hc@|}x8]+A@8\|;82|;|]x|Bp|B80|;TB8|BP;0/\A /"@8\|;;8|xh8!`|aN |!PB|rx|#x::; ;:W8||t/ApA /H/@ W8|B@xK|}x8@: ~xV:Ku|wxW :.;9W :~.HW8|B/A~CxK5|zyA;/Axc@Wq>>sp~-x~0x!@~.x!D!H!L!P!T~/x!XW:|z.Ha8cK||x/@<8PH|/A`s@X~#x@tV"1@l+@Hp1T`HV":|B4T|p|@x|P|@@0}kx+@ HqHU:|Bb4Tb>HWb>|]x~x@tV1@l+@HoT`HV:|B4T|p|@x|P|@@0a@+@ HpHTb:|Bb4H@}sx@tU1@l+@Ho)T`HU:|B4T|p|@x|P|@@0aD+@ Hp HTb:|Bb4T`1HWb1@DaH@dT`1@\+@HnT`HTb:|B4T/A,aL+@ HoHTb:|Bb4Hc@9 a)+@HnATb HTb:|B4}"8/AaP@hT`1@`+@HmT`HTb:|B4T/A0aT+@ HnHTb:|Bb4Tc>HWc>+@ Hm}HTb:|Bb4Ht}{x@dU1@\+@HmeT`HU:|B4T/A,aX+@ HnQHTb:|Bb4Hc@|exx<8TH`aHL/@x<8\H`EH0/\A /"@8\H W:x|.Hk|}.H\8@: ~xV:K|wxW :.;9W :~.;W:|./@CxH\M;/@~x8!|N |!B<_B􀀂KUX8!P|N |a̐!B|uxH|xx8` <_BHm; x/A<_D<_~x~xcxKAK|~x/Al/@w<8Hh;/A@~xW:z<8|.fxH`I|}.H[!;W:|./@H/@w<8exH` Hw<8exH_;/A`~|x|W:|@|./A<8H <8<8H_;W:|./A /@/@(/A<8c88H[;/A$W:|~.HZ!;W:|./@xHZ;9W :x./@h8!|aN |!B<_B/A$<8c88<_BHZq<_BbKH||x?);޳@~/A$<_)B8/AH>|dx~Ky/@|;?;ޛlAHVp|TP*8?);}K}?);}K}|yx|y<)<xHNZ8|Ѯ<_)BD|BP=?)IPH?;ޛ\~8 HO||y@ HH;<_b\P<_)B8/A(xK/@|t/ AH1xH=|~x;?;{lAHVp|TP*8?);}K}?);}K}|yx|yxxHMZ8|Ѯ8<_)\<_)P;`<_)Bb<_)BPP<)c8<)HK<_BЀA<_B=)9@<)8Ƴ\<)8P=)9k8J|/@/@ ||#x/@ ;{+Wb:I. P@<_)b`8;<_B/@X<_B/@D;@x88HJ8a<_B8<_BxHM|sxH:`<_B@`<_"<_=9Λl<_)8BA=?)9)!<_=)9ka<_)8BA}i[xa|KxA}"Kx!}i[xaA !=?)9)!=)9ka}"Kx!=?)9)!|KxA}"Kx!}i[xa A$!(=?)8I/@\ /@P8+A :`a8a@88HIYH(/ADaHL|`y@ 8@A8 A>):ֲaa ~YѮ;ZA8BA;Ah8A8T<!iT8KAbpT:Kp;{TWi:I.Ua}i.;;Al<_B@ Aēax|| x@@(<_b8K||Ѯ;Z;H@A;!H@@>>):$A(>):>):ֲ;A`8A0T<pT8KprT:Kݐr;{UWi:I.Va}i.;;AHѮ;Z;A?);޲8A@T<?);}T8KY}?);}T:K=};{<_)BWi:I.<_)Ba}i.;/@H /@<<_B8<_B8a|"|(P8@HE|sxH;<_BAl8|ѮA/@ Aēa|x<_)8B8A$T<?);}T8KU}=?))Wb:|BJB<_B/@<_BװB/AЈ|t/A<_BT/A<_)B8/Ax8<_)8<_B̀ AP<_B/@,<_B/@#x8H |zxH<_B̀B;B;A>:h>_):R>?):1>):ֲ??);9~x~3x;x.=9Λ`=)9P<_)8BLA=?)9)X!}4Kx/x}kxAqW:2|X.|iH <8cU9W:V| H.|8A3|KJB| H.|P{W:|IZ|X.x|PxH/@X@T@HM! @4a @$=?)Ѐ |QA xH/@$~x@OH |P ;@<_h@A|?);??);9;Bh<_[xyW:8|X.xHu8`xHŀ@xH0HvH ;@<_h<_BdA8~xH/@(<_)"P/A<_8B`|J<_)BD=?) P/@/@<_`/@<_)BTA<_)B<_BT/A$<_)B8/@<_)BAX8<_)8=?))<_)B|i<_)B|<_BЀ<_)BL|/@<_)BP|8|x9H<_b`/@<_)BP}bXP/@ <_)BP=?))LHAHH<_)BL/@8<_B`@(<_)BX@<_BЀb|kPH}=?)9)X|P/@<_)BP|P =?)9)X <_BЀB@I<)A|~P|"H<_)²<_BPbH6=?)9) =)9k=_)9J<_)8B <_)8B <_)8B 9 <_"T<_B/A$<_)B/A<_)8BL"H<_)BP=?)IL8!a|}p N |!B|ux|#x|+x|3x|;x}Cx<_…l<_Bp/@<_)BXP<_B܀@ <_B/A <_B/@8<_Bp@<_B/@p<_B/@\<_)BV):|i./@HQ;@x88H78a~x<_BxH;=|~x8+A;@;H;@/AaH:|zx/@x;@(<_\|t|ctH4Y;A<_Bl=?9)pI8BI;@x88H7=8a~x<_BxH:|~yA/A8;+@xH(5|ex|uxH:~x~xxH)UHd|u@8` <_B\H38<_l=?9)pI8BI|t/A/A<_B/@<_B/@8a@88H698a88H6);;~x~xH<~xx88H||x~xx88H|}x4|P@|t/A~xx8~xx9@H/@H`~x~x/@P|uAD|t@4;;9|P@ |uA|tAPx@4|t/A$;;@|t/@|TP:x@4|t/A$;Z8B@|t/@@ A:<_B/@<_B/@~x|P8HUu~x|P8HA~@@D@@<:A:a@~Cx88H41~cx88H4!P~xx~ExHP~xx~exH~xx~Ex~xx~hxH/AȈ|t/ @:~x|P8Hu~x|P8H~@@@ALHx;x:@@h@@`|tZ|Bt@H|t/ A:;{:@@$@@|tV|BtA/AxVxHcx88~Ƴx89H/@|t/AL<_B/@4<_B/@ ~x|P88HQuH;{|t/AL<_B/@4<_B/@ ~x|P88H~H::`/@ <_)b\<_BpA8~#xH }/@(<_)"X/A<_8Bl|J<_)bH;/A H"||xP/@<_B/@<_BԀb/A<_)BP@>:l/@A<_)B`Ap8<H >_):RHrxK-<_B/@0<_B/@r8xHwH <_lx~xHP|PP<_B/@D<_B/@0~x|P|PH-|wx~x|P|PH~PHx/@t<_B/@`<_)"XHAP<_B/@(<_B/@|HP~H<_)BX|SP~~xP<_B/@0<_B/@~x|P|PHY|}xHx/@X9 <_t@A@@9 <_B/AW<@<_B/A<_B/A /@Ĉ|t/AT<_B/A,<_Bl/A<_)BP@ /@#xx~xHIH |t/@T#xxK<_8Bl|ٰP|Q@xKו?;lx8|PH#xxKq<_8Bl|Ht<_B/AW<|WA<_B/A,<_Bl/@|<_)BX@:/A |wHٰQ@#xxK?;l#x8xHU|c}H/@$#xxK֙<_8Bl|PPP<_B/@D<_B/@0~x8|PH|wx~x8xH~PHx/A4<_B/A@~xH H ~xH !8!|N |B}H|@xT`1@p+@H%T`H <_BlTb:|B4T/A8c@T>+@ H&H,<_BlTb:|Bb4Hc@H8`?|~x?xH!}H!AxX8!P|N |!B|`xTc>pbA$<_B8`/A8`H|/ @`|DP8bHd/A pAP/AHT`1@@+@H$T`ZH <_BTb:|B4TZ8`/@8`X8!P|N |!Blptx|!A|ex<)8c88lH&=?)9)<_"p=p|}N!8`X8!P|N |!B<_B<_p=o}N!8`X8!P|N |!BK]=?9)o<_BHB/@ <_8B*I<_)88`X8!P|N |B||=)94(:~w??(;9~Ă?(;{~Ђ?(;~؂x~xexxK1z8K:\w8!|N |!B<_Bb/A8?H9<_8f<_Bb/A8H,<_BbK<_Bb8<H<_Bf /@8`KyHK<cf8 HA|cyA8cKqHKX8!P|N |!B<_B/A8?;e4}K8<_BbH8`8HAX8!P|N |!BKi8`KaK]<_BbHIX8!P|N |B}H|=*)dt<_B 8`X8!P|N |!B?;]~/AK88`X8!P|N |B}H|xH!x8!p|AN |!B|~xK98/Ap/@,; 8<_B<_B$d<_(8Bi`=(9ki\+9)+<_BQpA 8 8|xX8!P|N |B}H| @`T1@X8``c+@|#xHTb H <_BT:|B4|b8/AxxHHxxH8`X8!P|N |!B|#x|}y@|}KH<_B@"9)<_B,HA K HxT> @`T1@X8``c+@|#xHTb H <_B T:|B4|b8/AxxHHxxH 8`X8!P|N |!B|#x|}y@KQ8`H|T> @`T1@X8``c+@|#xHTb H <_B8T:|B4|b8/AxxHHxxH 8`X8!P|N |B|/8cA<_B"9)<_BH@<_BԀ<_<_€<_} Cx|3xHH8BHH||t/ A/ AAЁD}cx|+xHI8BII| |t/ A / @ KA/8cAF8BAt8`N |B|/8cA,<_Bt/@<_B<_t}Cx<_} Cx|+xH||t/ A4/ A,|G|t/ A / @H8BH|3x|+xHK8BK+/@ J|H|t/ A/ AЀ/@H}cx|#xK9"+/A J|H|t/ A / @ԀH8BH/8cA/A8`N |B|/8cA<_B~4"9)<_B~ H@t<_B~d<_~ |;x<_~4<_~d}cx|;x}cxx|;x}cxxG||t/ A/ A 8|#x xK9"+@@ J|H|t/ A/ AԀG/A@xjxHK8BK+@@ J|H|t/ A/ AKx xHK8BK+@@ J|H|t/ A / @ЀG8BG/8cAE8BA8`N |!pB/;CAt<_B|l"9)<_B|XH@P<_|<_"|Xx3x<_B|L<_"|lx/x~Nx~-xx6x~5x8Y| T 1@@|t+@Hp`H <_B|LTb:|B4p/@8Y| |t/_@~x~~x~[x~|H|t/_A / A/ AA|W~ɳx~xHI8BII| |t/ A / @ KA/;ZA <_B|lB8BA8`8!|N |!B/;#A<_By/@<_By<_y<_yxVxxTxxxQxx:\| |t/ A4/ A,|I|t/ A / @\8B\;Z|BT 1@8|t+@Hp`HTb:|B4p/@ Z|B|t/_@;:\| T 1@8|t+@Hp`HTb:|B4p/@:\| |t/_@ /Al:\| T 1@8|t+@H-p`HTb:|B4p/@0:\| |t/_A/A\8B\~x~ʳxHK8BK+/@ J|H|t/ A/ AЁ</@xZ|HT 1@8|t+@Hqp`HTb:|B4p/@:\| |t/_@~x~x~{x^9">/A]|HT 1@8|t+@Hp`HTb:|B4p/@=^| |t/_AH~^x~=x~x^9">/Ap]|HT 1@8|t+@Hup`HTb:|B4p/@,=^| |t/_A/ A / @\8B\/;9A/A8`8!|N |!pB/;cA<_Bú"9)<_BuH@p<_u<_"u6x<_ux~x3x~xx<_u/x~x xX9|H|t/ A/ A 8 ~˳x~xHK8BK+@@ J|H|t/ A/ AЁ9@X|HT 1@@|t+@Hp`H <_BuTb:|B4p/@8Y| |t/_@~~x~\x~=x~x^9">@]|HT 1@8|t+@H9p`HTb:|B4p/@=^| |t/_AH}{x}sx}kx?_Zu^9">@p]|HT 1@8|t+@Hp`HTb:|B4p/@,=^| |t/_A/ A / @Y8/;{AW8BA8`8!|N |!|#x8`H,8`xHU8`X8!P|N |!B|#x<_Br"<_Br@t<_Bs/A<_Bs/A=?)rI8BIH4<_r8`H) @<_Br8`xH8`X8!P|N |!|#x8`H+8`xK 8`X8!P|N |!8`8 H6 X8!P|N |B}H|} t@U 1@9 a)+@HT` HTb:|B4} 8|p|@x|P|@@;]})U#>} t@\U 1@T9 a)+@HeT` HTb:|B4} 8|p|@x|P|@@[=|bH+@ HHTb:|Bb4H؁;]})U#>} t@U 1@+@HT`HTb:|B4T/AЁ;]})U#>} t@pU 1@h+@HT`HTb:|B4T/A8[=|bH+@ HeHTb:|Bb4|dtH[=|H|t|#x/A,H8`xH3-8`xH)-H H-H8`xH /;AZA8`h8!`|!N |!B|#xT> @PT1@H8``c+@|#xH]Tb H <_BidT:|B4|b8/@D<_ip9$<_BiA <_Bib88Hy}8`xHm8`xH!u8`X8!P|N |!B<_h/Ap<_Bh@\<_Bi/@4<_Bi/@ <_BhЀb8H~H=?)hI8BI8`X8!P|N |!B<_Bg@8`H!H8<_Bgܐ8`X8!P|N |!!B|yx|#x<_Bg|<_Bgx?gȀ`@K}|~xT{/A<c,xH/@8+ AT?hH֓?gȀ`@K|~xT{H\@L/dA/yA /c@4<_Bg<_Bgx8`xH 5<_(F,H<8`H8<_(F,?g|?g]8 |ٮ9;<];@BIx<_BhK|]Bٮ<_Bg|@<_Bgx"<_Bg|8`AW>@|W1@t+@xHݹT`H <_BgpW:|B4T/A8W>+@ HޝH<_BgpTb:|Bb4/WH/W@d<_bg|+<_Bg@D<_Bgx@0<_BgB|H|t/ A/ A 8 /c@|<_Bg|"<_BgxA\W>@|W1@t+@xHܥT`H <_BgpW:|B4T/A8W>+@ H݉H<_BgpTb:|Bb4/WH/W@<_bg|<_BgxB<_gHK8BK+P@ H|H|t/ A/ A<_bg|+<_BgxAT<_bg|+/AH<_BgB8B@0<_BgB|H|t/ A/ A 8  <_bgx<_"g| I@ K8`h8!`|!N |Ԑ!B<_BcH`<_bd<_BcP:<_cH<_dyx<_c<_d<@`BB@@(KK݀T8`H<8cd|!K-`@K։T|~yA<7W8}bJ|H|t/@ @T:KXTcn8+ A</A[B |B8BА[H 8А8KK xK<_BcHT8`x8!p|N |!B|#xT> @TT1@L8``c+@|#xHYTb H <_Ba`T:|B4|b88`$/@<_(B@8/A<(c@Kx8@KU/AK8`Hd<8cc@Hڽ/@,<_bah+<_Ba@ 8  <_Balb<_BahHm8`h8!`|N |!B||x|#xT> @TT1@L8``c+@|#xH-Tb H <_B`8T:|B4|b88`$/@<_(B?/A<(c>K<_B`Dx8@K/AK8`H<8cbp@Hم/@,<_b`@+<_B`X@ 8  aC@@xT`1@p+@HQT`H <_B`8Tb:|B4T/A8aC+@ H5H<_B`8Tb:|Bb4/WH @/W@<_B`D@<_(B?/Ap<_(B>/A|t/AHv]<_B`Db<_B`@H<_(b>/AȈ|t/AHHvqHHv<_B`Db<_B`@H W>@PW1@H8``c+@xHTb H <_B`8W:|B4|b8/@<_(8>xx<_BaLKձ8`xK8`h8!`|N |!B|#x<_B]\T> @XT1@P8``c+@|#xH=Tb H <_B]PT:|B4|b8/A 8`$Kx8@KQ/AK~8`Ht<8c_@Hֹ/@,<_b]X+<_B]p@ 8  Hti?]\}<_B]XHeHtHrI8`h8!`|N |!B|ex|#x<_B\D/@K~-8`H<_B],/@@<_B](/@,<_B\tb<_B\08Ha|dxH<_B\0|<_B\DBA|Dx?\0}Hy/@$<_B\D@8`xH 8`X8!P|N |!B8`H<_b[$<_B[8B<_[hHK8BK+P@ H|H|t/ A/ A8`X8!P|N |!8`KeX8!P|N |!B|}x|#x/;A /,@(=?(9)9<_(9/;A|А H<_(B9@/@<(8c9(8K)<_(b9=?(9)9(<_("8/TA,A/FA0H@/fA/t@08H8H8H8<_(9<_(9x<(9<(8<(9H-X8!P|N |ܐ!B|#x; <_BY`<_BYB|b|ctH||y@<_BZ\/@h<_BZX/@T<_BY<_bY`H 8`xHA|:[|i|ctH ||yAH\<_BY<_Y`<_bYtH8`xHe:]|i|ctH||y@[8BA/A<_BY`HX<_BY`/@/AP<_Z\<_ZX<_BY|x/A,/@ zx8H|~x@;/A܀Z|b|ctH@ ;9H@;9/@H/A<_Z\<_ZX<_bY<_BYtЀ/A/A ;H{x88H|~x@4[|b|ctH]@ ;9H @;9HKy 8`H/@|<_BY`8`x8!p|N |`x8`/[M A 8`/(M 8`/)M H08`/{M A8`/]M H8`/}M 8`N |ܐ!B|{x<_(B5/A<_(5H8?V`@?(;5K5|~x}T/A /@ 8`H/;{A<_BV<"<_BVP@<_"W8<_W4<_V<_BV<<_VPHmY8`xH/@P/@D~xH$`@Ku|~xT8`xHy/@H8`xHa/@8`xH Hm)/;{A\A\8`x8!p|N |!B|~x<_(B3p/@8`c/SA8` KǑx8cKX8!P|N |!B|~x|#x<_(8B2܀/@8Hk/@$xxH<_(8B2|8`X8!P|N |!B|yx|#x;@l?(;{2d<_BS|x/@ KuHDHie/A\8B\@8`xH ;A<_(2d/@$?(;2\/AHkYHi8`h8!`|N |!B<_(81?(;1/@H!~9 =(9k1<_B U"8|BB9)/@=(9k1+<_BI+<_BI܁+<_BRIl+IT<_BR̈@|t/@ D<_BT@ KBD=?()1<_BSt"8`X8!P|N |!B?R$`@KT8+@Ks8`H(8c=?(9)0Tk:<_BQ؀| I.8`X8!P|N |!B?Q`@KmT/`@<_BQHHH8+A 8c<_(8B0T`:|./@Ks8`H$<_(8B0T`:|.<_BQL8`X8!P|N |!B8`K9 9@9`U 8|@}Cb9)/@9 A9@<_bPU 8|@}Cb9)/Z@X8!P|N |!|~xKe9@U@8}`} |^|C  9J/@܀X8!P|N |!BK 9 <_PU"8|B9)/~@<_BPȐCL<_BP̐CCD9 <_PU"8|B9)/@9 <_PU"8|B9)/@X8!P|N |!|}yA\;W8||t/A@4/AH(W8|BbKHW8|BbH;/@X8!P|N |!B|}yA |t/AHu|~xH;8`/Al<_BN|~<_BNAK9<_BNb<_BNtA4<_N<_BNtH}+|X|I9k @<_Nt<_BN||`xxH=<_BO/@x/@P<_BNB/A</@0"@ |HP/A8 H$<_BNt8`|+x|*8Hb <_BNt|<_BN"}>J"<_BNB8|IxX8!P|N |!B|}x|#x @ |#x||x<_BLB@|\x@|]x/@;xxK|fxPx<_BL|P@8<_L<_BL(|K| | Y9k |PA<_BM/@8`xxH`H |3xH<_BL"}>HP"<_BLB8|IxX8!P|N |B}H|@tT`1@l+@H!T`H <_BBDTb:|B4T/A4W>+@ HH$<_BBDTb:|Bb4Hx/BA8A/AAH/CA0/DApHxxKqHxxKeH<_BCL/@(<_BCH/@xxKH`xxKHP<_BCL/@(<_BCH/@xxKHxxKHKb8`X8!P|N |A!B|#x8|{y@<_BA/A<_BA/A@8A;@HX<_(8B X/A bH <_(b X?(;;`xx8He=?(9) \<_(8BЀI88a}$Kx<(8H/@xx8H8H0/@H<_(8B \@8A;@<_(8BЀ8<(8c \8HiH(/@8a@;@<_(8BЁ"9)"<(8c88H HT/@(<_B>P/@|#x8@8K;@<_"=X<_B=l<_b>T<_>PHTŀZ@8`xH/@/@8a@K!H8`xKHT;A8`x8!p|N |!B<_B</@ KHK̀X8!P|N |a!B|{xHO?@W1@+@xHaT`HW:|B4T|p|@x|P|@@W>+@ HAHTb:|Bb4HW>@W1@x8``c+@xHT` HW:|B4|`8|p|@x|P|@@0W>+@ HyHTb:|Bb4|`xHx|H4/@W>@W1@+@xHAT`HW:|B4T|p|@x|P|@@W>+@ H!HTb:|Bb4HxW>@tW1@l8``c+@xHTb HW:|B4|b8/A0W>+@ HiHTb:|Bb4|`xHx|Z|b|ctK9|xxHKQI8`H ;A<_B1b8`x8!pa|}p N |ܐ!B|#x<_B.ԃ8||yAxK?.Ԃ8`dxK)xdxK=8`dxK蕃]A @KP}<_B.ԓ8H|#xDxK|{xx~xK||xHF ?.ԓx~xKQcxK߁=#xDxK9xKiHF!cxHxH8|xx8!p|N |a!B8|{yA<_B-/A<_B-/AKO8HHEA<_-<_B-@`<_B./@4<_B./@ <_B-b8HoŐ~H=?)-I8BI;`<_-<_B./@8<_B./@$<_B-bx8HoY}H=?)-I8BI<_B-P8~K||x9`@4<_-<_B-(J|BZ| |Y9kA8|Y?-|#x|"KE<_B-bex8Hn}8`KQxKMHD xH8|xh8!`|aN ||@&A!B|xx|+x|3x<_B+|#y@ :@H:@/At-<_+<_"+~4x~x~&V@/~&V@ /@@AKM%8`H /@qx88HmHqx8Hm|}x~x~{xVր>~Ё Vր>V>~ V`>|x&xGxHl/Ad;@0<_+@|x88HmH0xH(<_+x/@|x8Hl~H@x@|x8HlH|x88Hl|}x@H/@8`8!a|}c N |!|~x|#x|+x8a@8K|fx/@|~xH xx8@Kрh8!`|N |!88KX8!P|N |!88KaX8!P|N |B}H||ix} t@xU 1@p+@HT`HTb:|B4T|p|@x|P|@@4A@`@+@ HHPTb:|Bb4H/@$#xH1|}y@~Hxx8!p|!N |!B|zx|#x|+x/@88`H:>@bR @<_L<_H<_/@0 /@$8a@88H8a88H/AX;V:??9D|?L>HH/@̀/@||.|}H|ex|.8a|"8@H|~x{|}H]|ex8a|"8Hea+@ HHTb:|Bb4aa+@ HHTb:|Bb4aĀ@} t@|U 1@t9 a)+@HT` HTb:|B4} 8|p|@x|P|@@0|\.|b+@ H1H$Tb:|Bb4H|\.||t|~yAx[}"U#>} t@|U 1@t9 a)+@HT` HTb:|B4} 8|p|@x|P|@@0[|b+@ HH$Tb:|Bb4H[||t|by@H;V:??9L>H:a@:@uxH/@l/@`~cx~ijx8Hi|U|u.x~ųxx9HW/AT|u.|}~dxHW%/@|];H @(;|[.||uAX||u@d@x:A/@P/AH|t/A8~xHq8cK}z~xHH̀z|.~ExHH8rKQz<_B/A|8z~$x8<Hm~xH|}xAD:A,V:|~.~xxH/A|:@@$Hz~xH z~ExHZ8|~#x(8! |N |a!B||x|#x8`/A<_B|/AxK|}xxH}%x<_B/A/A;/A;W:|./@x=}N!/A/@$/A xH|88`Hd8/A8T:|./@/@0@(x8xK/A xH|E8`h8!`|aN ||@&A!B|vx|#x:<_BȀB/A|@;/@;4;99<_B$/@8v~x8<?:1<_;@~x@x<_BHAhW}:|}./AXK1|.K8@0;|Q@$~^xP8` H;A{;ZAK4:s/A,P8BA@~cxK|syA:@8H:/A.?;{<_"<_BHV:|}.KY|.K/A/AP@L||@(:<~x~xTx~x~xSxH/@X/@|t/.A|t/.@ |t/AԀT.<@.AHԀ/Ah<U#>} t@xU 1@p9 a)+@HymT` HTb:|B4} 8|p|@x|P|@@,|+@ Hy H Tb:|Bb4H |t|~xW"U#>} t@U 1@x9 a)+@HxT` HTb:|B4} 8|p|@x|P|@@4Qb+@ HxqHTb:|Bb4HV|t@t;xHiU(A\rxHyHD8\|Bt |t@0;xHi(AxxH{/A{/AHr||y@/@?(;8~/A Hr?(;@~/AHg8?(;<~/AHg}8?(;D~/AHg]88`HL<_(B@/A|t/.@|t/A<_BP/A<_(BD|t/~@h?(;@}Hg|{x8|Hg|{8cK|~xHv]|B|t//At8/|ٮ;{8|ٮH\?(;D}Hg|{x8|Hgu|{8cK}|~xHu]|B|t//A8/|ٮ;{|~8HumH$;xHg8cK)xHuM|~xx8!|N |a!B|{x<_B<_BA<_(bݼ/AHe<_(b/AKY8<_(<_(<_(8B8`%K֕<_/@ <_<_B"<_("8<_(ؐ@?(;Ԙ/A8a@8K}?(;<_Bb|?(;ЀKm<_(bݼ<_(8Bԉx@}tKߵ<_(b<_/A<(8cK/@LK<_(b/AHdm<_(8<_(bݼ/AHdM8<_(ݼH<_(8<_(B/A0=?(9)<_(bI8BITB:|X./@<_(B/A<_(B/@8K<_(b/AHc8<_(<_(8BܐH=(9kā+};J<_(b| ||HP /@ | <_(B/@<<_(B/@,KA<(cݼ<(8<(8KH?(;Ā\?(;=TB:|bH.<(8<(8Kـ\=TB:<(cݼ|H.HuI|fx<}U):<_(8BԈ|iX.<(|tK<_(88`x8!p|aN |!B|~x<_B`+A<_8B@Ti:| .|| N \``````HH}8`88@Hv88@\B>@|B8A@HvqxHvI8`8@8HvyH<_BT^h8!`|N |!B|~x<_Bd`K%<_(٘+@x}N!<_BdT^X8!P|N |!B|#x|+xP8XT8P8@Hu5<_B@@A@DH~x8!p|N |!|~x|+x8DKU/@xx8@Hth8!`|N |!B<_B,/A<_(B/@8`?8<(8Ke8`8<(8KQ8`8<(8K=8`8<(8K|}x/@8`<(88@Hs/A,<_(8BpA8`<(88@Hs8`?8<(8 K8`8<(8,K8`8<(88K<_(8<_B0/A8?(;/@$8`<4<(8DKQ88`h8!`|N |!B<_B/A?(;d/@;D8`<(8l8@Hr8`<(8x8@Hr8`<(8֐8@Hr8`<(8ք8@Hr8`<(8֜8@Hrm8`<(8֨8@HrY8`<(8ִ8@HrE<_B/A8?(;h/@$;D8`<(88@Hr8`h8!`|N |!BKT9<_B@}N!KKhX8!P|N |!B<_BԀb<_B}N!KɀX8!P|N |!H KaQ|cyA 8K©KHKXX8!P|N |!B?(;̀/@4<_(<_(88`8<(8Hq8X8!P|N |!B?(;\/A 8`<(8X8Hp8X8!P|N |!|~x<@`th8@Hm/@x<`tg8@Hlh8!`|N |B||='(9):׈<_Tx<_"<_Bxxx~xx8`/A(8dY+AXb/A/A |vxHHT/A/A |#xHqHrZ/A@+A/AL/A@ hP9 <_B߀b/A@<_|i>2B١. h<Ѐ;@8xHK|cA8x/0@/0A|t/A/.A@<_B߄/@t@x@/0A7A$<_Ԁ8`*| N!7@8!8`a쁁|} N 9 @<_ɢ>K8cAP7A$<_Ԁ8` | N!7@@<_B߄/@;|t/A,<_Ԁ| N!;|t/@7{A<<_Ԁ8`0| N!7{@8!8`a쁁|} N <_|?A8| 2BK$K8BKD<_8`-BԀB|IN!K,8c;@pK<_8`+BKNK,}&.|BA|3x!0|#x|+x:`@>VܼB/Ap8@|AT7A$>_8`*| N!7@8!8`A} |} N A;/A<_;@P:; Vܼ||"}`P;8I |T})xU)}"9A\Vܼ;:`B/A\/(:@ :;( <:@8 ~xxHH%a@Ub>+A =?TB:)x|BJ4p@0}`t/NA/nA~xHE}|cPQA7A$>_8` | N!7@/A(>_0t|cRTc<8c-B|IN!a@~x/Ah>_|ct| N!|/@8!8`A} |} N /AVܼB/@K<_:B"@@<_;K4;@KK<_|;;e@<+0`0-;x@,/A@;;H ;/@7A$>_8` | N!7@/A(>_0t|cRTc<8c-B|IN!Vܼ~x.@/A/A\;{@@,>_|;|ct| N!@A<_;{8`0| N!6A@@,>_|;|ct| N!@A@;A(>_8`0;| N!@|/A >_|ct| N!|/@K; K;/A;@/@Kh@XxK\cxHNՀVܼ<8|Pcx8HDK<_|B|ctB|IN!Kl/0@8K>_a@;B|ct| H|;| |ctN!7AR8`.B|IN!K/>_@X8`.| N!@ Ѐ8`0| N!7@R;wB|ct|IN!KR8`0B|IN!K|B<_5!@8@8`H`<_7<_ɢ62hOA@DHh(١HLl|x8`|]x|~x8xx8HO/@xxHPH,WW~|JxW~8`W|cKx|SxHO!*(<_5@TP<_"6OAHLH(١@Dl|x8@HL<_6OAHLH(١@Dl|x8@xxx8!p|dx|Cx|N |!cH=|!B|yx|#x<_ǠH?5|zx8|uA /~@$8`H|~.H?8cx|{Hp/Ad;`@X;/A|ex|y|.HQu/A;W:|./@;{ACxh8!`|N ||@&!A!B|zx<_ưH>E|yx;`@-M |خ|t//Ah;AT/AHNW:|}.H=|ex|z|.HP`x/A,;AW:|./@;{A`x|xh8!`a|!}c N |!||x;@8~HNU/AxH=e;#HxH=U;##xK]|{x;x8@K|}x|Z8B@|;$cx8Ki|{x|{xxHMyZxKy|~x/@ /A8~K|}xxxHM=xH|~xxH;xHbB }^. iI ; /A|~xHCM<':` |.<8cxKxH3<_B́}N!h8!`|AN ||@&A!@B|yx<_B̀`<_BˀBAP<_B|BATK7aXa\W.K7|~x9<_BA`/@<_B A`K0U;`/A$/A;{W`:|./@txWc:8cK|vx;`@ Wi:|I.| .;{A<_Bb/AWb: |.H0?Ā}H38cK|mxHAW`:}.:aXKQ98`Ki|xx8:<_(8B蒢8/@8|xx}sx8K=<_BăBCxH3|wx<_Bˀ?̀`@K=||xT<_B|/@(<_Bx/@8@8K@e||x/A<_B "W8}bJ|H|t/@ <_B@i#H`<_B@ }pHH<_B̜@ ;H0/@ ;H /@ ;H/@;a`xHB/A /@lK9/A`8`HL<_B|/@@<_Bx/@,/AX8a@H1/@HHxK<H/A0/A sA8+@ /@ /@9<+A<_8BU):| .|| N /@X?(;/A?(;]9@x}{xK|xxH>x}sx8KH/A ;HAl;H9W.Ht/AP:H\AXT@:|v.8K|<_BˀP<_B|TKH<_Bˀ<_B˔@<_BĀB|b|ctK/Ax<_b˔<_BH;@R|b|ctK/@}?(:1|UP;HDA4|t|Z|Bt@$x|~xH@e/@ :sH A/@H A/@V>~ V>~}/AA/@A ոPK;K/AKŃa\K/AWi:| .<_(|i.8Kx<_Bˀa\exX@8x}sxKKxAXT@:<_BĀb|.H:K<_(b/AH+1<_(<_(\AX@|`P8K,H\AX|bP8K+/@<P\AXA<_BĀbH+|~x<_B|T<_BˀK/A }kxH*~óxH*<_B̀Tn8`8!a|}c N ||@&AA!|{x|#x|+x|3x8a@88H9/@;x/@$cxx8@H@;/@|.xH*|ex8ax8@H<8+A ;;8a@88H9QH(/A(AaH/M |@t/@ 8`|t/[M 8`N |B!|~x|t/0@\c|`t/;@ ;HDTc>+@H4-T`H <_Ti:BDb})Z 4T/A;X8!Px|N ||#x!||xK |~xxK/A;H@@<_+&@(^$"|BHP>|BP|BTB:|H.Hcx8H//@$^ W<8`|I/A$|CxH>;;H@A8`h8!`a|N |@&|BA<_" |zx!|#x;`/A~ ;X@@<_??(.}7Kx;9+@0^&>"$|BXP|BP|J>|BTB:|H.HCx8H./@x^W:i./Ax/Ap7I@/A|xAHx/A<dxH)xHX|B8BXH~ ;;X@A0x8!pacx|}p N |Ba<_B|~x!"I|t/AHxHRqH<_8BҨbH*<t|~`)k=?9)ԀI?||cp|fpP/|BI@,?;;Ј}|ct}N!7A<_؀B@Hh8!`8`a|N |B}H|}#t/AxN!H>U">+ATB:|B4p@} t/.@x8>H(/@(x8`$N!x8`U">}+Kx+ATB:|BR4p@}`t /.@`>U">+A(TB:|B4pA}"t>|H9~˳xH>+AU":|BZ4p@} t8@/*A //@8/*@};H ;8@>} t/*A//A/@/A;~/@<_8`B[x8!p|N |cy8@A/@ 8@H`|t/%@$|t/A /pH 8cH /$@|t/<@8@/A /@|CxN |B>V0||x!|#xB;A@|+x;`/; Ux:A|CxHY; ??(@/DaHAP>(;׎|[>H@@4;| }|xHL/}@ ~H /%@8| t| x+rA<_U):8B| .|| N @P H;H<8H<@Q`B<|@| p8|B.p|IPBdH,<@b`BM<|@| p8|B6p|IPB|PH$\|/@(V0/A8:H8;ZY|ٮH Y}bٮ;{HAD@H\!@AD9)8B!@ADHȈZ|t@|t|;HA@DhB`h`A@DHZ<ff`fg||Ip|p| P` T 6|KP|HLZ|@&p|T<|@PZ/A,;};Z|cH}|cH){|P|p/@ 8;AHHHY|ٮ;{/@;ٍ^/A4/A$0|bH}H^{8|ٮ8!y|N ||~x!|#x|+xKI/AxxxKHxxxH.X8!P|N 8`N |A!B|{x|#x<_B/@?(;x/@(<_(88`Kh};H<_(ˆ<_B@L<_(BxbH9@@`=(9xhUI:|IZ| Y.9JAH4<_(8B"9)"}>Kx?(;x}U$:Kh};<_(BxW:8| .H<_(B;<_B/A<_Bp/A<_(BxW:.xH|}xcxH8}Kg|}x/AxHxdxHdxHxxHxH ucxH m<_(BxW:.H<_(BxW:i.<_(ˆ8`h8!`|AN |!B|}x|#x A0Ki||xxxKX8A8xK=?)I8BI8`X8!P|N |!B|cy@|cHqHX?tK^mA xK5<_Bt<_B/@<_Bp8`X8!P|N |!B|cy@|cKIHX?K_MA xK<_BX/@<_B<_Bܐ8`X8!P|N |!B/@8`HuH\?L8`K] A xK <_BL<_BĀ/@<_BH8`X8!P|N |!B/@8`KEHx<_B/@ KĥHX?8`K\5A xKU<_B,/@<_B<_B8`X8!P|N |!BK;<_B8`<_BK<_BK8`X8!P|N |!B<_B/@ KÝH<_B/A8`/8cA<_b<_}f[x}CxHK8BK /A$H|B|t/ A/ A|3x|;xHI8BI /A$J|B|t/ A / @/8c@<_¡|+xK<_B/@<_B8`X8!P|N |!B<_BL/@ KQH@?L}8K9 =<_BĀ/@<_BH"8`X8!P|N |a!B|{x<_<_ŸĀ~APKdI||x/A~KR8<_Bā"<_BA8xKI=?)TI8BI8`h8!`|aN |!8`K=X8!P|N |!B<_B<_BB@|^x8`K|}x8`KS)<_BxX8!P|N |a!B|}x<_Bt<_Bxb|#y@8KXiH 8KY<_Bx<_Bt/@x8KYHx8KX!8`K%<_Bt<_Bxbh8!`|aN |!|cy@|cH!H 8KX8!P|N |!|cy@|cKH 8KX8!P|N |!B<_'B~/@K`8`H4<_BHbKt =?')~<_'B~U):|i.KNy8`X8!P|N |!B<_B<_BA<_B@<_'B~P/A?';~`^?';~P=TB:|bH.H|ex<_BЀQA/AH<_Bb^=TB:|H.|K|Bt|t@l||ZH/@\?xKO9=?'9)~`I8BI/@<_'B~d8BI8`8Ka8`H K_e8`X8!P|N |A!B|{x|#x|+xK||x/A ;@K;AKq|~xxK/A,cxdxHY|~yA|t/@K!8`H\K<_BbKq<_B/@8`DxK( <8cKL5xKL-xHK8`h8!`|AN |!8KX8!P|N |!B|~x|#x<_B<_BA<<_'8{<_B<_'{<_b <_8H`<_'B{/AK/A<_8B|А=?'9){؀ <_B| /@ 8 <_'B{/A<c H8`$x<'{K C|<_'{X8!P|N |!B|}xc8KN<_BL<_Bb/AK8<_BX8!P|N |a!B|}x|+x8|#yAK||xxK8/Ax<_B`|t/^@8}dxH_HxdxH_i|~x<_BT/A Km|~xxKx|xh8!`|aN |!B|#x|cyAT|t/AD<_'By/A4<'y|"K/@$KmK8<_BKHx?';y}K|~x}KK=|}x<_B`/A xKxK8<_B<_B<_BKaX8!P|N |ؐ!B|vx|#xK5=?)<_B"<_B(B88 <_By@8`:K|}x88KExH<_B0`<_0<_<_B<_<_b`@K ]|dxT/@ /@8@8K |dx/A/ AA$/AtA/AhH/H(/AHA/ AH|/A$/@l/A8`K\H8`KHt8`KHhK)K<_B<_B"KYK꽀T,H/@/@8a@KFH 8`KTU}N!K<_B"<_B/@<<_'Bx|/@tKHK}K<_B"KH`K<_'bx<_'bx|/AH?(}H8cKVH <_'bx|K<'cx|~ijxK=<_B0T,8!|N |!8?/?A88`|xK8`X8!P|N |!8///A88`|xK8`X8!P|N |!B<_'Bu/@K8`H<'cu8KY8`X8!P|N |!B<_'Bt/@K-8`H<'ct8K8`X8!P|N |ܐ!B|~x|#xK;`/A?';tt?';tp??';9td:xx|"~xK/Ap|K|}x|KK9|{xxKy/A,|tD|Bt@H /A;/@|/@@KK=?')tl<_Bȑ"<_B܀<_BĐ8`H<cxK}=?')tl<_Bȑ"<_B܀<_BĐ8`x8!p|N |!BK<_'bs <_Bd<_'s<_'8s/A=?'9)sI8BA 8?';s}KSy}?';s\8^|?d8c<_BH a\|B8KX8!P|N |!B|#x8|~yAx<_BȀ<_BPA<_BLAK<_'Br$/@xxK-H$p|x|`P8/A8K%|`x|xX8!P|N |!B|#x8|~yAx<_B<_BA<_BAK<_'Bqp/@xxKuH$p|x|`P8/A8Kq|`x|xX8!P|N АԿАa/ԀaĀ@l8@@|4/A |P0|`0|P0|Gx|cP0Tʄ>T>|STi>|@Q|x}!}b8PU`| Kx@@@$}k280@A@@@ 8}k2}hXPTi>| S|@Q| x}!|XPT|Kx@@@ |29J0@A@@@9JT| SxH/@ 8|3|4/@|8PT>9TĄ>H |P0|,0TĄ>},#|b,0|P0|xT>|cP0T>x|#x|I!}%Kx} }B`PU@| [x@@@$}J280@A@@@ 8}J2}HPPT>| |@|x}|BPPT@|Kx@@@$|B280@A@@@ 8|B2T| ;x|P|#Ti>|@!|x}}b8PU`| Kx@@@$}k280@A@@@ 8}k2}hXPTi>| #|@!| x}|XPT|Kx@@@ |29J0@A@@@9JT| SxH08@9 A } 4/@ @@A0@9 A9 H }P0|,0|,0|Hx|b,0U>|P0},#|xU>|cP0|P0T>|I!}>Kx|}B`PU@| [x(@@$}JB;@@A(@@ ;}JB}EPPT>| #|@!|x|}BPPU@| Kx(@@$}JB8@@A(@@ }JB8W}EPP| ;x}i0P@| 1AP@@@9)9!aN A;AАa/A@P@@|4/A  }B0|0|0|Jx|0TDŽ>T>| ;T>|@9}!}bPPU`| Kx@@@}k20@A@@@}k2}hXPT>| ;|@9}!H,/@ 8|3|4/@}FPPT>TĄ>H# |0}L0TĄ>},#|0}@0| xT>UK>x|0|#x|I!|}`PU|[x8@@}20@A8@@}2}@PUI>||@||@PT|Kx8@@|20@A8@@|2}GP| #T>|@!}}bPPU`| Kx@@@}k20@A@@@}k2}hXPT>| #|@!}|XPT|Kx@@@|20@A@@@|2/|PA|08@ĐAHP@@đAHl}4/@4@@A 0@A|(}HQ|x/A<đAH(# }0|0}L0|Hx|0U>}B0},|JxU>UK>|0|0|I}||@| x||8PT|Kx @@$|B9@@A @@ 9|B|8PW|cx|@08@|1A8@(@@}&|H} Kx/A,} (}B9}"0}@0}I0|x!aЀԻAN aА8`AЀM AA8`@M @ 8`N 8`N ||ip|jpB<@C0}|m@A=( +AL<_U):BwP}) 4pA0F }`t|B8/'@9d8cH9/}b[xA /A/A$8%88C;8^A |3xH|3x88x@|;xEaN /|BAȐ!|yx|#x|{x9`A8?_'XHݹ|wx8@#x8K9`>'X/A9 8@H8U*:| 8.} :/A;| 9.H;09)|x@|bxA/>'9vW8 @x5#aAlU :<'|A=}f[x8WX9g9Bp|i8&j9J/A U 89)|@:}g.&HH8BHB/@>'?'[|@t/%AT^>/@$H<_Xbg8{8KYc|{x}bt9"+]A<_U):8B| .|| N xx (h< XD  <X px(  ܀ZX95X 8B@@(;WT@<}|x HM/}A9zX8WK8%| 8BKH9WX(:`/@09)='9kWXU*8|JZ(/A ~jX.H=?9)gI8BIA/A8@X9uX9"K})@@U <;W}|x H\8W9'/@09)='9kWXU*8|JZ'/A } X.H=?9)gI8BI}Cy@;ZX95X 8B@@(;WT@<}|x H/}AH8ZXxW"I9)"H9W?(<;ހ8cg/@<9)='9kWXU*8|JZ(/@,|JX./A |CxH=?9)gI8BIHؕZX95X|sx 8B@@(;WT@<}|x H)/}A|;X;WxH9W>(:sgTX/@<9)='9kWXU*8|JZ(/@,|JX./A |SxH=?9)gI8BI~cxH@xX95X8cI|c@@(;WT`<}|x HU/}A;X;W~Dx}|`~exH||cHQ|H{9++A U :8A@}.} /A<8WG/A @<_'UI88BWX9J}i8} . GH 9W 0H {8 }i[x+A 8WU)>f<_'9)8BVH(8 +A `8WU)>f<_'9)8BV/U :8}@09+='9kWXU*8|JZ&/A |X.H=?9)gI8BIH {8 +A 9WUi>H<_'9)8BVH(8 +A 9WUi>H<_'9)8BV/U :|.H 9WH/A,<_'UI88BWX9J| .}i8 HH=?9)gI8BI{H 4<_;cbt<8`HC ;{|BJ8bЉ;+AU":|BZ4p@9WH/A P<_'UI88BWX9J}i|i.8 HH 9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|2H L9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|0PH9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|1H9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI/8Ah|;H`9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI8W9'/@09)='9kWXU*8|JZ'/A } X.H=?9)gI8BI/8A|3|1|@PH9W8(8/@09)='9kWXU*8|JZ(/A| X.H=?9)gI8BI/AHd9W8(8/@09)='9kWXU*8|JZ(/A(| X.H=?9)gI8BI/@`9W8(/@09)='9kWXU*8|JZ(/A,| X.H=?9)gI8BI/A89WH/AX<_'UI88BWX9J}i|.K9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|08H`9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|3xH9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|2xH9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|:x @|H<9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI08AH9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI08A89WH9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W G|9H`9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI9W|8H/A <_'UI88BWX9J}i| .K=?9)gI8BIHx@/@Ap8BApD/@TAt8BAtHD9W8(/@09)='9kWXU*8|JZ(/A |X.H=?9)gI8BI/@{8@/}`[xA|t/%@D{}`t/?@ 8BH,/;@/@8BH/e@ /A/A{/}`[x@Hp{8@/}`[xA\|t/%@0{}`t/?@ 8BH/;@/@(8B/A{/}`[x@H{/A ;{|PAH >'?'95XZX 8B@@4;WT@<}|x H/}@<8cH@9xW:XK8|Ik8!}c[xA|N ||jp<b`M|bx|= a)B@!8a@8|6p| P`@|KP|BI֐ADHh8`8!`|N |}y|!A(HA|~y@(xHH8 H|#xH|~xX8!Px|N ||@&ԐA!B|{x|#x|+x<_8BQ}#})t|t8`@;9`; <_8BQ};})t|t@0;<_B_ȁ"<_B^88}H||t/-@ 9`;|[|Ix8B+ Ax;] } t|B;;};8 + @/@$<_B^8"<_B_Ȁ})HPxKM8|~yA|xH||t/?@ ;9;x||uA<_B_<__;@.<_`D/@P/@Dx88HcxxxK|{xK9/@x|^;Hl@L/ Ap/ Ah/:A`u/A/AH֝/@@||tA0||t/ A A /?A;||u@4P8}K|zx/A|xH8|/A||t/?@;|t/@D/A':9>':9x~x7x8x?';9Y||t/&@DT|AW@<@cxDxK |{x|{HH\W||t/\@|B|t/&@;AWD<|#xcxK|{xX||;;AH8|?';9|}H}<_'9x8!p|N |!B|zx|#xPT|;x8a@88Hy8`K|ux|Z|uAT<8ciTHm/A@9 !ЀA8BA<_8BG̈!8a88H؁!|ZJ|t/#@8 xH;<_BU/@T<_BU/@@Cx8K||t/AT/'A /"@D|^xH</A0|Z|t/'A /"@A|Z|tCx8xK||x/@Cxx8H_':R8>':8='98~Qx='98 ~Tx/A0||tD|Bt@|~Hɭ/@P8}K||xxxH=|cxH)m||"|{|"|PH 8|xHyx;/A0 xHY|vx9;|@$/@ 9H/AHtA8BAԀA||t/:ApA8BA/A/q@xKhHx/x@XxKYHdCx$x8HCx$x8KATb~xHxH8`H|xHu8cKxHå|}xxHYxxHM|dx/A~x8K|ux~xxHexHԀAPATa؀88!0|N |!B|ux8`|#yA<_8B>Ȉ|t/@~xH8cK ~xH :8`K |xx89~xHq|vx<_8B>ɉ5})t|t@H8cK Y|zx<_8B>Ȉ8:8s8c~xHQ:H8aP88H¹~x8| x||t/A <_bL<_L?;>>:>?;>>?:1><_MT?;{>yxx/@4/@(|zJ8PK/@A|C8BHdA}z |t| uAp||tH@`/A |uALpH/A<|x||t/A 8|x||t/@H|Z|Bt|t@H/AqxH}/@/ACx}N!/@H/A0A||t/'@8Cx8KHH/A<||t/\@(/'A|t@A8BAЀA8BA|Ix||t/@D=?9)>Ȁ|Z|Bt |tA0xHCxH8cK DxH͐t8`H; !:@8| x@4:`<_"L<_L9@9P|H|t/A :@HD/@ЀP/@xA@ADAHAL;}{x}kx|x88HcxxK /@$A8BA||t;/@8a@H+@L8a@H|~x9A :@x~xK |xx|x|~P8@HH(<_8B>Ȉ|t@ ;H <_8B>ʈ|t@;/AA/AH/'A8/\@:R8A:@x~xK 1|xxɮH<_B>/ApA|\x8BACx8KP;xKa|xHA|BbaHe|}x9A :@x~xK|xx|x|}PHiaH!HԀ/A(|Z|uA<c>H/Aa|cP8cKa؀|"H aH|}x9A :@x~xK|xx|x|}PHɀaHH0A|Z|uAT<c>xH5/A<8A:@x~xK|xx||ɮ;9~xɮHCx88xK |}y@,ؐxHA CxH8`HЀa/A`9|t/ADH||x9A :@x~xK|xx|x||PHaHek @|܀ԐЀA8BA|IxAA CxH!0|`qA/AxK8`88!0|N |!B|#xe9;|X|t/:@ 9k9|X|t/%@L8 ?';'~/AH}8cKHH8`Ku8H|X|t/*@<8 8`8$|;xH|~y@8`K1HxH|X|t/$@ 8 8`$8$|;xH}Hd|X|t9@/-Ah|X|t9@/^AT|CX|Ix8B+ A8/A09@J } t|B9B9k}#X8 + @H 8`H|X|t/^A /*@$|X|t8/^A8$9kHx|X|t}DSx/-@d9k|CX|Ix8B+ A08D } t|B89k}#X8 + @H |X|t8/$@ 9k8$eP@/$A /@}CSx|;xH-|~xy@ <'8c&X8!P|N |ؐ!|}x|#x|+xH 8||yA`;`/A;{W`:|./@/@ Z;Z/@ ;/$@;[/$@;;Z@$A/A/A @ ;H; x@$W:||.H|y;#;A8yK|xx8x; @L: :W:|x|.H|}.H=98@~ɮ;9~ɮ;A;@W:||.H;AxHx|xx8!p|N |a̐!B|{x|#x|+yA/A 8:;;; |t/A>:2>:s2;||uA4/ A / @$;||uA/ A/ A||uA|tAx||uA<8cT4H/@||uA<8cT8H/A}; |t||t@,/$A$/<@l |t/-@\;HT/&@||t/>A@||t/&A/(@||t/$@ ;H<||t/$A ;H$||uA$<8cT@H/A||t;||x/A~|x/\@|[|t/ A<||t/\@4/'A,/"@<8cTD8\He/A ;Hx/A||t@ ;HX/@ ||uA|H/@D/@,||uA <8cT@H/A ||t;|[/@$/A /AA@P8A: #xV:K |yxW:8|K|}.|xH |].8|;W:8|.||t/@#x8!|aN |!88KiX8!P|N |!8@KA|}x@/A /@ 8`H|@T:.;@ W:|}.H;@AA@;W:|x|./A |b.H;W:|./@xHuxh8!`|N ||@&AȐA!B|+x<_B:T|zyA|t/A<_B:B/A@ /Ax/A<_B:@;Ki|xxCxH-<_:|{x-<_b:~&V@~rxA/A@@ 8`HTW:|X.xH]A$/@P/A4|t]|Bt@CxxexH/@<_B:8`HA\QAN~yxA4|t|]|Bt@$Cx|exH/@ Hl7@Ht|[P;";@`V>~ V>~WxA4|t|]|Bt@(Cx|exH/@xH$;AA ;K;K8!a|A}c N |!8KX8!P|N |!8KuX8!P|N |a!||x|#x|+xK|~xxKxdxK/@xK8`HK|}xxKxh8!`|aN ||~x!C/A c@A8@AHc/A H^/A |CxH~/AHՀ~ /AHŀ~/AH~/AH~/AH8$  X8!P|N |B}H|~^ K~~ T>$/A8W=<x8@xH18@Ѐ %x8a@8NK @ /A(xW<8@xH8@A8~xH8/|dx~Alx~xH8@TW@>^&/A|W:8a@|"Ex~xK7AT|T:^W:}|.|Ibx})ix/A/AH|r:C7;@/A@8~cxH8/|dx~AWC<|t~ex|~xKU/+~xA W,8|I^|;B/&~ݳxA$ V'8|I> W<;|K.B/xA$ X8|I>W:;|I.B8|x8!a|A}a N ||#x!8|~xH/Ax8H|~y@ 8`H(xKQ|}y@ xKxHxX8!P|N |BA!|#x||x|#x|+x|3xH+A8<x8@xxH-h8!`x|dxAKh8!`8`A|N |@&|BA|#x!|+x|3xH/|}x|~x|dx;8`AH ;Hh;|t.A/:8@@8@A <8@ #xExfxK/A8|xA |xKxHxh8!`a|}p N |B!|~x|#x|+x|t/AH<88HQ/A0<x88H5/AxH )/A 8`H숾<8?`x|t8a@8 Hu<_'B /A,8`K8@|dxxxK/8`A<8c?LH1/A(K8@|dxxxK/8`A\H |cyA$|dx8@xxKm/8`A0<8c?hH/@ <8c?xxx8@K8!|N |B<8c>,!Hu|cy@ <8c>8X8!P|N |@&a||#x|{xA8:!x|+xH.|}xA 8/A$x8H /@W:;.W:8|.A 8:h8!`ax|a}p N |B|sx<8c:ؔ!:@|#xA@Hy;|}y: ::@A\|t//@x~x8H <~dx8=tK/A$<x8=x8a8: H HKqH|tx|}x/AP;/:@ H0A|t/@x8a@xKe|xx/@<8c3@H|~yA`|t/APH8c +A@;xx;H9x<x8=HExx8a@K|xx; @ ::bր~xW :`|w.|"Ha9/@lT&AHX9HH;`@xPH0|P@ xcxxHU/8`A8;x8|H9|}y@;zcx8|H!|zy@8`8!!|N |B|@&|3y?AX|+x|;x!"A 8HQ.<_;@b88xHyxxxH-/ApA@b+@HpbHTb:|B"4q"/@<8c.K-A8a@LxIN!/@|8a@KKp<_b 4/A8<_8B 0b /A |Kx+IK/@X"x8!pa|}p N |B|@&>_A92 ܔ!@|ox:`; /A<_}:Kxx;/Ax@@h}K/AT/;@$};9K<|ex8-|8{HA/@ ~K]<|ex8-8{H/@/@8` 8H}/@X/8`A92 =8NX:/Al<_}1KxT(;@,~6x~xx};K߹y,4KU/A@:xA(<~8*dxK!/A 0;/@.@cx8p8@@DHLPTX\`dK)/@D8`H|~y@<8c+K8@8(H铞(;~.x0@ <8c-dxK%:0(;;9 A能/@/A~cxKe8`HP.AD?; ܃8/A}(/@;X@(9=0I9) (/@;XA8a@xH$Y(/A0@ 8a@|B$H](8B/|@x](@8a@xH}/AH|}} /AH|m}/AH|]8@x8(H~x8H8/@/@ /Aġ}8@X@@09@=| |t/@ }I}8BX@Aܡ]8@P@@09} TI<| Z/@ } [.]8BP@Aܡ] 8@P@@09}TI:| X./@ } Y.] 8BP@A܃/@DAl<_9 ؀ /AX 8NX/A@<_}cxT}K]Kx}N!/@8`8!a|}p N |B!C|~x/A /@/A0/A(/A /@<8c(K^/A0/A(/A /@<8c(K݀^/A0/A(/A /@<8c)K^/A0/A(/A /@<8c)DKm^H/@4d/A(/A<8c)tH̀^bH^/A0/A(d/A /@<8c)K^d/A0/A(/A /@<8c)K^d/A0/A(H/A /@<8c*K^/A0/A(H/A /@<8c*8`IxX8!Pa|}p N |Ba<_|#x!|{x^  A<8c!TH|/@cxHyE/At<_=?B,)0b 9kY/ @; ^/@8xHn|dyA(^cx |xH5^ h8!`a|N |B?';4!|~x/@8`Hna}^8,9 /88@' ^>&>">$@8`,Hn!~ /@8`NHn ~ /@8`xHm~9`@@ 9 ^}"Y9k@A9`@@$9@> Ub<9k}BK.@A 9`@@$9@>Ub:9k}BI. @A8<_'8X8!P|N ||}x!88`Hk|~yAx8HmmxxHX8!Px|N |BA?';戔!|zx~Hk݀^;?'|+A |Dx|cHy||愀h8!`|cA|N |@&.|ܐBA!||x(A8?';cKA |@@<\W:|}./A/AK\|}. ;@A;@@0x,/@8`KՐ},;; @A܀|HiH?'< ;?'\H@9] @P@X}HSx|}):@9@8W:|IX./@ }I.H /@ |.H|P| .;B/AH=_'99J9a @8\, "8B /@ H |HP 9kB;~Hj/|A;Hk  \@|B\@`:@99@W:}+./@\}K.H(/@\} .H\|J| . ;@A@"<$\&|J@A;;`@@L??'<;9:@W:;|}H.Hi \@|{|.|IxY;c|P|.AcxHi/|@<8c8K;;`@@\??':@;9W:\||.<|.|}H.|"Hv\;|}.Hhi@|{;cA/A@ 9@9<,9a @K9k/@ IH| 9) B؀ 8! a|}p N ||#x!|}xH >9`H@@H9@^|X|t/@]}BYH/@]|Y>9kH@Aġ^9`P@@H9^ Ui<| /@] } .H/A] | .^9kP@Aġ^ 9`P@@H9^Ui:| ./@]} .H/A]| .^ 9kP@AĀX8!P|N |@&.||+xA|xx!|#x|3x|;x; @/@|zx~Hw/@$;;9;.;ZHH@;9;{;ZH(@(;.;9;;Z;{;@ /A/;@,W :} /^;9;I;9)A/;@,W :|`/[;9;{C;8cAh8!`a#x|}p N /||~x!|+x;@,~xHv;/8`A/;A8`X8!P|N |a̐|zx!|+xc"|#x#$|3x(C&| J|;xA|K(P|cK7Z"z;bPAXW:xz;K |cyA z|\}<;{| | IH:|\|i7@:$"A|IPz |T&|B|BJ8B@(|DP|I~UI:9J|IZ| Y.BxxK!/ApA/AH/AH>|jx8I@(|CP|I^}"R |Q9JB>^"8 8B^"H>|jx8I@,|CP|I~ UI<9J|IZ| [.B>^$8 8B^$HT> |jx8I@,|CP|I~UI:9J|IZ| Y.B> ^&8  8B^&8`X8!P|N |ܐ|~x!|#x|+x|+xKdx|}xxK^">$@&|zx|BJW:|B;"@T^W:x|.Hp/@$x8!pxx|exKXA;@W:A~W$:K8@~@(| P| ~T:8|IZ| Y.B^xxex.K/|}xA|A/AH0/AH$^>"8B~^9)>"K^~8@@| P| ^}"" |!8BHȠ^>$8B~ ^9)>$T&8B~^ 9) >&T:KU^ ~8@@(| P| ~T:8|IZ| Y.Bx8!px|N |ؐ||x!|#x"C$#&@:J^x@ ::H<&\ W:||ZP|IP<|^TB:}H.|X./@xdx8K/APxdx8KU/@xdx8K=/Adxx8Kр\~Ht\x8|.K/AXxdx8K/@xdx8K/A$dxx8Ki\ Tc<~.H;Ax8!p|N |Ԑ|~x!|#x"C$c&|HD"$~Z$&| ~J@ /A@`P@X$\$@H;@Ё~W:<|bX.|H.Hl/@;A8/@|wTc:H[&|zx/A$"\$|/AxxK&/A$"$|/AxxK"Cx"Kݠ""|xxT:\T:$Tc:$|"|2|zK^$$c"|yx"Wc:|\|T:T:&|&||cKY||}xA0xDxx&xxK~/AHX^ALx&xxxDxW:K|xKyDx|xx8!p|HZЀx8!p|N |a|~x!8(|#xHZ~;HZ1~T|| ;^@A;@@(\ W<> ;}K.}KK.@A ;@@(\W:>;}K.}KI. @A"<$\&|JA0W:xHYUx~h8!`a|HYh8!`a|N |@&|BؐA||x!|#x|+x.; A@A/A$H;`K/A4/AHH<";H"$ H"\$<& )H";\$<&|J@@T\W:Cx|.Hh/@,\";`$|@A8@;`@,KD;@A;`K8`Hd>x@x:@--<W:Dx|bH.Hhi/@:A<x~PA A AH0AH(:,H :'H:H;@A/W+:@A|A/AH0/AH$\<"8B|\9)<"K \|;@@|P| \}" |;BHȠ\<$8B| \9)<$T_Bd<_B`<_B\"RT<<_BX/@ |t/|@8;xKŐ||K KɭHD|P/ @4@<8H <8<x8cK!;x8|HdE|~y@(xH/|}xA\/AT/<_"X>~`&Vs<_~&VTVs>~q Vs`>:=.x=0x=<88xH\/A <x88H\/@H(y K<_},<(B ) }) 4\(8B\(Hp/A<_PH <_LxHG .|{x@/@<_H/A}sx}kxVs>~r Vs@>|xHc/@D~/APHF.|{xA@̀<8c܀KiH /@H<_D/Ax~x}{xV>~ V@>|xHb/@D~/A8LHF.|{xA4@,<8cKH /@@yHU.|{x@<_B/AT<_xBXxK.|{xA4<_B@+@<_<BX8c0KQ@@<8cLK9H/A A.@D<8c8HZ9/@(0@|bH+8|ex<8cHH/@L<8c8HY/@00@|bH+8|ex<8cHE|{xH/@/;Ah@/A8A/AH4/AH(<8dH$<8lH<8tH <8|<8cHL.AA/AtH/A/@܀/A,A/AH/A$H;8H4[8< H<[8<TB:|I.Hܩ;8\|IHȨ[< TB<|K.H<_BX/@ xbT<|H0|~xxKu[<TB:|bI.H`@<8cK8`:/A8H0<8cH<8cKH8`,TcHxHE/|}xA /@xH|K)K/@RT/@t|8+;`H^/A ;`HD(;@4;,~8+H^a; /@;`(;AdxxHUH xH x8K8`8!a|}c N |cy|B||@/8AHH /@ 8H4}ISx+ATB:|BZ4p@(} t/.A/*A//A />@ 8cKd/$@p|t/<@`8|3xdUb>}i[x+ATB:|BB4p@(} t/.A/*A//A />@ 8K}Bt/@/8A }`t|P@8c8K|xN |+y||#x!A@8@8ABHAh8!`|N a|+y||}x|#x!A8xHKE/@(h8!`x|x|taKph8!`a|N |@&.|BA!|#x|zx@# /@ i(/AKޱZbȁ: /@ i,/AKމZb: /@LZ D/@$<<88T8a@HL8a@H <8cTK5Zb: 8/@|Z H/@$<<88X8a@HLY8a@H Z%|t/@<8cXK̀Zb8H 4/A/A 8: ,/@| 0/A/A ,H\Z)|t/APZ F/@$<<88p8a@HK8a@H <8cpK-Zb,:Z /@&|t/A| 0/A/A ,HX)|t/APZ F/@$<<88p8a@HK8a@H <8cpKܙZb:Z /@0)|t/@|fx<8cKH)x"x/AP/$@0|t/<@ |t/A/>@H8B/@8}#KxKݨ\:TB:|bI.;x8,HT|{y@4/A,:i4/@  /A 4Zb :@Z|t/@p /@<8cXKQZb܁: ';ӸP~/@8`Hk9؁B<_b?'=?<_8iB}Cx;`;`;@:H/@<8c|HH/|@/x@hxH`/:@H /,@/,@/@4HL/\x@ H / A/ A/ A|}x;H e/ |}x@`/89ؘ/@8\`89 :"HT/@L|t/ A/ A /,@$|t/ A/ A/,A8A 8[sP|]tK/AL/@X|t/@<8cdH Cx8 HJe/@(<8c|KH;P}H9a@ӸP@@<_.Ԍ~+@HH1TbbHTb:|B"4U"b/A@p<8cH |t//@@P<8cKH@<8c HI/A @(<8c|tKYH;@A`P<_;HeTbbHTb:|B"4U"b/@[||tH/;@8`h8!`a|N |@&|BA<_'8B!`B/@P?'9 [|t/A/ =@<<_=Bǐhǔ"K9)"H?'9{+/A |t/@=?'?'9驸|Px>';<_>!@}v[x"ǐ;U}{x:$9x~x}{x=}s[x;\8@A,TB}V|B|t/ @=?'=9)I|t/#@ Kd<_'A@H=?'=!@A@Hǔ9h*}`x @|<_'9)* 9kh| t8!a}#Kx|}p N |B='9k!<_'+B@<8cK8 iX8!P|N |B}H| Ԁ{8cXH*8!xa|N |Ba<_;!p/A<_b/At;@8X8,xH*IAL@xTB,T,`B@8AL8@`AaK|~y@$]8x8,Ԁ{8cXH)8!xa|N |B<_!/AH;@8X8,xH)LxT~LKe/@}x8,8cXH)e8!|N |Ba<_t;!p/A<_p/At;a@8X8,cxH(\cx8ALTj|Bx@`B` AL@K|~y@(]dx8,Ё=Ԁ|8cXH(8!xa|N |Ba<_;!p/Ap<_b/A\;@8X8,xH(-LA@x``BLA@K|~y@ ]x8,Ԁ{8cXH'8!xa|N |B<_!/AH;@8X8,xH'LxdLKa/@}x8,8cXH'a8!|N |Ba?\l|#x!p;B/A`;a@8Xcx8,H'/ALT~H Ld8a@LK|~y@\ldx8,b8cXH&8!xa|N |B}H|=*8`IĀB/M B/@(/@|/M /M )ĀIBT/@/M 8`N |B}H|+A@U":|BZ4pA,K|^x;`H;`TH |^x;`+@xH0 T`(H <_W:Bb})Z 4T(/Ad/,A\/'AT/\AL/:AD?'<;8|K ?'|;xK8'<'8H?'<;8|K+c|?'@,<@Q9=`B}$Kx|^TB>8B0IK|+ @D<9=`̀||^}$KxTB>|T |@PTB>8B0IKM|<@;`B̀||^xTBB |BPTB>8B0]Kx8}|K|cxh8!`a|N |BA<_'!|zxB|#x/A /@ ;@H/@;@?';ޚ@d/@$<8cxK<_'<;š8唀~KY/~;A<~8K9/~;@H/AK/^;AH?'?';ޚ;8;z0<~8Kx~|K/~;@<_'B/A(/A ?'<;8堀}K}<_'B/A(/A ?'<;8娀}Ka}h8!`A|N |Ba|@&>'>'>'>'A9`?'9V9897<_'8!|#xib|uxj|+xh;gKU/?_'z@ ?;3x.At~+Al=?Ub:),|BJ4pAP}*KxxUb>}i[x+ATB:|BR4p@} t/*A /.@~Kĉ~/}`[x??'A|t/%@;A;8Y}|DxH^;|Bt9"+NA,<_U):8Bt| .|| N <      , L d   $     D    $                                  |   X;8Y}|Dx8%H8W"9)/"@<8cHH8T"9)/"@<8c,H$8S"9)/"@<8c@~xKMH;<}8H(;8|;K}<8TK8}|Kـ}<8dH{8;K}<8pHĀ{8;K}<8|Ki}xK<}8KI}xK<8H~}`t}i[x/=A$/+A/-A/*A //@^|@t/pA /c@|t/A/=A{8K݈^/p@L;}8|t|c8cK]AK]8B];H8~K;^|Bt9"+A<_U):8B| .|| N xPd;<}8H<;<}8H(;<}8H;<}8K}H</A(/@ 8H/@8HH{8;KUxK<8䐀}HT{8;K)xK<8䠀}H{8;K}<8Hx;Ke8{Kр}<8H{8;K}<8Hx|t/3A,/2@{8;Ky}<8H@{8;KY}<8H {8;K9}<8K }KH9;I8BH9;I8BIH;<}8KHh;8Y8%}|DxK}~|ctHሾ|dx<8c~xKH$;8Y}|DxKa;}/@(/A;<}8xK-<_?'b,;ޘ}|Ub>}i[x+ATB:|B4p@} t/*A /.@}x~;KK;<}8K}8Y8z|DxK8!<'a|ca}p N |B<!88@8AH/8`@ha@Ub>+AX=?TB:IT|BR4pA+A,TB:|BR4pA}`t}"t@8`h8!`|N +|B!`|#x|~xA+@|#xH#%T`ZH <_T:B$b})Z 4TZ/AL/:A/\?'@$?'8\8\x|DxK-|~x8\x|DxHDW@xH M|dx8a@H!H<x8X8a@Hx8@Kр8!|N |B|#x<8`!|+xKxK̀X8!Px|K|Ba̐|#x!p; |+x!@!AK||xxH:|~:`:::|t;/>@|t//@<_;bTH;=U">+ATB:|BZ4p@} t/.A/*A/<@|t/$@x?'<_;BT;{H <'x8ę{Ke;||x}Ub>}i[x+ATB:|B4p@} t/.A/*A^/AA/\@$|t/^A /,@ H/$@x|t/<@h<_;bTH;>U">+ATB:|BZ4p@} t/.A/*A//A/>A^H$/%@$|t/%@<x8H|@t/%@ /A<_'x8BH<x88D8HH/Ah<;A88x8DxH}/AD<x8T8@8HH]/A$<x8px8@H=/@(x8;H! DH|~xxKH(xK|`yA<x8ڌH<x8ڐ8DH/A <x8ڠ8@H/@Tx8+H |}yA@<x8ٸK@;|t/ADDK]||xH<x8٘8H1/@<x8ڰK;HH<x8,8H/@$/;:@ <x8ڴH<x848H/@$/;:@<x8ڸȞ^|Kx|Bt9"+NA<_U):8B| .|| N <||||||||||XXXXXXXXXX|||||||||||||||||||||||||||||||||||||||||||||l|||||||| <_'x8B8%|DxH@?'8%;xxKu<_||xbTHxx=KU;||x>U">+ATB:|B4p@<}$t8cڼH/AȈ^8`/d@H<x8(H<x8H<x8$H|^|@t/1@ :Hp/2@(/@`/@X<x8:`H8@@8`Hl<x8@H<_'x8B:|DxbKQ||x^/A/|xA @ /8`@ <_'b$8!a|N C9 /A(|Bt|t/T@.|B})C@<`A} p`c||i|cFp|`Pc|cHPN ||#x!|}xKTc:./A8H  8`/A(@ ~xHm/@xX8!P|N |a8L@!|+x|{x|#x@8|x@cxH /xA; @A8`h8!`a|N |cyM /8 M 8N |#x8KȀ $dD #cCN |#y|||x!APxH Հ\|~x@@8|/AxH\||P8`H8`X8!P|N |#y|||x!APxH U|~x@@8|/AxHq| 8`|PH8`X8!P|N /"|B!|#x|~xA /\@8\H +AP+@|#xHT`(H <_T:Bb})Z 4T(/@ / @ H/ @8\8@nH/ @8\8@r^H/@8\8@bK/@8\8@eK+A`W>+@HT`H <_Ti:Bb})Z 4T/A$8\8@^8@^;H$<W>8дxH xHX8!Px|N A|#y|B!||x|+x@<8c0H/@<8c8H/@cxH|~x?'W:;W:||.8K>78"||.|zx8cA@;{|t/A,}xT>K7A;|t/@88@"CCxh8!`A|N 8K|dx8`K|#x|dx8`K|B}HTc h8!`|N |B}h=k|x}9kxN |B}h=k|X}9kXN |B}h=k|8}9k8N |B}h=k|}9kN |B}h=k|}9kN |B}h=k|}9kN |B}h=k|}9kN |B}h=k|}9kN |B}h=k|x}9kxN |B}h=k|X}9kXN |B}h=k|8}9k8N |B}h=k|}9kN |B}h=k| }9k N |B}h=k|(}9k(N |B}h=k|}9kN |B}h=k|}9kN |B}h=k|}9kN |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|x}N |B}h=k|\}N |B}h=k|@}N |B}h=k|$}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|t}N |B}h=k|X}N |B}h=k|<}N |B}h=k| }N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|x}N |B}h=k|\}N |B}h=k|@}N |B}h=k|$}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k||}N |B}h=k|`}N |B}h=k|D}N |B}h=k|(}N |B}h=k| }N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|d}N |B}h=k|H}N |B}h=k|,}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|h}N |B}h=k|L}N |B}h=k|0}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|l}N |B}h=k|P}N |B}h=k|<}N |B}h=k|,}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|h}N |B}h=k|L}N |B}h=k|0}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|l}N |B}h=k|P}N |B}h=k|4}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|X}N |B}h=k|}N |B}h=k|P}N |B}h=k|4}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|p}N |B}h=k|T}N |B}h=k|H}N |B}h=k|,}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|h}N |B}h=k|L}N |B}h=k|0}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|T}N |B}h=k|<}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|t}N |B}h=k|X}N |B}h=k|<}N |B}h=k| }N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|x}N |B}h=k|\}N |B}h=k|@}N |B}h=k|$}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k||}N |B}h=k|`}N |B}h=k|D}N |B}h=k|(}N |B}h=k| }N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|}N |B}h=k|d}N |B}h=k|H}N |B}h=k|,}N |B}h=k|}N |B}h=k |}N |B}h=k |}N |B}h=k |}N |B}h=k |}N |B}h=k |}N |B}h=k |h}N |B}h=k |L}N |B}h=k |0}N |B}h=k |}N |B}h=k |~}N |B}h=k |~}N |B}h=k |~}N |B}h=k |~}N |B}h=k |~}N |B}h=k |~l}N |B}h=k |~P}N |B}h=k |~4}N |B}h=k |~}N |B}h=k |}}N |B}h=k |}}N |B}h=k |}}N |B}h=k |}}N |B}h=k |}}N |B}h=k |}p}N |B}h=k |}T}N |B}h=k |}8}N |B}h=k |}}N |B}h=k |}}N |B}h=k ||}N |B}h=k ||}N |B}h=k ||}N __dyld_mod_term_funcs__dyld_make_delayed_module_initializer_callsThe kernel support for the dynamic linker is not present to run this program. ( ' --------------------------------'/' PROGRAM FIT2D Version: ',a7/' ________________________________'//' Copyright 1987-2003 Andy Hammersley / ESRF (hammersley@esrf.fr)'//'FIT2D: 2-D Detector Calibration/Correction; File re-formatting; 2-D Fitting'//' YOU CAN ALWAYS ENTER: ? '/' FOR FURTHER EXPLANATION OF REQUIRED INPUT'//' No commercial software used ! '/'See "CHANGES" (keyboard menu) for important changes'/)(3l2)('PARAMETERS OF FIT')(' ')('No Quantity Value Error')(a10, ' ', 1pe12.5, 1x, 1pe9.2)(a10,' ',1pe10.3)('Transformation completed')(a1)('INFO: Number of elements in the ADR = ', i10, ', ', i10)('INFO: D-spacing (Angstroms) = ', f12.5)('INFO: Two theta angle (Degrees) = ', f12.5)('INFO: Wavelength (Angstroms) = ', f12.5)('INFO: Energy (keV) = ', f12.5)('MEMORY: ', 2(1pg14.7))('REGISTER 1: ', 2(1pg14.7))('REGISTER 2: ', 2(1pg14.7))('REGISTER 3: ', 2(1pg14.7))('REGISTER 4: ', 2(1pg14.7))('Element ', i2, ' = ', 2(1pg14.7))('RESULT: ', 2(1pg14.7))('INFO: alpha star = ', 1pe12.5, ' degrees')('INFO: beta star = ', 1pe12.5, ' degrees')('INFO: gamma star = ', 1pe12.5, ' degrees')('Value ', i4, ' frequency = ', i6)(' histogram = ', i4, ' probability = ', 1pe12.5)('INFO: Entropy of image (bits per pixel) = ', f12.5)(' Theoretical maximum compression ratio = ', f12.5)('INFO: Weighted mean value of frequency histogram = ', f14.7)(' Standard deviation of frequency histogram = ', f14.7)('Number of escaped pixels = ', i10)('Value ', i4, ' code length = ', i3, ' Code = ', a)('INFO: Escape symbol: Code = ', a)('INFO: Huffman code bit rate (bits per pixel) = ', f12.5)(' Huffman code compression ratio = ', f12.5)(' Huffman code efficiency = ', f6.2, '%')('INFO: Active data region minimum value = ', g14.7)(' Active data region maximum value = ', g14.7)('INFO: Program arrays have ', i10, ' elements in the X-direction')('INFO: Program arrays have ', i10, ' elements in the Y-direction')('INFO: Current data; number of defined elements in the X-direction ', i10)('INFO: Current data; number of defined elements in the Y-direction ', i10)('INFO: Start element of ADR in the X-direction is ', i10)('INFO: Start element of ADR in the Y-direction is ', i10)('INFO: End element of ADR in the X-direction is ', i10)('INFO: End element of ADR in the Y-direction is ', i10)('INFO: Memory; number of defined elements in the X-direction ', i10)('INFO: Memory; number of defined elements in the Y-direction ', i10)('INFO: Start element of memory ADR in the X-direction is ', i10)('INFO: Start element of memory ADR in the Y-direction is ', i10)('INFO: End element of memory ADR in the X-direction is ', i10)('INFO: End element of memory ADR in the Y-direction is ', i10)('INFO: There are currently ', i2, ' active data regions stored internally')(' ', i2, ': ', a70)('%!*\')('%!*\ Message text (up to 100 lines)')('\\')('%!*\ End of message text')('INFO: Estimated distance error at transformation coordinates = ', f8.4)('INFO: Time for transformation = ', f12.2, ' seconds')(' Maximum element value = ', 1pe12.5)('INFO: Scaling factor = ', g14.5)('INFO: Offset = ', g14.5)('Data coordinate = (', g12.5,',', g12.5,')')('Pixel = (', i5,',', i5,')')('Pixel intensity = ', g12.5)('Average 3*3 intensity = ', g12.5)('Average 5*5 intensity = ', g12.5)('d spacing (order = 1) = ', 1pg10.5, ' Angstroms')('d spacing (order = 2) = ', 1pg10.5, ' Angstroms')('d spacing (order = 3) = ', 1pg10.5, ' Angstroms')('%!*\ Definition of interactive input of a value')('%!*\ Data value type')('%!*\ User prompt')('%!*\ Give default')('%!*\ Default value')('%!*\ Range limits')('%!*\ Help text (up to 100 lines)')('%!*\ Program variable')('%!*\ End of Definition')('INFO: Unit cell volume = ',1pe12.5, ' cubic Angstroms')('INFO: a star = ', 1pe12.5,' Inverse Angstroms')('INFO: b star = ', 1pe12.5,' Inverse Angstroms')('INFO: c star = ', 1pe12.5,' Inverse Angstroms')('INFO: alpha star = ',1pe12.5, ' degrees')('INFO: beta star = ',1pe12.5, ' degrees')('INFO: gamma star = ',1pe12.5, ' degrees')('INFO: Reciprocal cell volume = ', 1pe12.5, ' cubic Inverse Angstroms')('INFO: a = ', 1pe12.5, ' Angstroms')('INFO: b = ', 1pe12.5, ' Angstroms')('INFO: c = ', 1pe12.5, ' Angstroms')('INFO: alpha = ', 1pe12.5,' degrees')('INFO: beta = ', 1pe12.5,' degrees')('INFO: gamma = ', 1pe12.5,' degrees')('INFO: CPU time (seconds) for transformation = ', f7.2)(' Elapse time (seconds) for transformation = ', f7.2)(a)('INFO: Sequence counter value = ', i8)('ENTER COEFFICIENT ', 2i2)('Enter value of convolution coefficient ', 2i2)('INFO: Data Coordinate limits: Min ( ', 1pg10.2, ' , ', 1pg10.2, ')')('INFO: Data Coordinate limits: Max ( ', 1pg10.2, ' , ', 1pg10.2, ')')('INFO: Pixel number limits: Min ( ', i5,' , ', i5, ') Max (', i5, ' , ', i5, ')')('INFO: Total number of data values = ', i6, ' * ', i6, ' = ', i10)('INFO: Minimum data value = ', g12.5)('INFO: Maximum data value = ', g12.5)('INFO: Average (mean) data value = ', g12.5)('INFO: Sum of data values = ', g12.5)('INFO: Root mean square (RMS) value = ', g12.5)('INFO: Standard deviation value = ', g12.5)('INFO: Skewness parameter = ', g12.5)('INFO: Achieved RMS closeness of fit = ', g14.7)('Scaling constant = ', g12.5)('Scaling constant can not be calculated ')(i3)('PCH',i2,'X',i2,'Y')('GAU', i2, ' XCe')('GAU',i2, ' YCe')('GAU', i2, ' MAX')('GAU', i2, ' 1SD')('GAU', i2, ' 2SD')('GAU', i2, ' ANG')('GAU', i2, ' INT')('X-CEN SYM')('Y-CEN SYM')('PGa',i2, ' XCe')('PGa',i2, ' YCe')('PGa', i2, ' MAX')('PGa', i2, ' RAD')('PGa', i2, ' ANG')('PGa', i2, ' INT')('TPG', i2, ' XCe')('TPG', i2, ' YCe')('TPG', i2, ' MAX')('TPG',i2, ' RAD')('TPG', i2, ' ANG')('TPG', i2, ' MX2 ')('TPG', i2, ' In1')('TPG', i2, ' In2')('ROW', i2, ' LOW ')('ROW', i2, ' HIG ')('ROW', i2, ' XCe')('ROW', i2, ' YCe')('ROW', i2, ' ANG')('ROW', i2, ' PPa')('ROW', i2, ' PSh')('ROW', i2, ' Rat')('ROW', i2, ' SDR')('ROW', i2, ' SDA')('ROW',i2, 'I', i3)('INFO: Number of function calls = ', i8)('INFO: Sum of squares = ', g14.5)('ROW',i2,'I',i3)('INFO: Zoom pixel region = ', i6, ': ', i6)('INFO: Zoom pixel region = (', i6, ', ', i6, ') to (', i6, ', ', i6, ')')('INFO: Number of correctly input images = ', i6)('INFO: Required size for internal arrays = ', i6, ' * ', i6, ' pixels')('extension = ', a)('POL ', i2)('GAU', i2, ' POS')('LOR', i2, ' POS')('LOR', i2, ' INT')('VOI', i2, ' POS')('VOI', i2, ' INT')('VOI', i2, 'FWHM')('LOR', i2, ' MAX')('VOI', i2, ' MAX')('GAU', i2, ' SD')('LOR', i2, 'HWHM')('VOI', i2, ' SD')('VOI', i2, 'HWHM')('EXP', i2, ' POS')('EXP', i2, ' MAX')('EXP', i2, ' H-L')('TRI', i2, ' POS')('TRI', i2, ' AMP')('TRI', i2, ' PER')('INFO: Best fit radius 1, radius 2 (mm) = ', 2g14.7)('INFO: Best fit radius 1, radius 2 (X-pixels) = ', 2g14.7)('INFO: Best fit angle of axis 1 (degrees) = ', g14.7)('INFO: Estimated coordinate radial position error (mm) = ',g14.7)('INFO: Estimated coordinate radial position error (X pixels) = ',g14.7)('INFO: Best fit radius (mm) = ', g14.7)('INFO: Best fit radius (X-pixels) = ', g14.7)('INFO: Beam/symmetry centre (mm) = (', g14.7, ',', g14.7, ')')('INFO: Beam/symmetry centre (pixels) = (', g14.7, ',', g14.7, ')')('INFO: Best fit centre X / Y (mm) = ', 2g14.7)('INFO: Best fit centre X / Y (pixels) = ', 2g14.7)('INFO: Number of acceptable coordinates on ring = ', i3)('INFO: Estimated sample to detector distance = ', f12.3, ' mm')('INFO: Initial wavelength, based on fixed distance = ', f8.5,' Angstroms')('INFO: Refined Beam centre = ', 2f12.3, ' (pixels)')('INFO: Refined Beam centre = ', 2f12.3, ' (mm)')('INFO: Refined sample to detector distance = ', f12.3, ' mm')('INFO: Refined wavelength = ', f12.5, ' Angstroms')('INFO: Refined tilt plane rotation angle = ', f12.3, ' degrees')('INFO: Refined tilt angle = ', f12.3, ' degrees')('INFO: ROT X = ', f12.3, ' ROT Y = ', f12.3, ' degrees')(' Energy (keV) = ', f12.5)('INFO: Stability indicator (proportional to D-spacing; Angstroms) = ', f10.5)('INFO: Refined polarisation factor = ', f8.5)('INFO: Number of acceptable coordinates on first ring = ', i3)('INFO: Number of coordinates = ', i3)('INFO: Best fit ellipse centre (X/Y mm) = ', 2g14.7)('INFO: Best fit ellipse centre (X/Y pixels) = ', 2g14.7)('INFO: Best fit radius 1 (X pixels) = ', g14.7)('INFO: Best fit radius 2 (Y pixels) = ', g14.7)('INFO: Estimated coordinate radial position error (mm) = ', g14.7)('INFO: Estimated coordinate radial position error (X pixels) = ', g14.7)('INFO: Best fit beam centre (X/Y mm) = ', 2g14.7)('INFO: Best fit beam centre (X/Y pixels) = ', 2g14.7)('INFO: Cone ', i2, ' best fit 2 theta angle (degrees) = ', g14.7)('INFO: Best fit angle of tilt plane rotation (degrees) = ', g14.7)('INFO: Best fit angle of tilt (degrees) = ', g14.7)('Meridian angle (degrees) = ', f12.5)('y_min, y_max = ', 2i6)(3i6)('INFO: Time taken for search = ', f7.2, ' seconds')('INFO: Number of peaks found = ', i6)('INFO: Number of saturated peaks found = ', i6)('INFO: Number of bad "peaks" found = ', i6)(' X Y INTENSITY SIGMA D (Angstroms) ')(2f10.1, 2f12.1, f9.3)('INFO: Average I / Sigma(I) of found peaks = ', f10.2)(' ', f5.1, ' to ', f5.1, ': ', i5)(' ', f5.1, ' to ', f5.1, ': ', i6, f8.2)('INFO: Energy = ', g14.5, ' keV')('INFO: Wavelength = ', g14.5, ' Angstroms')('INFO: Average pixel size in X-direction = ', f12.4, ' +- ', f10.4, ' microns')('INFO: Average pixel size in Y-direction = ', f12.4, ' +- ', f10.4, ' microns')('INFO: Overall average pixel size = ', f12.4, ' +- ', f10.4, ' microns')('INFO: RMS pixel size in X-direction = ', f12.4)('INFO: RMS pixel size in Y-direction = ', f12.4)('INFO: Average rotation based on rows = ', f12.6, ' +- ', f10.4, ' degrees')('INFO: Average rotation based on columns = ', f12.6, ' +- ', f10.4, ' degrees')('INFO: ', f12.6, ' +- ', f10.4, ' degrees')(' (', f8.2, ', ', f8.2, ') to (', f8.2, ', ', f8.2, ')')('INFO: Starting peak is at position ', 2f12.5)('INFO: Next first grid axis peak is at position ', 2f12.5)('INFO: Next second grid axis peak is at position ', 2f12.5)('INFO: Number of grid peaks (X/Y) = ', 2i6, ' (', i8, ')')('INFO: Time taken = ', g10.2, ' seconds')('xmaxdat, xmax_lut = ', 2i6)('INFO: The corrected pixel dimension in X is ', f12.4, ' microns')('INFO: The corrected pixel dimension in Y is ', f12.4, ' microns')('INFO: Time for correction = ', f12.2, ' seconds')('INFO: CPU Time for correction = ', f12.2, ' seconds')('INFO: Maximum correction factor = ', f9.5)('INFO: Position/Distortion = ', 4f12.4)(' The rank deficiency = ', i6)('INFO: Number of horizontal/ vertical true knot points = ', 2i5)('INFO: Average position discrepancy = ', 1pe12.5)(4e14.7)(3e14.7)(2i6)(e14.7)('xnum_lut, ynum_lut = ', 2i8, ' xnumdat, ynumdat = ', 2i8)('X_PIXEL_SIZE = ', 1pe14.7)('Y_PIXEL_SIZE = ', 1pe14.7)('X_NUMBER = ', i12)('Y_NUMBER = ', i12)('BYTES_PER_PIXEL_LUT = ', i12)('FLAT_FIELD_STORED = ', l1)('FF_OFFSET = ', 1pe14.7)('FF_SCALING = ', 1pe14.7)(' X-direction shift relative to the previous pixel = ', i6)(' Y-direction shift relative to the previous pixel = ', i6)('ERROR: The sum of the fractions is not 255 at pixel ', 2i6)(' Sum of output fractions = ', i5)('WARNING: Problem closing file: Return status = ', i6)('DISTORTION FUNCTION FROM IDEAL TO DISTORTED GRID, MEASURED ON IDEAL')('SPATIAL DISTORTION SPLINE INTERPOLATION COEFFICIENTS')(' System dependent error code = ', i6)()(' VALID REGION')(' GRID SPACING, X-PIXEL SIZE, Y-PIXEL SIZE')(' X-DISTORTION')(5e14.7)(' Y-DISTORTION')('Peaks positions and estimated distortions for a ', i6, ' times ', i6, ' grid')(' X-PEAK Y_PEAK X-POSITIONS Y-POSITIONS X-DISTORTIONS Y-DISTORTIONS ')(2i8, 1x, 4(1pe14.7, 1x))('INFO: Number of rows calculated = ', i6, ' (',i3, '%)')('INFO: Time for creation of LUT = ',f12.2, ' seconds')('INFO: CPU Time for creation of LUT = ', f12.2, ' seconds')('WARNING: ', i10, ' triangles have been ignored, because they require')('INFO: Number of rows treated = ', i6, ' (', i3, '%)')('INFO: RMS residual = ', g14.5)('PARAMETER NUMBER ', i3, 1x, a, 1x, a,' Value = ',g14.5)('INFO: Total number of elements in active data region = ', i8)(' Number of masked elements = ', i8)(' Number of unmasked elements = ', i8)(' Percentage of masked elements = ', f11.8)('INFO: The current pixel coordinates for the beam centre = ', 2f10.3)('INFO: The current pixel sizes (microns) = ', 2f10.3)('INFO: The current sample to detector distance (millimetres) = ', f10.3)('INFO: The rotation angle of the tilt plane = ', f8.3)('INFO: The tilt angle of the detector = ', f8.3)('Must be within set bounds')('Enter new scale size for parameter')('Please give an acceptable input')('ILLEGAL COMMAND, PLEASE RE-ENTER')('Must be within set limits')('INFO: Distance between coordinates = ', f9.2, ' pixels')('INFO: Distance between coordinates = ', g14.7, ' millimetres')('Extremes of polygon (X/Y min, X/Y max) = ')(4f10.2)('Number of pixels inside polygon = ', i8)('Smallest value = ', 1pg12.5, ' Largest value = ', 1pg12.5)('Total intensity = ', 1pg12.5, ' (square root = ', 1pg12.5, ')')('Average intensity = ', 1pg12.5)('Root Mean Square (RMS) value = ', 1pg12.5)('Standard Deviation = ', 1pg12.5, ' Gain (?) = ', 1pg12.5)('Integrated intensity minus previous average = ', 1pg12.5)('Square root of above = ',1pg12.5)('INFO: ', a)(' ', a)('INFO: Data coordinate = (', g12.5,',', g12.5,')')(' Pixel = (', i5,',', i5,')')(1pe10.3)(i7)('INFO: Number of pixels equal and above threshold value = ', i12)('INFO: Number of rows treated = ', i6, ' (',i3, '%)')('INFO: Minimum fractional intensity decrease owing to polarisation = ', f7.4)('SCALE FACTOR = ', g14.7)('FITTED PARAMETERS')('No Quantity Value')(a10, ' ', 1pe12.5)(a10, ' ', 1pe10.3)(' Sum of squares = ', g14.7)(' RMS mis-fit per data element = ', g14.7)(' R_p = ', f7.2, '%')('INFO: X-centre = ', g14.7, ' (pixels)')(' Y-centre = ', g14.7, ' (pixels)')(' Gaussian peak intensity = ', g14.7)(' Angle of first axis = ', g14.7, ' (degrees))')(' Sigma of first axis = ', g14.7, ' (pixels))')(' Sigma of second axis = ', g14.7, ' (pixels))')(' Background average intensity = ', g14.7)('ERROR: num_sections, max_coordinates = ', 2i8)('INFO: Ring ', i2, ', Number of coordinates = ', i3)('ring, azimuth, intensity = ', i3, 2g14.5)('INFO: The search distance either side of the powder rings (mm) = ', f7.3)('INFO: The search distance either side of the powder rings (X-pixels) = ', f7.2)('INFO: Radius of powder ring ', i2, ' (mm) = ', f10.3)('INFO: Radius of powder ring ', i2, ' (X-pixels) = ', f10.3)('INFO: Time for calculation = ', f12.2, ' seconds')('Order = ', i3, ' residual = ',1pe12.5)('INFO: Number of rows re-binned = ', i6, ' (',i3, '%)')('WARNING: ', i10, ' input pixels have been ignored, because they require')('INFO: Lowest X-distortion = ', e12.5,' at grid position (X/Y) ', 2i4)('INFO: Highest X-distortion = ', e12.5,' at grid position (X/Y) ', 2i4)('INFO: Lowest Y-distortion = ', e12.5,' at grid position (X/Y) ', 2i4)('INFO: Highest Y-distortion = ', e12.5,' at grid position (X/Y) ', 2i4)('Ready for input of Lorentz Geometry')(1x,'INTENSITY ORDER ',i3)('INFO: Number of function calls = ', i6)('INFO: Number of function calls = ', i7)('INFO: Number of rejected coordinates = ', i5)('PANIC: SQRT OF NEGATIVE TO CALCULATE SIGMA !')('sum, sum_squared, term num_pixels = ', 3(1pe14.5), i6)('INFO: Found ', i6, ' peaks')('INFO: Time for operation = ', f12.2, ' seconds')('Columns of numbers for data-set ', i2)('Line: ',i5, ' of file, column of numbers: ',i2,' could not be found (set to zero)')('Line: ',i5, ' of file, column of numbers: ',i2, ' could not be converted (set to zero)')('Line: ',i5, ' of file, column of numbers: ',i2, ' could not be found (set to zero)')('INFO: ',i4,' X/Y coordinates per data-set have been found')rbwbWARNING: End of file encouteredWARNING: %i bytes input instead of %i requested WARNING: Input file is not openfio_filewritec: errno = %i ERROR: fio_filewrealc: errno = %i (' Start Step End Monitor')(3f9.3, ' 1.0')(10f8.4)(10i8)(' -1000')(' -10000')('File array size = ', 2i10)(' on line ', i5, ' of input file')('INFO: Number of values input = ', i10, ' (',i3, '%)')(' Keyword = ', a50)(' Value = ', a50)('INFO: Full image size = ', i9, ' * ', i9, ' pixels')('WARNING: File open status = ', i6)('ERROR: Failed to open: ', a)('INFO: Data-set ("memory")', i2, ' contains ',i2, ' image(s) of ', i6, ' x ', i6, ' pixels')(' ', a)(i8)('INFO: Size of image = ', i8, ' times ', i8, ' pixels')('WARNING: Only ', i8, ' X/Y coordinates have been found')(i6)('INFO: The file contains one image (frame) of ', i6, ' * ', i6, ' pixels.')('INFO: The file contains ', i4, ' images (frames) of ', i6, ' * ', i6, ' pixels.')(' Each pixel is stored using ', i2, ' bits.')('INFO: Image X-offset = ', i5)('INFO: Image Y-offset = ', i5)('INFO: Size of image = ', i5, ' * ', i5)('INFO: Number of bits per pixel = ', i5)('INFO: Time for input = ', f12.2, ' seconds')('INFO: CPU Time for input = ', f12.2, ' seconds')('INFO: "Image" number ', i8, ' has been found, continuing search ...')(' "Image" number ', i8, 'was the last found')(10f8.0)('WARNING: Only ', i4, ' X/Y coordinates have been found')('INFO: Number of stored images = ', i5)('INFO: The file contains ', i12,' bytes')('INFO: There appears to be ', i1,' bytes per pixel')('INFO: The mean value of the "0" sequence bytes = ', f8.3)('INFO: The mean value of the "1" sequence bytes = ', f8.3)('INFO: The mean value of the "2" sequence bytes = ', f8.3)('INFO: The mean value of the "3" sequence bytes = ', f8.3)('INFO: The standard deviation of the "0" sequence bytes = ', f8.3)('INFO: The standard deviation of the "1" sequence bytes = ', f8.3)('INFO: The standard deviation of the "2" sequence bytes = ', f8.3)('INFO: The standard deviation of the "3" sequence bytes = ', f8.3)('INFO: There appears to be ', i4,' bytes per pixel')('INFO: There appears to be ', i6,' pixels per row')('INFO: The file size corresponds exactly to a ', i6, ' x ', i6, ' pixel image')('INFO: The file is a maximum of ', i6, ' rows, with at least', i10)(3(g15.8))(i12)('INFO: Data region is ', i6, ' * ',i6, ' pixels')('INFO: Data minimum value = ', g14.7)('INFO: Data maximum value = ', g14.7)('CDD V01.00A X NUMBER =', i8, '; Y NUMBER =', i8, '; DATA (C1) =')('ERROR: NOT IMPLEMENTED')(i11, ' Errors')(i11)(4(1pe14.7, 1x))(2(1pe14.7, 1x))('WARNING: Error during file output: System dependent status = ', i6)('BANK', 3i5, 1x, a, 4f10.5, ' STD')(i2, f6.0)(' Return status = ', i6)('INFO: Time for output = ', f12.2, ' seconds')('INFO: CPU Time for output = ', f12.2, ' seconds')('INFO: Compression ratio = ', f8.4)('INFO: Data region is ', i6, ' * ', i6, ' pixels')('INFO: Minimum data value = ', 1pg12.5)('INFO: Maximum data value = ', 1pg12.5)(8f10.3)('# Powder CIF file created by FIT2D')('data_', a)('_audit_creation_method "From 2-D detector using FIT2D"')('_diffrn_radiation_wavelength ', f10.6)('_diffrn_radiation_wavelength ?')('# Scan information')('_pd_meas_scan_method fixed ')('_pd_meas_2theta_range_min ', f11.6)('_pd_meas_2theta_range_max ', f11.6)('_pd_meas_2theta_range_inc ', f11.6)('# 2-Theta Scan Data')('loop_')(' _pd_meas_intensity_total')(' ', 1pe14.7)('_pd_meas_number_of_points', i7)('#--eof--eof--eof--eof--eof--eof--eof--eof--eof--eof--eof--eof--eof--eof--eof--#')('INFO: The ASCII file created will be of size ', i12, ' bytes')(2i8, ' Start pixel = (', 2i8, ')')('INFO: File item not found: ', a)('ERROR: Problem reading file. Operating system error code = ', i8)Image size = %i by %i pixels predictor, min_symbol, max_symbol = %i %i %i ('WARNING: Bad TIFF file, tiff version = ', i12)('WARNING: Un-supported number of bits per pixel (', i2, ')')('WARNING: Bad TIFF file, tiff version = ', i10)(' ', 8i5)(' Sample to detector distance = ', f7.2, ' mm ')(' Wavelength is = ', f9.4, ' Angstroms')(' Phi angle at the start of the oscillation = ', f7.3, ' degrees')(' Phi angle at the end of the oscillation = ', f7.3, ' degrees')('WARNING: Invalid Overloaded pixel address: ', i14)('Name of binary file containing image data = ', a)('Number of pixels (horizontal/vertical) = ', 2i10)('Integer data: Number of bytes per pixel = ', i2, ' ', a)('The data has been written in "big endian" format. (Normal for HP/SUN/SG)')('The data has been written in "little endian" format. (Normal for VAX/PCs)')('Nominal horizontal pixel size = ', f12.3, ' (microns)')('Nominal vertical pixel size = ',f12.3, ' (microns)')('Pixel number of first output pixel (pixel offsets) = ', 2i10)('Title = ', a)('X-axis label = ', a)('Y-axis label = ', a)('Z-axis label = ', a)('Input data value scaled to lowest file value = ', 1pe14.7)('Input data value scaled to highest file value = ', 1pe14.7)('Record length = ', i8, ' (bytes); First output record = ', i8)('Records have been padded out. ')('WARNING: TIFF Integer tag contains ',i8, ' values') CCP4 packed image, X: %04d, Y: %04d ('GRAPHICAL MENU: ', a)('(NOTE: Graphical user interface controlled text output of the following text)')('(NOTE: End of GUI controlled text output)')('O.K.')('SAVE')('GS_SET_IDR: Bad image data region')('xminidr = ', g10.3)('yminidr = ', g10.3)('xmaxidr = ', g10.3)('ymaxidr = ', g10.3)(' (Range: ',a,' to ',a,')')('(Enter ', i4, ' coordinates)')('INFO: Graphical coordinate = ', 2g14.7)(1pe14.7)('GRAPHICAL INPUT:', 2(1pe14.7))('GUI: FILE SELECTION')('')('FILE = ', a)('GRAPHICAL PROMPT: ', a)('GRAPHICAL INPUT: ')('GRAPHICAL INPUT: ', a)('GRAPHICAL INPUT: ', 2(1pe14.7))('ERROR: GS_TEXTSTYLE: char_height = ', f10.3)('ERROR: GS_TITLE: char_height = ', f10.3)('ERROR: GS_XLABEL: char_height = ', f10.3)('ERROR: GS_YLABEL: char_height = ', f10.3)('WARNING: GUI WARNING MESSAGE')('WARNING: END OF GUI WARNING MESSAGE')(' Fortran I/O status return value (IOSTAT) = ', i8)('ERROR: z_min, z_max = ', 2g14.7)('ERROR: GS_LINAXENUM: scale_factor_char= ', f10.3)(i2, ' % COMPLETE')('Curve ',i3)('font_index = ', i6)('ERROR: LG_DATAWINDOW:'))(' x_min_wc, x_max_wc = ', 2(1pe12.5))('LG_INQ_SCALING: ERROR')('lg_wc_xmax = ', 1pe14.7)('lg_wc_xmin = ', 1pe14.7)('lg_wc_ymax = ', 1pe14.7)('lg_wc_ymin = ', 1pe14.7)('Error: colour_index = ', i10)('colour_index = ', i6)StaticGrayGrayscaleStaticColourPseudoColorTrueColorDirectColorLight Graphics X-11 WindowLG X-11LG GraphicsFIT2D/CHIPLOT GraphicsWARNING: Failed to open X-11 displayINFO: Only %i contiguous colour cells can be allocated in the default colour table. A separate colour table is being created, you may notice colour "flash".NOTE: Display uses 'TrueColor' colour mapping with %i bits. Image byte order is LSBFirstImage byte order is MSBFirstImage bitmap bit order is LSBFirstImage bitmap bit order is MSBFirstServer BitmapUnit = %i bits, BitmapPad = %i bits red_mask = %X, green_mask = %X, blue_mask = %X, bits_per_rgb = %i Image Byte swapping is necessaryImage Byte swapping is not necessaryByte swap images because its Hummingbird eXceed ERROR: Display uses a colour mapping which is not presently supported. Default colour mapping: Depth = %i bits, Class = %s Default Depth = %i bits 8-bit plane 'PseudoColor' and 24-bit plane 'TrueColor' are presently supported.WARNING: Structure allocation for windowName failed.WARNING: Structure allocation for iconName failed.BasicwinFont not availableWARNING: Problem creating pixmap for text outputProblem obtaining copy of basic text (probably the window is not visible)clR4x65x7timR2412x24timR085x86x9timR106x10timR126x127x13timR147x149x158x16timR1810x20Note: Font at height %i points out found, using X-11 font 6x10 instead WARNING: X-11 font 6x10 not found, trying 9x15 insteadERROR: Cannot open 6x10 nor 9x15 fonts, text cannot be output to the X-11 screen. You may be able to 'load' the necessary fonts, or change the font path. See your system administrator or local X-11 guru. Ideally the TIMES-ROMAN series of fonts should be available.X=99999, Y=99999, I=-9.999999e-99X=%5i, Y=%5i, I=%gERROR: X-11 Error code: %s WARNING: Structure allocation for window_title failed.(i4, ' 0 translate 90 rotate')('/pl_r 0 def /pl_g 0 def /pl_b 0 def /pl_w ', i4, ' def /pl_t 0 def')('/pl_g 0 def /pl_w ', i4, ' def /pl_t 0 def')('/pm_r 0 def /pm_g 0 def /pm_b 0 def /pm_t 5 def /pm_s ', i4, ' def/pm_w ', i4, ' def')('/pm_g 0 def /pm_t 5 def /pm_s ', i4, ' def/pm_w ', i4, ' def')('/setlinejoin 1 def /dash', i4, ' def /dot ', i4, ' def /gap ', i4, ' def')(i4, ' 1 tf')(3z2.2)('/pixel_string ', i5, ' string def % String to hold line of pixels')('/rgb_string ', i5, ' string def % String to hold line of rgb values')(4i6, 2i5, ' ca')(z2.2)(6i5, ' ca')ERROR: LG_X11_RMCA failed to allocate %i bytes bytes_per_line = %i y_height_pixels = %i ERROR: Scaling range unacceptableERROR: Log Scaling range unacceptable minimum = %f, maximum = %f ('x_start_element, x_end_element, x_max = ', 3i8)('y_start_element, y_end_element, y_max = ', 3i8)('WARNING: Problem fitting coordinates: SURFIT Error status = ', i6)('num_coordinates, max_coordinates = ', 2i6)('xnum_knots wrong')('max_coefficients too small')('xstrelm, xendelm problem')('xmax_work too small')('Three vertices in the same side in MA_CAL_TRILINE')('This should not happen !!!!!')('Two vertical pixels')('Three vertical pixels')('Two horizontal pixels')('Three vertices in the same side in MA_CAL_TRILINES')('Three horizontal pixels')('INFO: Iteration = ', i6, ' Sum of squares = ', g14.7)('INFO: Iteration = ', i6)('INFO: Average mis-fit per element = ', g14.7)('INFO: Sum of squares = ', g14.7)('IO_OPEN_ASCIIFILE retstat = ', i6)('DATABASE DEFAULT VALUES FILE')('!!! DO NOT ALTER YOURSELF !!!')('---',i2.2,'%---(This is NOT more)--- = Next "page" --- ? = help ------:')('WARNING: Unknown value for the status variable; value = ', i14)('%!*\ END OF IO MACRO FILE')(' [',a,']')(' [YES]')(' [NO]')('%!*\ BEGINNING OF GUI MACRO FILE')('%!*\ BEGINNING OF IO MACRO FILE')('%!*\ This is a comment line')(a,$)('(i', i1, ')')('(i', i2, ')')('(f', i1, '.0)')('(f', i2, '.0)')(i2)(i4)(i5)(i9)(i10)(i1)(1pe13.6)(f9.2)(f9.3)(f9.4)(f9.5)(f9.6)('0.0')(1pe12.6)(f8.6)(f8.5)(f8.4)(f8.3)(f8.2)('record_length = ', i6)('num_bytes = ', i6)(f40.20)(1pe40.20)ERROR: Number of CPU clock ticks per second is unknown(f12.7)(f11.7)(f12.8)(f13.9)(f11.9)(f11.8)WARNING: in io_directoryc.c from stat: EACCES Problem file/directory = %s WARNING: in io_directoryc.c from stat: EBADFWARNING: in io_directoryc.c from stat: ENAMETOOLONGERROR: in io_directoryc.c from stat: ENOTDIRERROR: in io_directoryc.c from stat: unknown ??...(' Operand value = ', i14)(' Operand value = ', 1pe14.7)('ERROR: There are ', i3, ' open "DO" loops')(' Line number = ', i8)('SURFIT ERROR: eps is incorrectly defined')('SURFIT ERROR: kx is incorrectly defined')('SURFIT ERROR: ky is incorrectly defined')('SURFIT ERROR: iopt is incorrectly defined')('SURFIT ERROR: m is too small wrt kx and ky')('SURFIT ERROR: nxest is out of range')('SURFIT ERROR: nyest is out of range')('SURFIT ERROR: lwrk1 is too small')('SURFIT ERROR: kwrk is too small')('SURFIT ERROR: xb >= xe')('SURFIT ERROR: yb >= ye')('SURFIT ERROR: Zero or negative weight')('SURFIT ERROR: X-coordinate out of range')('SURFIT ERROR: Y-coordinate out of range')('SURFIT ERROR: nx out of range')('SURFIT ERROR: ny out of range')('SURFIT ERROR: s negative')unknown code in do_fio: %d %.*s do_fiofmtformat too complicated: bad stringinwriterecendendfileI/O recursionstartintSTOP statement executed bad repetition countexponent fieldinvalid integere%ldinvalid numberlist incomplex formatundelimited character stringno )no spaceno starlreadno real partno commano imaginary partlogicallist iostlerlioread starts_catstartiosfewrite startwr+br+rmalloc failurefort.%ldopenTMPDIR/tmp.FXXXXXXTEMP/tmpsdfuDIRECTYESFORMATTEDNOZERONULLSEQUENTIALUNKNOWNUNFORMATTEDrewinddo_uddo_ussyserrcdueduebackspace4.3TERMOAOBOCODOHOFerror in formatillegal unit numberformatted io not allowedunformatted io not alloweddirect io not allowedsequential io not allowedcan't backspace filenull file namecan't stat fileunit not connectedoff end of recordtruncation failed in endfileincomprehensible list inputout of free spaceread unexpected characterbad logical input fieldbad variable typebad namelist namevariable not in namelistno end recordvariable count incorrectsubscript for scalar variableinvalid array sectionsubstring out of boundssubscript out of boundscan't read filecan't write file'new' file existscan't append to filenon-positive record numberI/O started while already doing I/OTemporary file name (TMPDIR?) too long%s: %s apparent state: unit %d named %s (unnamed) last format: %.*s %s: illegal error number %d apparent state: internal I/O readingwritingsequentialdirectformattedunformattedexternalinternallately %s %s %s %s IO%s: end of file (libf2c f__fatal already called, aborting.)KilledInterruptQuit signalTrace trapIOT TrapFloating Exception%s rd_ned, unexpected code: %d rd_ed, unexpected code: %d 0123456789ABCDEFleft offw_ned, unexpected code: %d w_ed, unexpected code: %d malloc(%u) failure in %s %s: out of virtual memory xmallocxrealloc/-_=~.#$~C-\M-INPUTRC~/.inputrcreadline: %s: line %d: %s readline: %s Control-C-CTRL-MetaM-otherterm=mode=emacsvi$else found without matching $if$endif without matching $ififendifelseincludeunknown parser directiveno closing `"' in key bindingsetprefix-metablink-matching-parenbyte-orientedcompletion-ignore-caseconvert-metadisable-completionenable-keypadexpand-tildehistory-preserve-pointhorizontal-scroll-modeinput-metamark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmeta-flagoutput-metapage-completionsprefer-visible-bellprint-completions-horizontallyshow-all-if-ambiguousvisible-statsbell-stylecomment-begincompletion-query-itemsediting-modeisearch-terminatorskeymaponnoneoffaudiblevisibleDELESCEscapeLFDNewlineRETReturnRuboutSPCSpaceTabemacs-standardemacs-metaemacs-ctlxvi-movevi-commandvi-insert\M-\C-%c\C-?# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on , . "%s"%s... "%s%s": "%s" %s%s outputs %s set %s %s %s is set to `%s' set bell-style %s bell-style is set to `%s' #set comment-begin %s comment-begin is set to `%s' set completion-query-items %d completion-query-items is set to `%d' set editing-mode %s editing-mode is set to `%s' set isearch-terminators "%s" isearch-terminators is set to "%s" set keymap %s keymap is set to `%s' COLUMNScoLINESli@7DCICceclcrdceiicimkHkIkdkekhklkrkskulemmmopcupvbvsvedumb amxnkmMT\%o readline: debug: insert_some_chars: count (%d) != col (%d) (arg: %d) POSIX hl^$0ftFT;,%wbeWBE|_*\AaIiCcDdPpYyRrSsXx~ l|h^0bB l|hwW^0bB l|h^0%bB "\'`@$><=;|&{("'--More--/Display all %d possibilities? (y or n) readline: bad value %d for what_to_do in rl_complete abortaccept-linearrow-key-prefixbackward-bytebackward-charbackward-delete-charbackward-kill-linebackward-kill-wordbackward-wordbeginning-of-historybeginning-of-linecall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencompletecopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-chardelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyforward-wordhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-linekill-regionkill-wordmenu-completenext-historynon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-againoverwrite-modepossible-completionsprevious-historyquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertset-markstart-kbd-macrotab-inserttilde-expandtranspose-charstranspose-wordstty-statusundouniversal-argumentunix-line-discardunix-word-ruboutupcase-wordyankyank-last-argyank-nth-argyank-popvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-yank-argvi-yank-toLINES=%dCOLUMNS=%d%#.*f%#.*E%+.2d ~ ~HOME reverse-i-search)`%s%d%02d%03dbwxbxseognhchsindadbmimsosesxthzulxonx5iHCNRNPNDccuthlYAYBYCYDYEYFYGbsnsncNLptxritlmsgpbvtwsNllhlwmaMWCopaNCYaYbYcYdYeYfYgYhYiYjYkYlYmYnBTYoYpugdCdNdBdTknbtblcsctcdchCCcmdohoCMndlldldshdasmbmdtidmmhmkmpmrsousecaemeteedseuefffsi1isi3alipkbkakCktkDkLkMkEkSk0k1k;k2k3k4k5k6k7k8k9kAkNkPkFkRkTl0l1lal2l3l4l5l6l7l8l9nwDLDOSFALLERISRUPpkplpxpspfporpr1r2r3rfrccvscsfsrsastwitatsuchuiPK1K3K2K4K5pOrPacpnkBSXRXSARAXNXFeALOLF@1@2@3@4@5@6@8@9@0%1%2%3%4%5%6%7%8%9%0&1&2&3&4&5&6&7&8&9&0*1*2*3*4*5*6*7*8*9*0#1#2#3#4%a%b%c%e%f%g%h%i%j!1!2!3RFF1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFrcbMCMLMRLfSCDKRCCWWGHUDIQDTOPUfhPAWAu0u1u2u3u4u5u6u7u8u9opocIcIpspSfSbZAZBZCZDZEZFZGZHZIZJZKZLZMZNZOZPZQZRZSZTZUZVZWZXZYZZZaZbZcZdZeZfZgZhZiZjZkZlZmZnZoZpZqZrZsZtZuZvZwZxZyKmMiRQGmAFABxldvcis0s1s2s3XyZzYvYwYxYyYzYZS1S2S3S4S5S6S7S8XhXlXoXrXtXvsAsLi2rsnlbckoG2G3G1G4GRGLGUGDGHGVGCmlmubxLC_ALLLC_CTYPELANG.UTF-8linuxscreenTERMCAPhhII00TERM environment variable not set. TERM environment must be <= %d characters. |Not enough memory to create terminal structure. terminals database is inaccessible '%s': unknown terminal type. '%s': I need something more specific. '%s': I can't handle hardcopy terminals. Out of memory = ;&()|<>event not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitutionunknown expansion error:$*%^() <>;&|$"'`\`"$/sw/share/terminfoTERMINFO%s/%s%c/%.*sTERMINFO_DIRS/sw/share/terminfo:/usr/share/terminfoTERMPATH/etc/termcap:/usr/share/misc/termcap|:%.*s %s/.termcap"%s", line %d, col %d, terminal '%s'%s/.terminfoterminal names must start with letter or digitName collision between %s %sresolution of use=%s failedexit_standout_mode but no enter_standout_modeenter_standout_mode but no exit_standout_modeexit_underline_mode but no enter_underline_modeenter_underline_mode but no exit_underline_mode``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~exit_alt_charset_mode but no enter_alt_charset_modeenter_alt_charset_mode but no exit_alt_charset_modeenter_alt_charset_mode but no acs_charsexit_alt_charset_mode but no acs_charsenter_blink_mode but no exit_attribute_modeenter_bold_mode but no exit_attribute_modeenter_ca_mode but no exit_ca_modeexit_ca_mode but no enter_ca_modeexit_delete_mode but no enter_delete_modeenter_delete_mode but no exit_delete_modeenter_dim_mode but no exit_attribute_modeexit_insert_mode but no enter_insert_modeenter_insert_mode but no exit_insert_modeenter_secure_mode but no exit_attribute_modeenter_protected_mode but no exit_attribute_modeenter_reverse_mode but no exit_attribute_modeto_status_line but no from_status_linefrom_status_line but no to_status_linemeta_on but no meta_offmeta_off but no meta_onprtr_off but no prtr_onprtr_on but no prtr_offrestore_cursor but no save_cursorsave_cursor but no restore_cursorexit_xon_mode but no enter_xon_modeenter_xon_mode but no exit_xon_modeexit_am_mode but no enter_am_modeenter_am_mode but no exit_am_modelabel_off but no label_onremove_clock but no display_clockdisplay_clock but no remove_clockset_color_pair but no initialize_pairNCURSES_NO_SETBUFEntry does not start with terminal names in column oneprimary namealias%s `%.*s' may be too longusetc%s (%s termcap extension) aliased to %s%s (%s terminfo extension) aliased to %sextended capability '%s'unknown capability '%s'booleanstringnumericunknownwrong type used for %s capability '%s'unknown token type%s (%s termcap extension) ignored%s (%s terminfo extension) ignoredkil1kcbtkedkelkclrtbckdch1kdl1kcud1krmirkhomekich1kICkcub1kcuf1kentkhtskcuu1 %s$<%d>hardware tabs with a width other than 8: %dhardware tabs with a non-^I tab string %sunknown capability `%.*s' in ko stringko translation table is invalid, I give upno value for ko capability %s%s (%s) already has an explicit value %s, ignoring koacsc string synthesized from XENIX capabilitiesacsc string synthesized from AIX capabilities@%&*!#Illegal character (expected alphanumeric or %s) - %sempty longname fieldolder tic versions may treat the description field as an aliaswhitespace in name or alias fieldslashes aren't allowed in names or aliases$[]!*?dubious character `%c' in name or alias fieldSeparator inconsistent with syntaxMissing separator after `%s', have %sno value given for `%s'Missing separatorIllegal character - %sIllegal ^ character - %sAllow ^? as synonym for \177Premature EOFNon-octal digit `%c' in \ sequenceIllegal character %s in \ sequenceVery long string found. Missing separator?Can't backspace off beginning of linexsbxhpxenlmirmsgreslokxonnxonmc5ichtsnrrmcnpcndscrcccbcehlsxhpacrxmdaisyxvpasamcpixlpixcolslinesxmcwslnlabwnumcolorspairsncvbufszspinvspinhmaddrmjumpmcsmlsnpinsorcorlorhiorvicpswidcsbtnsbitwinbitypecbtbelcsrclearelhpacmdchcupcud1homeciviscub1mrcupcnormcuf1cuu1cvvisdch1dl1dslsmacsblinkboldsmcupsmdcdimsmirinvisprotrevsmsosmulechrmacssgr0rmcuprmdcrmirrmsormulflashfslis1is2is3ich1il1kbsktbckctabkf0kf1kf10kf2kf3kf4kf5kf6kf7kf8kf9kllknpkppkindkrirmkxsmkxlf0lf1lf10lf2lf3lf4lf5lf6lf7lf8lf9rmmsmmnelpaddchcudichindnilcubcufrincuupfkeypflocpfxmc0mc4mc5reprs1rs2rs3vpaindrisgrhtswindhttsliprogka1ka3kb2kc1kc3mc5prmpacscplnsmxonrmxonsmamrmamxoncxoffcenacssmlnrmlnkbegkcankclokcmdkcpykcrtkendkextkfndkhlpkmrkkmsgkmovknxtkopnkoptkprvkprtkrdokrefkrfrkrplkrstkresksavkspdkundkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkFNDkHLPkHOMkLFTkMSGkMOVkNXTkOPTkPRVkPRTkRDOkRPLkRITkRESkSAVkSPDkUNDrfikf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63el1mgcsmglsmgrflnsclkdclkrmclkcwinwingohupdialqdialtonepulsehookpausewaitinitcinitpscpsetfsetbcpilpichrcvrdefcswidmsdrfqsitmslmsmicmsnlqsnrmqsshmssubmssupmsumrwidmritmrlmrmicmrshmrsubmrsupmrummhpamcud1mcub1mcuf1mvpamcuu1pordermcudmcubmcufmcuuscssmgbsmgbpsmglpsmgrpsmgtsmgtpsbimscsdrbimrcsdsubcssupcsdocrzeromcsnmkmousminforeqmpgetmsetafsetabpfxldevtcsins0dss1dss2dss3dssmglrsmgtbbirepbinelbicrcolornmdefbiendbisetcolorslinesdispcsmpchrmpchsmscrmscpctrmscescscesaehhlmelhlmelohlmerhlmethlmevhlmsgr1slengthOTi2OTrsOTugOTbsOTnsOTncOTdCOTdNOTnlOTbcOTMTOTNLOTdBOTdTOTknOTkoOTmaOTptOTxrOTG2OTG3OTG1OTG4OTGROTGLOTGUOTGDOTGHOTGVOTGCmemlmemubox1sbBSDBOAT&TCICVDSXSEEXENIXGEGSCFCOENHMLDPDPNPSRTG6G7G5G8GrGuGdGhGvGcGGkqIBMHSIRISKATekKBKCKDKEKFBCfont0font1font2font3kbtabkselstring too complex to convertI'm confused%'%{string may not be optimal%Pa%ga%p%{96}%^%{127}%^saw %%r twice in %ssaw %%m twice in %ssaw %%n twice in %s%{10}%/%{16}%*%{10}%m%+%{2}%*%-%?%>%t%+%;%+%-%*%/%+%c%-%c%2d%3d%\unknown %% code %s (%#x) in %s$</>\%03o%>%%%%?%%{%d}%%>%%t%%{%d}%%+%%;%%?%%{%d}%%>%%t%%'%c'%%+%%;%%?%%'%c'%%>%%t%%{%d}%%+%%;%%?%%'%c'%%>%%t%%'%c'%%+%%;%B%%{%d}%%+%%c%%'%c'%%+%%c%D%n%mdoxX.%.%r\%03lo(null)(cancelled)auto_left_marginauto_right_marginno_esc_ctlcceol_standout_glitcheat_newline_glitcherase_overstrikegeneric_typehard_copyhas_meta_keyhas_status_lineinsert_null_glitchmemory_abovememory_belowmove_insert_modemove_standout_modeover_strikestatus_line_esc_okdest_tabs_magic_smsotilde_glitchtransparent_underlinexon_xoffneeds_xon_xoffprtr_silenthard_cursornon_rev_rmcupno_pad_charnon_dest_scroll_regioncan_changeback_color_erasehue_lightness_saturationcol_addr_glitchcr_cancels_micro_modehas_print_wheelrow_addr_glitchsemi_auto_right_margincpi_changes_reslpi_changes_resbackspaces_with_bscrt_no_scrollingno_correctly_working_crgnu_has_meta_keylinefeed_is_newlinehas_hardware_tabsreturn_does_clr_eolcolumnsinit_tabslines_of_memorymagic_cookie_glitchpadding_baud_ratevirtual_terminalwidth_status_linenum_labelslabel_heightlabel_widthmax_attributesmaximum_windowsmax_colorsmax_pairsno_color_videobuffer_capacitydot_vert_spacingdot_horz_spacingmax_micro_addressmax_micro_jumpmicro_col_sizemicro_line_sizenumber_of_pinsoutput_res_charoutput_res_lineoutput_res_horz_inchoutput_res_vert_inchprint_ratewide_char_sizebuttonsbit_image_entwiningbit_image_typemagic_cookie_glitch_ulcarriage_return_delaynew_line_delaybackspace_delayhorizontal_tab_delaynumber_of_function_keysback_tabbellcarriage_returnchange_scroll_regionclear_all_tabsclear_screenclr_eolclr_eoscolumn_addresscommand_charactercursor_addresscursor_downcursor_homecursor_invisiblecursor_leftcursor_mem_addresscursor_normalcursor_rightcursor_to_llcursor_upcursor_visibledelete_characterdelete_linedis_status_linedown_half_lineenter_alt_charset_modeenter_blink_modeenter_bold_modeenter_ca_modeenter_delete_modeenter_dim_modeenter_insert_modeenter_secure_modeenter_protected_modeenter_reverse_modeenter_standout_modeenter_underline_modeerase_charsexit_alt_charset_modeexit_attribute_modeexit_ca_modeexit_delete_modeexit_insert_modeexit_standout_modeexit_underline_modeflash_screenform_feedfrom_status_lineinit_1stringinit_2stringinit_3stringinit_fileinsert_characterinsert_lineinsert_paddingkey_backspacekey_catabkey_clearkey_ctabkey_dckey_dlkey_downkey_eickey_eolkey_eoskey_f0key_f1key_f10key_f2key_f3key_f4key_f5key_f6key_f7key_f8key_f9key_homekey_ickey_ilkey_leftkey_llkey_npagekey_ppagekey_rightkey_sfkey_srkey_stabkey_upkeypad_localkeypad_xmitlab_f0lab_f1lab_f10lab_f2lab_f3lab_f4lab_f5lab_f6lab_f7lab_f8lab_f9meta_offmeta_onnewlinepad_charparm_dchparm_delete_lineparm_down_cursorparm_ichparm_indexparm_insert_lineparm_left_cursorparm_right_cursorparm_rindexparm_up_cursorpkey_keypkey_localpkey_xmitprint_screenprtr_offprtr_onrepeat_charreset_1stringreset_2stringreset_3stringreset_filerestore_cursorrow_addresssave_cursorscroll_forwardscroll_reverseset_attributesset_tabset_windowtabto_status_lineunderline_charup_half_lineinit_progkey_a1key_a3key_b2key_c1key_c3prtr_nonchar_paddingacs_charsplab_normkey_btabenter_xon_modeexit_xon_modeenter_am_modeexit_am_modexon_characterxoff_characterena_acslabel_onlabel_offkey_begkey_cancelkey_closekey_commandkey_copykey_createkey_endkey_enterkey_exitkey_findkey_helpkey_markkey_messagekey_movekey_nextkey_openkey_optionskey_previouskey_printkey_redokey_referencekey_refreshkey_replacekey_restartkey_resumekey_savekey_suspendkey_undokey_sbegkey_scancelkey_scommandkey_scopykey_screatekey_sdckey_sdlkey_selectkey_sendkey_seolkey_sexitkey_sfindkey_shelpkey_shomekey_sickey_sleftkey_smessagekey_smovekey_snextkey_soptionskey_spreviouskey_sprintkey_sredokey_sreplacekey_srightkey_srsumekey_ssavekey_ssuspendkey_sundoreq_for_inputkey_f11key_f12key_f13key_f14key_f15key_f16key_f17key_f18key_f19key_f20key_f21key_f22key_f23key_f24key_f25key_f26key_f27key_f28key_f29key_f30key_f31key_f32key_f33key_f34key_f35key_f36key_f37key_f38key_f39key_f40key_f41key_f42key_f43key_f44key_f45key_f46key_f47key_f48key_f49key_f50key_f51key_f52key_f53key_f54key_f55key_f56key_f57key_f58key_f59key_f60key_f61key_f62key_f63clr_bolclear_marginsset_left_marginset_right_marginlabel_formatset_clockdisplay_clockremove_clockcreate_windowgoto_windowhangupdial_phonequick_dialflash_hookfixed_pausewait_toneuser0user1user2user3user4user5user6user7user8user9orig_pairorig_colorsinitialize_colorinitialize_pairset_color_pairset_foregroundset_backgroundchange_char_pitchchange_line_pitchchange_res_horzchange_res_vertdefine_charenter_doublewide_modeenter_draft_qualityenter_italics_modeenter_leftward_modeenter_micro_modeenter_near_letter_qualityenter_normal_qualityenter_shadow_modeenter_subscript_modeenter_superscript_modeenter_upward_modeexit_doublewide_modeexit_italics_modeexit_leftward_modeexit_micro_modeexit_shadow_modeexit_subscript_modeexit_superscript_modeexit_upward_modemicro_column_addressmicro_downmicro_leftmicro_rightmicro_row_addressmicro_uporder_of_pinsparm_down_microparm_left_microparm_right_microparm_up_microselect_char_setset_bottom_marginset_bottom_margin_parmset_left_margin_parmset_right_margin_parmset_top_marginset_top_margin_parmstart_bit_imagestart_char_set_defstop_bit_imagestop_char_set_defsubscript_characterssuperscript_charactersthese_cause_crzero_motionchar_set_nameskey_mousemouse_inforeq_mouse_posget_mouseset_a_foregroundset_a_backgroundpkey_plabdevice_typecode_set_initset0_des_seqset1_des_seqset2_des_seqset3_des_seqset_lr_marginset_tb_marginbit_image_repeatbit_image_newlinebit_image_carriage_returncolor_namesdefine_bit_image_regionend_bit_image_regionset_color_bandset_page_lengthdisplay_pc_charenter_pc_charset_modeexit_pc_charset_modeenter_scancode_modeexit_scancode_modepc_term_optionsscancode_escapealt_scancode_escenter_horizontal_hl_modeenter_left_hl_modeenter_low_hl_modeenter_right_hl_modeenter_top_hl_modeenter_vertical_hl_modeset_a_attributesset_pglen_inchtermcap_init2termcap_resetlinefeed_if_not_lfbackspace_if_not_bsother_non_function_keysarrow_key_mapacs_ulcorneracs_llcorneracs_urcorneracs_lrcorneracs_lteeacs_rteeacs_bteeacs_tteeacs_hlineacs_vlineacs_plusmemory_lockmemory_unlockbox_chars_1^@^A^B^C^D^E^F^G^H^I^J^K^L^M^N^O^P^Q^R^S^T^U^V^W^X^Y^Z^[^\^]^^^_!"$%&'()*+,-0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abceghijklmnopqtvxyz{}^?~@~A~B~C~D~E~F~G~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~^~_~/.fit2d.defWARNING: Problem inputting internal database V11.010FIT2D GRAPHICS WINDOWNOTE: "User escape" issued on start-up Exit from FIT2D: Bye !------------------------------------------------------------------------------WARNING: Problem saving default valuesSubroutine F2D_GUI V0.21EXIT MENU EXIT MENU: Return to keyboard menu Click on "YES" or "NO"Enter YES or NO WELCOME TO FIT2D GUI SELECT SCIENTIFIC INTERFACE FROM GIVEN CHOICES (OR CLICK ON "HELP" FOR INFORMATION) FIT2D: SCIENTIFIC INTERFACESnull EXIT FIT2D EXIT MENU !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!! REQUEST TO EXIT FIT2D !!! !!! ARE YOU REALLY SURE !!! CONFIRM EXITEnter "YES" to finish FIT2D sessionCONTROL RETURNED TO KEYBOARD MENU ? HELP 2-D FITTING FILE SERIES IMAGE PROCESSING (GENERAL) KEYBOARD INTERFACE NOTE: WITHIN THE KEYBOARD MENU MANY OPERATIONS PRODUCE OUTPUT IN THE MEMORY AND "EXCHANGE" MUST BE USED TO RECOVER THE RESULT. (THIS IS DONE AUTOMATICALLY WITHIN THE "GRAPHICAL USER INTERFACE"). "EXCHANGE" IS USUALLY THE DEFAULT COMMAND AFTER SUCH OPERATIONS. HOWEVER "SIMPLE" COMMANDS PRODUCE OUTPUT IN THE CURRENT DATA ARRAY. "PLOT" OR "IMAGE" IS OFTEN THE DEFAULT COMMAND. THE TABLES AT THE END OF THE REFERENCE MANUAL DESCRIBE THE OUTPUT OF ALL COMMANDS AND SHOULD BE USED WHEN THIS NOT CLEAR. CONTROL TRANSFERRED TO TERMINAL WINDOWMACROS / LOG FILE MFIT (MULTIPLE 1-D FITTING) ON-LINE CRYSTALLOGRAPHY POWDER DIFFRACTION (2-D) SAXS / GISAXS TEST Bad "status": RESET "status" ?YES: to reset "status" value, other exit programSubroutine F2D_INP_DATASTORE V0.8 COLOUR_TABLEZ_SCALING_MODEZ_SCALING_MINIMUMZ_SCALING_MAXIMUMZ_SCALING_LOGCURVE_STYLE_1X_PIXEL_SIZEY_PIXEL_SIZESubroutine F2D_KEYBOARD V1.6 banner INPUT DATA Please enter one of the available menu choices Enter ? for list of menu choices Enter YES or NOnull Main menu: ENTER COMMANDSEQUENCE RESET "status"YES: to reset "status" value, other exit programWARNING: No data exists at the moment, you must "INPUT DATA" or "CREATE DATA"WARNING: No data is stored in the memory at present, you must use "STORE" or use "EXCHANGE" to put data into the memorySTORE WARNING: Memory is not defined throughout active data region (ADR) you can use "REGION" or "ROI" to re-define the ADRREGION WARNING: Memory arrays do not exist you must create them with "DIMENSIONS" (but this will destroy any stored data)DIMENSIONS WARNING: Graphics system is turned off. You must "EXIT" and restart FIT2DWARNING: No variance arrays exist at the moment, you must "EXIT" and restart with error arrays definedEXIT WARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNING ERROR: Bad "WARNING: occured during a macro. Macro automatically terminated.ERROR: Bad "WARNING" occured during a sequence. Sequence terminated.INFO: Control transferred to graphics window?HELPADDANNOTATION LABELASPECT RATIOAUTOCORRELATIONAXES SCALESBANNERBLURSMOOTHBRAGGS' EQUATIONGEOMETRY (EXPERIMENT)CADDCALCULATORCALIBRATIONCDIVIDECHANGESCLEAR DATASYMMETRIC FUNCTIONCLOSE LOGWARNING: Log file is not openOPEN LOGCMULTIPLYCOLOUR TABLECOLOUR_TABLECONCATENATIONCONTOUR PLOTcontourx/y graphCREATE DATAGAUSSIANCURVE STYLESSET CURVE STYLESDEFINE VARIABLESYMBOLVARIABLEDEDUCE FILE SEQUENCEDIFFRACTION PATTERNDIFFERENTIATEDIMENSIONSMust be within specified boundsARRAY X DIMENSIONEnter X dimension for internal data arraysARRAY Y DIMENSIONEnter Y dimension for internal data arraysMust enter YES or NOCREATE MEMORYYES is required for many operations, NO saves memoryCREATE VARIANCE ARRAYSYES if error analysis is required, NO saves memoryDISPLAY LIMITSDIVIDEEND GRAPHICS FILEENTROPYEXCHANGEEXITQUITCONFIRM EXITYES: to exit program, NO: to continueEXTENDFAST IMAGEWARNING: The command "FAST IMAGE" has been removed as the normal PostScript printing is now much faster. You should not use this command and remove it from any macros.FILTERWARNING: Not yet implementedFITFLIPFONTSET FONTFUJI LINEARISATIONFULL REGIONGRIDGUIHISTOGRAMIMAGEI2CINFORMATIONINPUT DATAINTERNAL MEMORYLINEARISE FILMLIST VARIABLESLOGARITHMMACRORUN MACROMEDIAN FILTERMESSAGESLEEPMOVE/ROTATEMULTIPLYNORMALISEOFFSET/SCALEWARNING: Log file is already openfit2d.log OUTPUT DATAPAGE POSITIONPAUSEWAITWAIT: Enter to continue: PEEPPIXEL REGIONROIPLOT DATAimageZ-SCALEPOISSONIAN NOISEPOLARISATION EFFECTPOSTSCRIPT OPTIONSPOWER SPECTRUMPREDICTORPRINT GRAPHICSPUBLICATION QUALITYQUESTIONRAISE TO A POWERREBINRE-BINRECALLREFLECTREGIONRING (ADD POWDER RING)ROTATE LUTSELECT PIXEL OPERATIONSEQUENCESET ANNOTATION STYLESET ARROW STYLESET AXES STYLESET BACKGROUND STYLESET ENUMERATION STYLESET COLOURSSET GRID STYLESET LAYOUT STYLESET TICK POSITIONSSET TITLE STYLESET X-LABEL STYLESET Y-LABEL STYLESPATIAL FILTERINGSTART MACROSTATISTICSSTOP MACROSTORESUBTRACTSURFACE INTERPOLATIONINTERPOLATED SURFACETHRESHOLDTITLENEW TITLEEnter new titleEnter valid charactersTRANSPOSEUN-DEFINE VARIABLEUNIT CELL PARAMETERSVARIANCES DEFINITIONV2CWEIGHTED AVERAGEX-AXIS LABELLABEL TEXTEnter X-axis label text for graphicsEnter text or returnY-AXIS LABELEnter Y-axis label text for graphicsZ-AXIS LABELEnter Z-axis (intensity) label text for graphics1-D INTERPOLATIONWARNING: This option has been added as a quick fix. In the future it will be thought out more properly and the user questions and the action will change.3-D SURFACE PLOTnullWARNING: Illegal command, please re-enterSubroutine IO_MSET_OPTIONS V0.15-dim+dim-DIM+DIMxXWARNING: Command line option to set program array sizes could not be decoded successfully-var+var-VAR+VAR-nogr+nogr-NOGR+NOGR-keyboard+keyboard-KEYBOARD+KEYBOARD-key+key-KEY+KEY-42WARNING: There was a problem opening the graphics output window. This may be a problem of the X-terminal not accepting graphics output from the host running FIT2D. If this is the case it can be cured by using the xhost program e.g. if FIT2D is running on system 'esrf01', then enter: xhost +esrf01 on the local machine which is being used as an X-terminal. If the problem does not seem to be linked to 'xhost' then check that the "DISPLAY" variable is properly defined. You can enter: printenv DISPLAY (for users of the "C"-shell or "T"-shell) to check the current output destination. e.g. If the X-terminal is called 'esrft1' then the "DISPLAY" variable should be set to 'esrft1:0'. To achieve this enter: setenv DISPLAY esrft1:0 GRAPHICS OUTPUT and the "GRAPHICS USER INTERFACE" are UNAVAILABLE.INFO: The graphics system has been turned off by a command line optionDIM1_DATADIM2_DATAHere you are asked to define the size of the program arrays. These will be used to store data "inside" FIT2D. Normally you will want the arrays to be at least as large as the image data to be input. If the dimensions are larger this does little harm, but is wasteful of system resources. If the arrays are smaller then not all of an image can be input at full resolution. Some input options allow an image to be re-binned on input or for a sub-region of the image to be input. Must be an integer in the defined rangeX DIMENSION FOR ARRAYSY DIMENSION FOR ARRAYSArrays to hold estimates of data value variances may be created or not. If error propagation is to be carried out these will be needed, but they double the program array requirements and will make many operations slower. Unless you are going to need error progation e.g. for weighted fitting, it is best to reply "NO". You must enter "YES" or "NO"CREATE VARIANCE ARRAYSSubroutine F2D_TRAILER V0.7 ------------------------------------------------------------------------------ exited by user commandINFO: BYE: FIT2D INFO: (No commercial software is used within FIT2D.) Spline surface fitting uses FITPACK, written by Paul DierckxSubroutine F2D_GUI_2DFIT V0.1 2DFIT_ITERATIONSX_BEAM_CENTREY_BEAM_CENTREimage WELCOME TO THE 2-D FITTING INTERFACE PRESS "INPUT" TO SELECT A DATA FILE FIT2D: 2-D MENUnull EXIT ? CONSTRAINTS WARNING: No parameters; parameters must be input using "INITIALISE"DISPLAY EXCHANGE FULL HELP INITIALISE INPUT SELECT FILE TO INPUT (for fitting) (click on "HELP" for list of formats) OPTIONS OPTIMISE FIT MODEL INFO: The fit model is stored in the "memory", use "EXCHANGE" to view the fit model.NO FIT MODEL: USE "INITIALSE"OUTPUT MASK PRINT RESULTS NO RESULTS DEFINE: USE "OPTIMISE"SET-UP ZOOM IN Z-SCALING SUBTRACT ADD MEMORY DEFINED, BUT NOT IN WHOLE OF ADRMEMORY NOT DEFINEDDATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_FS V0.6 masked_image WELCOME TO THE FILE SERIES PROCESSING GUI "AVERAGE" a file series or create a "COMPOSITE" image FIT2D: MAIN MENUnull EXIT ? EXCHANGE AVERAGE COMPOSITE HELP INPUT (1-D) INTEGRATE OPTIONS OUTPUT DISPLAY PRINT SUMMATION DATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_IP V0.14image WELCOME TO THE GENERAL IMAGE PROCESSING GUI PRESS "INPUT" TO SELECT A FILE FIT2D: MAIN MENUnull EXIT ? EXCHANGE FILTER FULL HELP INPUT SELECT FILE TO INPUT IMAGE DATA (click on "HELP" for list of formats) GEOMETRIC MATHS MOVEMENT OPTIONS OUTPUT UN-ZOOM ZOOM IN DISPLAY PRINT Z-SCALING DATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_MACROS V0.2 WELCOME TO THE MACRO / LOG FILE GUI Macros can be created with "CREATE MACRO" and "STOP MACRO" and run with "RUN SEQUENCE". A log of the session can be created with "OPEN LOG" and "CLOSE LOG" FIT2D: MACROS / LOG FILE MENU null RUN SEQUENCE EXIT ? HELP CLOSE LOG FILE CREATE MACRO OPEN LOG FILE RUN MACRO STOP MACRO Subroutine F2D_GUI_MFIT V0.20MFIT_ITERATIONSMFIT_DIS_FREQUENCYMFIT_MODEL_EVOLUTION NOTE: This menu is designed to work on data stored in horizontal rows. The "POWDER DIFFRACTION" menu NOW PRODUCES 2-THETA, RADIAL, Q-SPACE DATA IN THE X-DIRECTION. Azimuthal data is now in the Y-direction. If fitting azimuthal data the "TRANSPOSE" command should be used to convert the data to row order.image CLICK ON ROW TO USE FOR MODEL INITIALISATIONoptimise WELCOME TO THE MFIT (MULTIPLE 1-D FITTING) GUI PRESS "INPUT" TO SELECT A DATA FILE FIT2D: MFIT MENUnull EXIT ? CONSTRAINTS WARNING: No parameters; parameters must be input using "INITIALISE"DISPLAY EXCHANGE FULL HELP INITIALISE Choose row to be used to enter the initial fitting model parameters, by clicking on it. INPUT SELECT FILE TO INPUT (for fitting) (click on "HELP" for list of formats) OPTIONS OPTIMISE Fitted ModelNO FIT MODEL: USE "INITIALSE"OUTPUT MASK PRINT FINISHED WRITING FILEINFO: Finished writing graphics fileRESULTS NO RESULTS DEFINE: USE "OPTIMISE"SET-UP TRANSPOSE VECTORS ZOOM IN Z-SCALING DATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_PD V0.29masked_image image WELCOME TO THE POWDER DIFFRACTION GUI PRESS "INPUT" TO SELECT A DATA FILE null EXIT ? BEAM CENTRE CAKE CALIBRANT CORRECTION MEMORY DOES NOT EXIST DISPLAY EXCHANGE FULL HELP INPUT SELECT FILE TO INPUT OF IMAGE DATA (click on "HELP" for list of formats) INTEGRATE OPTIONS OUTPUT MASK PRINT TILT UN-ZOOM ZOOM IN Z-SCALING DATA NEEDED, BUT NONE IS DEFINED WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLESubroutine F2D_GUI_SAXS V0.11REMEMBER_ROIFORGET ROI FORGET ROI: Don't remember region of interest between input images REMEMBER ROI REMEMBER ROI: Remember region of interest between input images masked_image image WELCOME TO THE POWDER DIFFRACTION GUI PRESS "INPUT" TO SELECT A DATA FILE null EXIT ? BEAM CENTRE CAKE DISPLAY EXCHANGE FORGET ROI FULL HELP INPUT SELECT FILE TO INPUT OF IMAGE DATA (click on "HELP" for list of formats) INTEGRATE OPTIONS OUTPUT MASK NORMALISE NOT YET IMPLEMENTEDPRINT PROJECTION REMEMBER ROI SPHERICAL MOD 1-D TRANSFORMS UN-ZOOM ZOOM IN Z-SCALING MATHS DATA NEEDED, BUT NONE IS DEFINED WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLESubroutine F2D_GUI_TEST V0.3 WELCOME TO THE TEST AND SIMULATION GUI FIT2D: TEST MENUnull EXIT ? GAUSSIAN Simulated DataColumnsRowsIntensityDISPLAY POISSON TRIANGLE DATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_GUI_XTALLOGRAPHY V0.28Enter "YES" or "NO"Enter number of secondsCLICK HERE TO ENDmasked_image WELCOME TO ON-LINE CRYSTALLOGRAPHY GUI PRESS "INPUT" TO SELECT A FILE FIT2D: MAIN MENUnull TIME-OUT ALARM: NEW FILE DOESN'T EXIST YETAUTO INPUT AUTO INPUT: Automatically input files from a sequence NEXT FILE EXIT ? AUTO INPUT STOP INPUT STOP INPUT: Cancel automatic input of files from a file sequence You may choose to set a time-out alarm, so that if there is not a new file after a set number of seconds the alarm will notify you. This is to help spot failures in data collection. Enter "YES" to set the alarm, and the number of seconds will be requested. SET TIME-OUT ALARMEnter number of seconds between data input, prior to issuing a warning alarm. ALARM TIME-OUT (SECONDS)The peak search algorithm may be applied automatically to each image on input. Enter "YES" to have automatic peak searching. Normal peaks are displayed as red crosses, and saturated peaks are displayed with yellow crosses. Yellow asterisks denoted "bad" saturated peaks. AUTO PEAK SEARCHNO FILES DEFINED: USE "INPUT" TO SELECT A FILESTOP INPUT EXCHANGE FULL HELP INPUT SELECT FILE TO INPUT IMAGE DATA (click on "HELP" for list of formats) MASK MOVEMENT SET GEOMETRY PEAK SEARCH PREV FILE OPTIONS OUTPUT SORRY, NOT YET IMPLEMENTEDUN-ZOOM SPY-GLASS Move the cursor into the displayed image. The "spy-glass" will show a zoomed in region of the image centred around the coursor position. As the cursor moves so should the spy-glass image. ZOOM IN DISPLAY PRINT Z-SCALING DATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_1DINTERPOLATE V0.2 Enter the relative scaling to apply at the entered scaling coordinate. This is relative to 1.0 at the reference coordinate.e.g. If you want to increase values linearly between coordinates x=1 and x = 100, such that at x=100 the value is multiplied by 1.1, (and 1.0 at x=1, by a linearly proportional value inbetween) You should enter: 1, 100, 1.1 to the three prompts. Enter real number REFERENCE X-COORDINATESCALING POINT X-COORDINATERELATIVE SCALING VALUE AT SCALING COORDINATESubroutine F2D_3DSURFACE V0.8 LINEAR LINEAR: Linear (or logarithmic) image intensity scaling LOG LOG: Logarithmic (or linear) image intensity scaling FAST FAST: Fast mode updating, low resolution, few colours NORMAL NORMAL: Normal updating, resolution, and number of colours Enter valid real3-d surfaceINTERACTIVE 3-D VIEWERnull EXIT ? PRINT 360 DEFAULT +ROT. -ROT. +ELEV. -ELEV. +ZOOM -ZOOM LEFT RIGHT UP DOWN STEEPER FLATTER ANGLE VIEW ROTATION ANGLEEnter view rotation angle, around imageVIEW ELEVATION ANGLEEnter view elevation angleLOG LINEAR: Linear (or logarithmic) intensity scaling LINEAR LOG: Logarithmic (or linear) intensity scaling FAST NORMAL STYLE Subroutine F2D_ASPECTRATIO V0.1 Enter "YES" if you want image display with automatic correct aspect ratios i.e. the pixels are square. Enter "NO" to use all the available display region. This may result in non-square pixels, but may be preferable for very non-square images. Enter "YES" on "NO"AUTOMATIC CORRECT ASPECT RATIO IMAGE DISPLAYSubroutine F2D_AUTOCORRELATION V0.1 NOTE: At present only circular autocorrelation is offered, and this is restricted to numbers of elements which are powers of two in length. This restriction may be removed in a future version.WARNING: The array sizes must be powers of two in size.Enter "YES" or "NO"CENTRE OUTPUT"YES" to move zero point to centre of outputAutocorrelation FunctionX-directionY-directionAutocorrelationSubroutine F2D_AXESSCALES V0.2 Enter the axis value for the first element of the X-axis. This value corresponds to the axis value for the MIDDLE of the first pixel. All axis element values refer to the middle of the pixels. The normal default value is 0.5 for axes which are number 1, 2, 3, etc. Enter valid real value1ST X-AXIS ELEMENT VALUEEnter the increment between axis values for the X-axis. Negative increments may be enetered, BUT they may cuase problems with some options which have not been designed with negative axes in mind ! A value of 1.0 corresponds to a normal 1, 2, 3, scaling per pixel. X-AXIS ELEMENT INCREMENTEnter the axis value for the first element of the Y-axis. This value 1ST Y-AXIS ELEMENT VALUEEnter the increment between axis values for the Y-axis. Y-AXIS ELEMENT INCREMENTSubroutine F2D_BANNER V0.8 null CONDITIONS I ACCEPT HELP DON'T ACCEPT WARNING: Problem in banner widget, bad internal error statusSubroutine F2D_BLUR V0.3 Number of pixels must be postiveX BLUR SIZENumber of pixels in "top-hat" in X-directionY BLUR SIZENumber of pixels in "top-hat" in Y-directionSubroutine F2D_BRAGG V0.4 D-SPACING Must be valid real numberEnter YES or NOBragg equation sub-menu: ENTER COMMANDEnter one of the available commandsTWO THETA ANGLE (Degrees)Enter two theta angle in degreesTWO THETA ANGLE EXIT QUIT D-SPACING (Angstroms)Enter d-spacing in Anstroms (1 Angstrom = 0.1nm)WAVELENGTH/ENERGY WARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programSubroutine F2D_CADD V0.1 Enter real numberADDITION CONSTANTEnter real value to add to active data regionC4@IAF`W?Subroutine F2D_CALCULATOR V0.14Enter YES or NOEnter a value to put it onto the stack or enter an operator to perform an operation on existing values on the stack. Enter ? for list of available operators and commands. ENTER VALUE OR OPERATOREnter valid textADDITION SUBTRACTION MULTIPLICATION DIVISION NULL WARNING: Entered text does not correspond to any of the available choices. Please enter a command from the menu. WARNING: Entered command is ambiguous. Please enter more letters.? HELP ABSOLUTE ARCCOSINE ACOSINE WARNING: Imaginary part of number will be ignored for this operationARCSINE ASINE ARCTANGENT ATANGENT CLEAR COSINE DUPLICATE ENERGY WARNING: Wavelength cannot be 0.0EXCHANGE EXIT QUIT EXPONENTIAL INTEGER LN LOGARITHM MAXIMUM MEMORY MINIMUM MODULUS NEGATION PI POP The stack is empty !POWER PUSH R1 R2 R3 R4 RECALL RECIPROCAL 1/X REGISTERS S1 S2 S3 S4 SINE SQRT SQUARE ROOT STACK STORE VARIABLE SYMBOL #VALUE ENTER VARIABLE NAMEEnter name of internal variable to defineEnter stringWARNING: No value is definedTANGENT WAVELENGTH WARNING: Energy cannot be 0.0Not enough operands for operatorWARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programSubroutine F2D_CALIBRATION V2.29Subroutine F2D_CALIBRATION V2.29#INPUT_FORMATNone IMAGEQUANT HAMAMATSU PHOTONICS FAST CORRECTION SPATIAL CORRECTION FIND PEAKS Value must be within given rangeEnter integer with given rangeEnter YES or NOCalibration sub-menu: ENTER COMMANDEnter one of available commands ("HELP" for help)? HELP APPLY FLAT-FIELD COR. TO LUT NOTE: The current data array must contain a normalised "flat-field" response image.STORE LOOK-UP TABLE WARNING: The flat-field array and the distotion correction look-up table are of different sizes. Operation has NOT BEEN PERFORMED.WARNING: The "flat-fielding" operation lead to values which were too large to be stored in the elements of the distortion correction look-up table.CALCULATE FITTED DISTORTION WARNING: No spatial calibration function exists present, you must "FIT GRID PEAKS"DECAY CORRECTION DESTROY GRID PEAKS DISPLAY DISTORTION EXIT QUIT FALSE PEAK WARNING: No spatial distortion look-up table is defined, you must use "LOOK-UP TABLE (SPATIAL DISTORTION)" or "LOAD LOOK-UP TABLE"FIT GRID PEAKS Enter required maximum AVERAGE discrepancy between the calculated peak distortions and the values of the spline function at the corresponding positions. Note this is the AVERAGE value and does not mean the the function is better fitted for some peaks and worse for others. A value around the estimated error in calculated peak distortion should be about right. AVERAGE FIT DISCREPANCY (PIXELS)OUTPUT SPATIAL FUNCTION FLAT-FIELD CORRECTION INVERSE DISTORTED/IDEAL INFO: Distortion now defined from distorted grid to ideal gridINFO: Distortion now defined from ideal grid to distorted gridINPUT SPATIAL FUNCTION WARNING: Interpolation function coefficients have not been inputLINEARISE INTENSITIES LEARN HOLE PROFILE LOAD LOOK-UP TABLE LOOK-UP TABLE (SPATIAL DISTORTION) WARNING: No spatial calibration function exists present, you must "FIT GRID"WARNING: to create a function.PLATYPUS CORRECTION FILE WARNING: This option has been temporarily removed. Please request that it be re-instated if you need it (e-mail to hammersley@esrf.fr)RE-CALCULATE DISTORTION GRID SPACING (CENTRE TO CENTRE IN microns)Enter distance between adjacent peaks in micronsRESIDUALS OF FIT SAVE PEAKS SIZE (IMAGE DISPLAY) NUMBER OF PIXELSEnter number of pixels to be displayed in "FIND PEAKS" (each dimension) "LOOK-UP TABLE(SPATIAL DISTORTION)"TRANSFER DISTORTION WARNING: Memory arrays do not exist you must create them with "DIMENSIONS"VIEW PEAKS WARNING: No peak centres have been found you must "FIND PEAKS"XRII FLAT-FIELD null WARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit program"YES" to destroy peak position and fit function arrays, and recuperate program memory. "NO" to save peak position and fit function arrays for later re-use. DESTROY DYNAMIC ARRAYSSubroutine F2D_CDIV V0.1 Enter real numberDIVISION CONSTANTEnter real value to divide the active data regionWARNING: Not possible to divide by zeroSubroutine F2D_CMULT V0.2 Enter real numberMULTIPLICATION CONSTANTEnter real value to multiply the active data regionSubroutine F2D_CONCATENATION V0.4 ENTER FIRST STRINGEnter charactersEnter textENTER SECOND STRING INFO: Concatenation: ENTER NAME OF VARIABLEEnter name of variable to defineEnter stringsWARNING: Problem defining variable: Subroutine F2D_CREATEDATA V0.1 Must be within specified boundsX DATA SIZEEnter number of elements for data region in X-dimensionY DATA SIZEEnter number of elements for data region in Y-dimensionSimulated DataColumnsRowsIntensitySubroutine F2D_DIFPATTERN V0.13 NOTE: The reciprocal cell angles are not defined in a standard alpha star, beta star, gamma star fashion.The diffraction pattern is that of a unit cell randomly orientated about a single axis i.e. a fibre pattern. The unit cell must be entered as the reciprocal space unit cell. The command "UNIT CELL PARAMETERS" may be used to convert between real space and reciprocal space cell parameters. The orientation of the unit cell axes wrt to the rotation (fibre) axis are defined according to a system given in R D B Fraser and T P MacRae, "Unit cell and Molecular Connectivity in Tendon Collagen", Int. J. Biol. Macromol., Vol 3, pp 193-200, 1981. Size of A star axis in reciprocal space. Value must be within given rangeA* (INVERSE ANGSTROMS)Size of B star axis in reciprocal space. B* (INVERSE ANGSTROMS)Size of C star axis in reciprocal space. C* (INVERSE ANGSTROMS)Angle from Z-axis (fibre) to A* THETA A* (degrees)Angle from Z-axis (fibre) to B* THETA B* (degrees)Angle from Z-axis (fibre) to C* THETA C* (degrees)Angle from X-axis (beam) to A* PHI A* (degrees)Angle from X-axis (beam) to B* PHI B* (degrees)Angle from X-axis (beam) to C* PHI C* (degrees)MINIMUM h indexLowest index in range of h indices to calculateMAXIMUM h indexHighest index in range of h indices to calculateMINIMUM k indexLowest index in range of k indices to calculateMAXIMUM k indexHighest index in range of k indices to calculateMINIMUM l indexLowest index in range of l indices to calculateMAXIMUM l indexHighest index in range of l indices to calculateOVERLAY PLOTYES for overlay, NO for basic X/Y plotX-filmY-filmPredicted Diffraction PatternAnswer "YES" or "NO"HARDCOPY OUTPUTYES for saving to file, NO for no outputINFO: Finished writing graphics fileSubroutine F2D_DISPLAYLIMITS V0.4 Enter the Maximum number of pixels to display in an image (or contour plot) in one direction. If there are more than this number of pixels to display in either the X or the Y-direction then the image will be displayed with automatic rebinning of the necessary number of pixels (in each direction). The rebinning includes dividing by the number of pixels, so the displayed range should be about the same. Enter integer in given rangeIMAGE: MAXIMUM PIXEL DIMENSIONEnter the Maximum number of pixels to display in a 3-D surface plot in one direction. If there are more than this number of pixels displayed with automatic re-binning of the necessary number of pixels (in each direction). The re-binning includes dividing by the number of 3-D PLOT: MAXIMUM PIXEL DIMENSIONSubroutine F2D_DIVIDE V0.1 Subroutine F2D_ENTROPY V0.4 INFO: Number of pixel differences which are too large to enterNOTE: This assumes 16 bit integer data values 0 1 01Subroutine F2D_EXCHANGE V0.1 Subroutine F2D_EXTEND V0.1 Enter a valid integer within given rangeX-NUMBER OF PIXELSEnter size of extended data region horizontallyY-NUMBER OF PIXELSEnter size of extended data region verticallySubroutine F2D_FILESEQUENCE V0.3 ENTER NAME OF STARTING FILEEnter file nameEnter textENTER NAME OF END FILEERROR: Could not deduce required file sequence##PREFIXs##STARTi##END##STEP##VARIABLEl##NUM_CHARS##POSTFIX##EXTENSIONSubroutine F2D_FIT V0.49Subroutine F2D_FIT V0.49INPUT PARAMETERS Enter YES or NOEnter one of available commands Fit sub-menu: ENTER COMMAND2-THETA TO RINGS INFO: Control passed to graphics windowCAKE CHANGE SCALE WARNING: No fit parameters have been defined, define using INPUT PARAMETERSCLEAR MASK CONSTRAIN WARNING: No parameters; parameters must be input using INPUT PARAMETERSCOVARIANCE WARNING: Not yet (re-)implementedDEFINE MASK DISPLAY MASK EXIT QUIT ResidualsMASK STATISTICS MINIMISE OPTIMISE ('INFO: Elapse time = ', g14.1, ' seconds (', g12.3, ' minutes)') FIT MODELPARAMETERS MUST BE DEFINED USING "INPUT PARAMETERS"MODEL WARNING: No model parameters, they must be defined using "INPUT PARAMETERS"NORMALISATION OUTPUT PARAMETERS WARNING: Parameters must be defined using "INPUT PARAMETERS"POWDER DIFFRACTION R/THETA RE-BINNING RADIAL PROFILE Radial ProfileRESULTS RESULTS MUST BE DEFINED USING "OPTIMISE"SET MASK COLOUR SET UP SILICON CALIBRATION SURFACE POLYNOMIAL 2-D Chebyshev Polynomial Fit modelTHRESHOLD MASKING TILT/BEAM CENTRE TRANSFER MASK TO MEMORY null WARNING: Unknown command, please enter new commandRESET "status"YES: to reset "status" value, other exit programSubroutine F2D_FLIP V0.1 Enter real numberFLIP LEFT TO RIGHT ("NO" = TOP/BOTTOM)"YES" for reflection in vertical plane, "NO" for reflection in horizontal Subroutine F2D_FUJI V0.3 WARNING: User input has changed The linearisation is performed according to the formula:OUT(x, y) = 100 * (4000 / S) * 10**L( IN(x, y) / 2**b - 0.5)where L is the latitude S is the sensitivity b number of bitsThese values are given in the .inf (or .INF) file.Enter integer value within given rangeSENSITIVITYEnter sensitivity (S in linearisation formula)Enter real value within given rangeLATITUDEEnter latitude (L in linearisation formula)NUMBER OF BITSEnter number of bits (b in linearisation formula)Subroutine F2D_GAUSSIAN V0.1 Must be valid real numberPEAK CENTRE X-COORDINATE Enter X-coordinate of centre of peakPEAK CENTRE Y-COORDINATE Enter Y-coordinate of centre of peakPEAK MAXIMUM INTENSITYEnter maximum intensity of peakORIENTATION OF FIRST AXISOrientation in degrees, anti-clockwise from the X-axisSTANDARD DEVIATION WIDTH FOR FIRST AXISPeak width in first axis (standard deviation size)STANDARD DEVIATION WIDTH FOR SECOND AXISPeak width in second axis (standard deviation size)Subroutine F2D_GEOMETRY V0.8 WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLEDETECTOR_ROTATIONX_BEAM_CENTREY_BEAM_CENTREMust be within given rangeROTATION OFFSET ANGLE OF DETECTOR (DEGREES)Rotation angle FROM ideal X-axis (synchrotron plane) TO actual detector X-axisSubroutine F2D_HISTOGRAM V0.1 Enter real numberHISTOGRAM MINIMUM VALUEEnter minimum pixel value for calculating histogramHISTOGRAM MAXIMUM VALUEEnter maximum pixel value for calculating histogramNUMBER OF HISTOGRAM BINSEnter required number of histogram bins: Frequency HistogramPixel ValuesFrequencySubroutine F2D_I2C V0.4 Enter a valid integerENTER INTEGEREnter integer value to convertVARIABLE LENGTH OUTPUTEnter whether the output should be of variable lengthENTER NUMBER OF OUTPUT CHARACTERSEnter number of characters for outputENTER VARIABLE NAMEEnter name of variable to defineEnter string0 sSubroutine F2D_IMAGE V0.20imageFIT2D: IMAGE MENUnull EXIT ? FAR-LEFT UN-ZOOM FULL L-TOP L-UP LEFT L-DOWN L-BOTTOM TOP UP CENTRE DOWN BOTTOM R-TOP R-UP RIGHT R-DOWN R-BOTTOM OPTIONS ZOOM IN FAR-RIGHT DISPLAY PRINT CONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_INFORMATION V0.3 INFO: Variance arrays exist, error propagation will be performed.INFO: No variance arrays exist, (no error propagation).INFO: Current data is definedINFO: No current dataINFO: Memory definedINFO: Memory is not definedSubroutine F2D_INTERNALMEMORY V0.2 You are given the choice of saving the current active data region (ADR) or recovering a previously saved region (if one exists). Enter "YES" to save the current ADR within internal program memory, or "NO" to recover a previously saved ADR. Note: Each time an ADR is saved the program needs to allocate more dynamic memory, so this command should be used with care, and may fail if the computer system cannot allocate more memory. Enter "YES" or "NO"SAVE ACTIVE DATA REGION ("NO": TO RECOVER)WARNING: No data exists in the program array at presentEnter number of internal memory to use to store active data region. By default a new memory will be used, unless they are all being used, however each time a new memory is used more virtual memory is necessary. Enter integer within given rangeINTERNAL STORE NUMBEREnter number of internal memory to recover a previously stored active data region. WARNING: No active data regions are presently stored internallySubroutine F2D_LINEARISE V0.2 Enter value within given rangeVALUE FOR UNIT OPTICAL DENSITYEnter data value corresponding to optical density of one (usually 128 for Daresbury scanner)Enter the Selwyn granularity for the film being used: e.g. MOSFLM uses 3.7 for Daresbury scanned CEA film and suggests 2.5 for other CEA film (old MOSFLM documentation suggests 2.3). Other values from Morimoto and Uyeda (Acta Cryst 16, pp. 1107, 1963): Kodirex 3.2, Kodak No Screen 2.7 SELWYN GRANULARITYEnter fog level in optical density units of the film being used: e.g. 0.16 for fresh CEA film, 0.30 for Kodirex, 0.20 for Kodak No Screen FILM FOG LEVEL (OD UNITS)Enter saturation value for data: e.g. highest reliable value, 254.0 for 0-255 microdensitometers DATA SATURATION VALUEEnter exponent for power law of Selwyn granularity as a function of optical density: Theoretically it should be 0.5, but empirically 0.6 is found. (0.61, for Ilford Industrial G film) GRANULARITY POWER EXPONENTEnter area of digitilisation aperature in square microns e.g. enter 2500 for a 50*50 micron aperature APERATURE AREAFILM CORRECTION CONSTANTEnter correction constant (0.06 Kodak no-screen C, 0.055 Kodirex, 0.07 CEA)Subroutine F2D_LISTVARIABLES V0.6 INFO: No program variables are presently defined INFO: Variable Names / Data Types / Variable Values s(0) = ) = s( = Subroutine F2D_LOGARITHM V0.2 Enter real valueLOWER THRESHOLDLog(0) or Log(-) has been encountered. Enter value for lower thresholdSubroutine F2D_MEDIANFILTER V0.3 Enter integer within given rangeMEDIAN FILTER X-SIZESize of filter window in X-directionMEDIAN FILTER Y-SIZESize of filter window in Y-directionSubroutine F2D_MESSAGE V0.1 INFO: Enter message text or user escape (\\) to exitTEXTEnter user help textEnter valid character stringSubroutine F2D_MOVE V0.11Either the centre and angle of rotation, and the translation vector may be specified, OR the coordinates of two input points and two output points may be entered. If the indirect method is chosen the distance between the points should be equal for this to make sense. However, the distances are different this cannot be done exactly. In this case the rotation angle will bring the two lines together, with the two lines sharing the same mid-point. "YES" to specify rotation and translation, "NO" to specify two input coordinates and two output coordinates Enter "YES" or "NO"DIRECT DEFINITION TRANSLATION/ROTATIONINFO: First the data is rotated about a fixed coordinate, THEN aINFO: translation is applied. (Output in the memory)Enter angle within given rangeROTATION ANGLE (DEGREES)Angle of rotation in degrees (positive angle is anti-clockwise rotation)Enter real numberX CENTRE ROTATIONX-coordinate of centre of rotationY CENTRE ROTATIONY-coordinate of centre of rotationX TRANSLATIONX-component of translation vector (data coordinates)Y TRANSLATIONY-component of translation vector (data coordinates)INFO: Enter two input coordinates followed by their correspondingINFO: output coordinates from which a rotation and/or INFO: translation will be automatically calculated.INFO: If the distances between the input and output coordinatesINFO: are different the operation cannot be exact,INFO: but the vectors will be aligned with their mid-points equal.FIRST INPUT X-COORDINATEEnter X-component of first input coordinateFIRST INPUT Y-COORDINATEEnter Y-component of first input coordinateSECOND INPUT X-COORDINATEEnter X-component of second input coordinateSECOND INPUT Y-COORDINATEEnter Y-component of second input coordinateFIRST OUTPUT X-COORDINATEEnter X-component of first output coordinateFIRST OUTPUT Y-COORDINATEEnter Y-component of first output coordinateSECOND OUTPUT X-COORDINATEEnter X-component of second output coordinateSECOND OUTPUT Y-COORDINATEEnter Y-component of second output coordinateTwo different re-binning methods are available. The fastest just puts the whole contents of each input pixel into one output pixel, depending on where the centre of the input pixel is transformed to in the output array. For this option enter: 1. Alternatively exact area overlap calculations are applied and intensity is distributed amongst the overlapped output pixels in proportion to covered area. Previously, there was the option to sub-divide input pixels into a defined number of sub-pixels. Since the exact area re-binning takes the same time as 2*2 sub-pixel re-binning, exact area is now used instead. Enter integer within give rangeSUB-PIXELS (0 = TRIANGLE RE-BINNING)X-MINIMUM PIXELPixel in X-direction for start of output regionY-MINIMUM PIXELPixel in Y-direction for start of output regionX-MAXIMUM PIXELPixel in X-direction for end of output regionY-MAXIMUM PIXELPixel in Y-direction for end of output regionSubroutine F2D_NORMALISE V0.2 WARNING: The maximum value in ADR is too small (<1.0e-19) or negative to be used for normalisationSubroutine F2D_OFFSET V0.5 Enter "YES" or "NO"SCALING KNOWN"YES" if the scaling between the two images is knownEnter real numberSCALE FACTOREnter scale factor (current data divided by memory)SEPARATION LIMIT VALUEValue below which lower mean is defined, above upper meanFIRST LOWER LIMITValue below which values are not reliable for first imageFIRST SATURATION VALUEValue above which values are not reliable for first imageSECOND LOWER LIMITValue below which values are not reliable for second imageSECOND SATURATION VALUEValue above which values are not reliable for second imageWARNING: Range contains no valuesWARNING: Not possible, try different separation valueSubroutine F2D_PEEP V0.8 CLICK ON IMAGE PIXELClick on pixel of interestSubroutine F2D_PIXELREGION V0.2 Enter integer within given rangeX-LOWER LIMITEnter integer to define lower X-limit of active data regionY-LOWER LIMITEnter integer to define lower Y-limit of active data regionX-UPPER LIMITEnter integer to define upper X-limit of active data regionY-UPPER LIMITEnter integer to define upper Y-limit of active data regionSubroutine F2D_POLARISATION V0.2 CONTROL OF POLARISATION EFFECT PARAMETERS POLARISATION X PIXEL SIZE DISTANCE X-BEAM CENTRE Y-BEAM CENTRE POLARISATION FACTOR SIZE OF PIXEL IN X-DIRECTION (MICRONS) SIZE OF PIXEL IN Y-DIRECTION (MICRONS) SAMPLE TO "DETECTOR" DISTANCE (MM) X-PIXEL COORDINATE OF DIRECT BEAM Y-PIXEL COORDINATE OF DIRECT BEAM Enter ratio of horizontal to vertical polarisation Enter horizontal size of pixelsin microns Enter vertical size of pixelsin microns Enter sample to detector distance (mm) Enter X-pixel coordinate of centre of the direct beam Enter Y-pixel coordinate of centre of the direct beam WORKING: CALCULATING POLARISATION EFFECT ON INTENSITY VALUES Subroutine F2D_POSTSCRIPT V0.2 WARNING: The user input may change for this optionINFO: Colour PostScript output will be producedINFO: Black and white PostScript output will be producedSubroutine F2D_POWDERRING V0.7 Must be valid real numberOPENING ANGLE OF DIFFRACTION RING (DEGREES)Enter 2 theta angle of diffraction ring (degrees)PEAK MAXIMUM INTENSITYEnter maximum intensity of powder diffraction ringSTANDARD DEVIATION WIDTH (X-PIXELS) OF RADIAL PROFILERadial peak width of diffraction ring in pixel unitsSubroutine F2D_POWER V0.2 Enter real numberENTER POWEREnter power by which data elements are to be exponentedATTEMPT TO TAKE SQUARE ROOT ON ONE OR MORE NEGATIVE NUMBERS. VALUES SET TO 0.0 WARNING: Attempt to take square root on one or more negative numbers. values set to 0.0ATTEMPT TO DIVIDE BY ZERO. VALUES SET TO 1.7*10**38 WARNING: Attempt to divide by zero. Values set to 1.7e38Subroutine F2D_POWERSPEC V0.1 WARNING: The number of elements in the ADR in the X-direction is not a power of two, which is a requirement of the Radix-2 FFTWARNING: The number of elements in the ADR in the Y-directionPower SpectrumFrequencies (X)Frequencies (Y)PowerSubroutine F2D_PREDICTOR V0.3 Enter choice of predictor algorithm: If x is the current pixel, and a, b,c, d are the "previous" pixels as shown: a x c b d 1: predictor = x - a 2: predictor = x - Int ( (a + b) / 2) 3: predictor = x - Int ( (a + b + c) / 3) 4: predictor = x - Int ( (a + b + c + d) / 4) 5: predictor = x - ( (a + b - c) 6: predictor = x - Int ( (3a + 3b - 2c) / 4) 7: predictor = x - Int ( (2a + 2b - c) / 3) 8: For pairs of values a and b, replace with a' = Int((a+b)/2) and b' = a - b (this is reversable) This is applied alternately horizontallly and vertically to a specified level, then the series of a' values are stored as a simple previous value differential 9: predictor = x - Int ( (a + b + 1) / 2) 10: predictor = x - Int ( (a + b + c + 1) / 3) 11: predictor = x - Int ( (a + b + c + d + 1) / 4) (All in integer arithmetic) Enter integer value within given rangePREDICTOR ALGORITHM TO APPLYEnter number of times pairs of pixels should be replace with rounded mean and differences NUMBER OF AVERAGING ITERATIONSSubroutine F2D_PRINT V0.9 3-d lines3-d surfacebannerV*.**imagemasked_imagecontourx/y graphWARNING: Unknown type of graphics to outputFINISHED WRITING FILEINFO: Finished writing graphics filePROBLEM WRITING FILE: (SEE TERMINAL WINDOW)Subroutine F2D_QUESTION V0.9 INTEGER VALUE TYPE OF DATA VALUE TO DEFINEEnter one of available data typesENTER USER PROMPT FOR VALUE INPUTEnter text to be presented to the userEnter valid character stringGRAPHICAL COORDINATEEnter "YES" or "NO"USE GRAPHICAL USER INTERFACE"YES": to present requests through GUIGIVE USER DEFAULT VALUE"YES": to output a default value to the userEnter valid integer valueENTER DEFAULT VALUE FOR INTEGEREnter the default value to be presented to the userREAL VALUE Enter valid real valueENTER DEFAULT VALUE FOR REALLOGICAL VALUE ENTER DEFAULT VALUE FOR LOGICAL VALUEENTER CHARACTER STRING OR FILE NAMEEnter default character string for string or file nameRESTRICT INPUT VALUE RANGE"YES": to only allow values within a defined rangeLOWER LIMIT OF RANGE FOR INTEGEREnter the lower bound for accepted inputUPPER LIMIT OF RANGE FOR INTEGEREnter the upper bound for accepted inputENTER LOWER LIMIT OF INPUT RANGE FOR REALENTER UPPER LIMIT OF INPUT RANGE FOR REALINFO: Enter help text or user escape (\\) to exitTEXTEnter user help textX-COORDINATE VARIABLE NAMEEnter name of variable to defineEnter stringY-COORDINATE VARIABLE NAMEENTER VARIABLE NAME NOTE: !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! INTERACTIVE INPUT REQUIRED FOR THE MACRO !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!INPUT FILE OUTPUT FILE NOTE: Macro terminated by user request.NOTE: Sequence terminated by user request.MACRO ABORTEDCONTINUING MACROSubroutine F2D_REBIN V0.3 Enter number of input pixels (in the X-direction) to be rebinned (scaled) into 1 output pixel. (If whole numbers are specified for both the X and the Y-directions the operation will be much faster. Values smaller than one make one input pixel expand to cover more than one output pixel. Enter value within given rangeX REBIN NUMBER (NUMBER INPUT TO 1 OUTPUT)Y REBIN NUMBER (NUMBER INPUT TO 1 OUTPUT)Must be postiveX START OUTPUTX Starting pixel for outputY START OUTPUTY Starting pixel for outputX-REFERENCE POSITION FOR SCALINGEnter X-data coordinate for reference origin of scalingY-REFERENCE POSITION FOR SCALINGEnter Y-data coordinate for reference origin of scalingLOWER X-LIMIT FOR OUTPUTX lower pixel limit for outputLOWER Y-LIMIT FOR OUTPUTY lower pixel limit for outputUPPER X-LIMIT FOR OUTPUTX upper pixel limit for outputUPPER Y-LIMIT FOR OUTPUTY upper pixel limit for outputSubroutine F2D_RECIPROCAL V0.3 "YES" to convert from real unit cell parameters to reciprocal space cell parameters, "NO" to convert from reciprocal space cell paramters to real space unit cell parameters Enter "YES" or "NO"REAL TO RECIPROCALValue must be within given rangeA axis length (ANGSTROMS)Length of A axis of unit cellB axis length (ANGSTROMS)Length of B axis of unit cellC axis length (ANGSTROMS)Length of C axis of unit cellALPHA (degrees)Alpha AngleBETA (degrees)Beta AngleGAMMA (degrees)Gamma AngleA star axis length (Inverse ANGSTROMS)Length of A star axis of reciprocal unit cellB star axis length (Inverse ANGSTROMS)Length of B star axis of reciprocal unit cellC star axis length (Inverse ANGSTROMS)Length of C star axis of reciprocal unit cellALPHA STAR (degrees)Alpha Star AngleBETA STAR (degrees)Beta Star AngleGAMMA STAR (degrees)Gamma Star AngleSubroutine F2D_REFLECT V0.5 REFLECTION LINEClick on two points of line of reflectionOUTPUT REGION CONTROL FORM X-START OUT Y-START OUT X-END OUT Y-END OUT STARTING PIXEL OF OUTPUT REGION (X) STARTING PIXEL OF OUTPUT REGION (Y) END PIXEL OF OUTPUT REGION (X) END PIXEL OF OUTPUT REGION (Y) Minimum pixel of output region (horizontally) Minimum pixel of output region (vertically) Maximum pixel of output region (horizontally) Maximum pixel of output region (vertically) Enter pixel limits of the output region REFLECTING: Please waitEnter real numberX COMPONENT POINT 1X-component of first coordinate on line of reflectionY COMPONENT POINT 1Y-component of first coordinate on line of reflectionX COMPONENT POINT 2X-component of second coordinate on line of reflectionY COMPONENT POINT 2Y-component of second coordinate on line of reflectionEnter number in rangeSUB-PIXELSNumber of sub-pixels in each direction (0 = area re-binning)Subroutine F2D_ROTATELUT V0.1 NUMBER OF LEVELS TO ROTATEEXIT -100 - 50 - 10 - 1 DEFAULT+ 1 + 10 + 50 +100 Subroutine F2D_SELECTPIXEL V0.4 #OVERLOAD_VALUE"YES" if pixels are to be selected by a greater than comparison (exclusive), "NO" if pixels are to be selected by a lesser than comparison (exclusive). Enter "YES" or "NO"GREATER THAN COMPARISONEnter real numberDECISION PIXEL VALUEInput pixel value for comparison"YES" if the pixel values are to be multiplied by a constant, "NO" if a constant is to be added to the selected pixels. MULTIPLICATION ("NO" = ADDITION)OPERAND VALUEInput value to multiply or add to pixel valuesSubroutine F2D_SEQUENCE V0.10WARNING: The "SEQUENCE" command cannot be used within a macro. (It is used to repeately run a defined macro.)Enter a valid integerThe sequence is defined by an integer "loop" variable. This variable is set with an initial value, an end limit value, and a increment step for each loop. This works in the same fashion as a Fortran "DO" loop. e.g. To simply loop 10 times, the initial value can be set to 1, the maximum value to 10 and the increment step to 1. The value of the counter at each loop through the sequence may be used to define varying definitions of variables values e.g. file names, and the value of the counter can be used within the called macro. The variable ##COUNT is set to contain the current loop count value. Thus, it may be useful to define loops starting from values other than 1, and with non-unity or negative increment steps. LOOP COUNT START VALUELOOP COUNT END LIMIT VALUE (INCLUSIVE)LOOP COUNT INCREMENT STEPWARNING: The entered values do not define a valid finite loop, please re-enter valid parameter values (You can enter user escape (\\) to exit this command.)INPUT MACRO FILE NAMEEnter Name of a file containing a macroUnacceptable inputREAD%!*\ BEGINNING OF EXPG_IO MACRO FILE%!*\ BEGINNING OF IO MACRO FILEWARNING: The entered file is not a valid macro fileWARNING: The entered file could not be opened (probably it doesn't exist)Enter the total number of programs variables, whose values you want to be re-defined automatically each iteration of the sequence. (Non-changing program variable values can be defined before the "SEQUENCE" command using the "DEFINE VARIABLE" command, or may be defined here as additional re-definable variables, but not using the dynamic capabilities.) Enter a valid integer within the given rangeNUMBER OF VARIABLES TO DEFINEEnter "YES" or "NO"Enter an integer within given rangeEnter a valid real valueENTER VARIABLE NAMEEnter name of variable to be definedVARIABLE VALUE BASEEnter characters defining the unchanging base part of the variable values##BLANK Enter "YES" if any variable part of the variable values is to be of a fixed number of characters. Enter "NO" if minimum number of characters is to be automatically defined. VARIABLE PART FIXED LENGTHNUMBER OF CHARACTERS IN VARIABLE PARTThe loop count value can be used directly to form part of the program variable value e.g. a file name, or some simply arithmetic may be defined to produce another integer value based on the loop count value. Enter "NO" to use the loop count value directly. Enter "YES" to allow a real valued multiplier to be multiplied with the loop count value, and a real constant added. The result is then converted to the nearest integer and used as part of the variable value. i.e. variable_value = loop * multiplier + constant ARITHMETIC ON LOOP COUNT VALUEThe loop count value is multiplied by a real multiplier and then a real constant is added. The result is converted to the nearest integer before being used to form part of the variable value. i.e. variable_integer_value = loop_value * multiplier + constant You can enter the value of the multiplier and the constant. e.g. For a loop which goes from 1 to 20, you can make a variable which counts down from 20 to 1 with: MULTIPLIER = -1.0, and CONSTANT = 21.0 MULTIPLIER FOR LOOP COUNT VALUECONSTANT TO ADD TO MODIFIED LOOP COUNT VALUEVARIABLE VALUE EXTENSIONEnter characters defining the unchanging extension part of the variable values ##COUNTiWARNING: The variable value could not be constructed properlyINFO: *** END OF SEQUENCE ***Subroutine F2D_SLEEP V0.1 Enter a value within the given rangeLENGTH OF PAUSE (seconds)Enter number of seconds to pauseSubroutine F2D_SPATIALFILTER V0.2 Enter "YES" or "NO"LOW-PASS FILTER"YES" for low-pass filtering, "NO" for high-pass filteringEnter integer within given rangeFILTER TYPEType 1 filters the least, type 3 the most: (4 =user defined)Enter real valueSubroutine F2D_STATISTICS V0.8 INFO: Statistics of Active Data Region (ADR):##MINIMUMr##MAXIMUM##MEAN##RMS##SIGMA##SKEWNESS##TOTALSubroutine F2D_SURFACE V0.5 NOTE: The surface fitting method has been changed since Version 8.* (Previously polynomials were used, and now bi-cubic splines are used. Please examine results carefully.)INFO: Control passed to graphics windowCLICK ON COORDINATES, DEFINING THE SURFACEClick on X/Y coordinates, defining the surfaceCONTROL RETURNED TO TERMINAL WINDOWEnter real numberRMS CLOSENESS OF FITEnter required maximum RMS discrepancy between data and fitSubroutine F2D_SYMFUN V0.2 Must be valid realX-COORDINATE OF CIRCULAR SYMMETRYX-centre for radial profileY-COORDINATE OF CIRCULAR SYMMETRYY-centre for radial profileSubroutine F2D_THRESHOLD V0.2 Enter real valueMINIMUM THRESHOLD VALUEValues below this value are set to this threshold valueMust be greater of equal to the lower thresholdMAXIMUM THRESHOLD VALUEValues above this value are set to this threshold valueSubroutine F2D_TRANSPOSE V0.5 The operation is not possible because the second dimension of the work arrays is not WARNING: The operation is not possible because the second dimension of the work arrays is not large enough to contain the transposed X-limit of the ADRfirst dimension of the work arrays is not large enough to contain the transposed data WARNING: The operation is not possible because the first dimension of Y-limit of the ADRSubroutine F2D_UNDEFINE V0.3 WARNING: No variables are presently defined so you cannot "UN-DEFINE" anyENTER VARIABLE NAMEEnter name of variable to un-defineEnter stringWARNING: Requested variable is not definedSubroutine F2D_VARIANCES V0.2 Enter real numberMAXIMUM NON-SATURATED VALUEEnter maximum value of reliable rangeLOWER "POISSON" LIMIT (FOG)Enter lower limit of reliable "Poisson" rangeSubroutine F2D_XYGRAPH V0.4 Enter "YES" or "NO"CONTINUE"YES" for further 1-D graphs, "NO" to exitSubroutine F2D_ZSCALE V0.11Enter integer in given rangeEnter valid realEnter scaling mode for Z-axis (intensity) of 2-D data: 0 = Automatic full data range 1 = User set minimum and maximum 2 = User set minimum, but automatic maximum 3 = Automatic minimum, and user set maximum 4 = Automatic "weak diffraction peak" scaling IMAGE Z-SCALING MODEMINIMUM DISPLAY VALUEEnter lowest data value in display rangeMAXIMUM DISPLAY VALUEWARNING: The minimum of the range has been set greater than or equal to theWARNING: maximum of the display range. You must reset the values.The false colour image display may use either linear intensity scaling (the default), or logarithmic intensity scaling. Here you can choose which to use. Enter "YES" for logarithmic scaling, "NO" for linear scaling. Enter "YES" or "NO"LOGARITHMIC IMAGE SCALINGZ_SCALING_MODEZ_SCALING_MINIMUMZ_SCALING_MAXIMUMZ_SCALING_LOGSubroutine F2D_GUI_SIZES V0.5 DIMENSIONS OF PROGRAM ARRAYS (need to be big enough to store and work on data) This size form allows you to select the sizes of internal program arrays for storing 2-D detector and other data. Normally you will want the arrays to be at least as large as your data, but it is possible to require arrays which are bigger, and it is also possible to work with arrays which are smaller by only inputting a sub-region of the data, or by re-binning the data on input. The "X-DIMENSION" and "Y-DIMENSION" buttons allow these number of pixels to be changed. Normally memory arrays should be created as they are necessary for many operations, however if you need to limit the computer memory usage, they do not need to be created for simple display. The "MEMORY" button controls the creation of the memory arrays, or not. Normally variance (error) propagation is not necessary. If it is required this option should be selected, but the requirements for computer memory for array space will double and mathematical operations will take twice as long. X-DIMENSION Y-DIMENSION MEMORY VARIANCES FIRST DIMENSION OF ARRAYS SECOND DIMENSION OF ARRAYS CREATE MEMORY ARRAYS CREATE VARIANCE ARRAYS Enter number of pixels "horizontally" for arrays Enter number of pixels "vertically" for arrays Enter "YES" to be able to perform maths, etc. Enter "YES" for error propagation (slower) Subroutine F2D_1DCONSTRAINTS V0.2 FIT PARAMETERS STATES: constrained (YES) or unconstrained (NO) This size form allows you to constrain or unconstrain fit model parameters. The "buttons" show the number of the parameter, whilst the text box shows the type of model feature and parameter: GAU = Gaussian, LOR = Lorentzian, VOI = Voigtian peak. POS = Central position, MAX = Maximum peak intensity, SD = Standard deviation width of a Gaussian peak or component, HWHM = Half-Width Half-Maximum of a Lorentzian peak or component. POL = Chebyshev polynomial coefficient, followed by the order of the coefficient. Subroutine F2D_CLICK V0.10 X = Y = I = d = 2-Theta Angle (Degrees)Subroutine F2D_DISPLAY V0.19imageimage FIT2D: IMAGE: DISPLAY MENUnull EXIT ? ARC SLICE CONTOUR PLOT contourx/y graphDISTANCE HELP NUMBERS PIXEL (X/Y) PROJECTION SATURATED SLICE STATISTICS 3-D SURFACE 3-D LINES 3-d linesPRINT Subroutine F2D_FULL V0.2 Subroutine F2D_GUI_PARAMETERS V0.14 NOTE: The definition of model 2-D polynomials has been changed to Chebyshev form. User input has also been changed.INFO: As you input model features the model is built up. The intensity values used to initialise features are based on the data minus the current model value. It is recommended to select the most intense features first, followed by the next intense features, etc. If the background is large and is to fitted with a 2-D polynomial, this should be selected first, but initialised with a low order polynomial so not to fit too much to the other featuresINFO: Control passed to graphics windowCONTROL RETURNED TO TERMINAL WINDOWWARNING: Parameter array full, not enough room to store feature parametersSubroutine F2D_GUI_ZSCALE V0.17LINEAR SCALE LINEAR SCALE: Linear (or logarithmic) image intensity scaling LOG SCALE LOG SCALE: Logarithmic (or linear) image intensity scaling FIT2D: IMAGE: OPTIONS: Z-SCALINGnull EXIT ? FULLY AUTOMATIC WEAK PEAKS + MAXIMUM - MAXIMUM + MINIMUM - MINIMUM USER MIN/MAX USER MINIMUM USER MAXIMUM LOG SCALE LINEAR SCALE: Logarithmic or linear image intensity scaling LINEAR SCALE LOG SCALE: Logarithmic or linear image intensity scaling Enter valid realMINIMUM DISPLAY VALUEEnter lowest data value in display rangeMAXIMUM DISPLAY VALUEWARNING: The minimum of the range has been set greater than or equal to the maximum of the display range. You must reset the values. Z_SCALING_MODEZ_SCALING_MINIMUMZ_SCALING_MAXIMUMZ_SCALING_LOGSubroutine F2D_LSQFIT2D V0.10WARNING: Geometry not definedWARNING: Problem fitting the model to the dataSubroutine F2D_MASK V0.15FIT: MASK MENUnull CLEAR MASK EXIT ? FULL UN-ZOOM MASK PEAKS (5) MASK PEAKS (9) MASK PEAKS (15) MASK PEAKS (27) MASK POLYGON UN-MASK POLYGON UN-ZOOM UPDATE DISPLAY ZOOM IN Z-SCALING MASK ARC THRESHOLD MASK CONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_MFITSETUP V0.4 FITTING CONTROL PARAMETERS This size form allows you to adjustaspects of the fit and graphical display of results. INFO. LEVEL ITER / PAR DIS. FREQ. EVOLUTION WEIGHTED LEVEL OF FITTING INFORMATION No. OF ITERATIONS PER PARAMETER DISPLAY FREQUENCY OF RESULTS ALLOW FIT PARAMETER VALUES TO EVOLVE WEIGHTED FITTING Fitting information level: 0 = minimum, 2 = maximum Enter maximum number of iterations per fit parameter Enter number of rows bewteen graphical display of fitted results Yes to allow the fitted values ofone fit to be used for the next Select fitted weighted by varianceexists or not Subroutine F2D_OPTIONS V0.16NO LUT NO LUT: Don't add the look-up table to the image display DRAW LUT DRAW LUT: Add a look-up table to the image display Enter "YES" on "NO"imageFIT2D: OPTIONS MENUnull NULL EXIT ? COLOURS CURVE STYLES DRAW LUT GRID NO LUT DRAW LUT: Add the look-up table to the image display POSITION ROTATE LUT TITLE ENTER TITLE FOR IMAGEEnter new titleEnter valid charactersX-AXIS LABEL ENTER TEXT FOR X-AXIS LABELEnter new X-axis labelY-AXIS LABEL ENTER TEXT FOR Y-AXIS LABELEnter new Y-axis labelZ-AXIS LABEL ENTER TEXT FOR Z-AXIS LABELEnter new Z-axis labelZ-SCALING ASPECT RATIO Enter "YES" if you want image display with automatic correct aspect ratios i.e. the pixels are square. Enter "NO" to use all the available display region. This may result in non-square pixels, but may be preferable for very non-square images. AUTOMATIC CORRECT ASPECT RATIO IMAGE DISPLAYSubroutine F2D_ZOOMIN V0.17Click on two coordinates to define required zoom in region. Clicking just outside the image region is equivalent to clicking on the very edge. CLICK ON OPPOSITE CORNERS OF NEW REGIONINFO: !!!!! CORRECTING COMPILER BUG, PLEASE REPORT THIS INCIDENTSubroutine F2D_AVERAGE V0.6 AUTOMATIC SEQUENCE INPUT STARTEDINFO: Input WARNING: File not input: to Subroutine F2D_COMPOSITE V0.12CONTROL OF COMPOSITE IMAGE DISPLAY PARAMETERS SUBTRACT ROI NO. PER ROW RE-BIN NO. SUBTRACT BACKGROUND IMAGE FROM DATA SELECT REGION OF INTEREST NUMBER OF IMAGES PER ROW FACTOR BY WHICH TO RE-BIN Enter "YES" to input an imagewhich will subtracted from all the input Enter "YES" to be able to zoom inon a region of interest for the compoEnter number of images which will be displayed on one line of the compEnter the factor by which input pixels will be re-binned (in both direBackgroundEnter "YES" or "NO"SELECT FILE CONTAINING BACKGROUND IMAGE (click on "HELP" for list of formats) FILE O.K.Enter "YES" if the file is O.K.AUTOMATIC SEQUENCE INPUT STARTEDThe program arrays need to be bigger, this will destroy any existing data in the "memory". Enter "YES" to create new arrays. DESTROY AND CREATE BIGGER PROGRAM ARRAYSINFO: Input WARNING: File not input: to Subroutine F2D_FSINPUT V0.3 Number must be within given rangeENTER NUMBER OF ROW TO INPUTYou can choose to input one row within the given rangeINFO: Input WARNING: File not input: INPUTTING FILE: Scan NumberSubroutine F2D_FSINTEGRATE V0.11#OVERLOAD_VALUEFF_CORRECTIONFF_FILEFF_SCALEFF_SCALERSD_CORRECTIONSD_FILEFS_INT_SAVE_1DFS_INT_SAVE_EXTPROBLEM ALLOCATING MEMORY FOR FLAT-FIELD IMAGEINPUT OF FLAT-FIELD IMAGEINFO: Input of flat-field imageSELECT FLAT FIELD FILE (click on "HELP" for list of formats) PROBLEM INPUTTING THE FLAT-FIELD IMAGETHE FLAT-FIELD IMAGE IS THE WRONG SIZECALCULATING SCALED INVERSE OF FLAT-FIELDTHE FLAT-FIELD CONTAINED ONE OR MORE ZEROSEnter real number within given rangeMAXIMUM MULTIPLER FOR FLAT-FIELD CORRECTIONEnter maximum value to increase intensityINFO: Applying flat-field correctionSPATIAL DISTORTION: MEMORY ALLOCATION FAILEDPROBLEM WITH SPATIAL DISTORTION FILE1ST IMAGE: CORRECTING SPATIAL DISTORTIONINFO: 1st image: Spatial distortion correctionINFO: The "MASK" menu allows you to mask out bad pixels and regions, and to zoom in on a sub-region, if required.THE MASKING MENU WILL NOW APPEAR. YOU CAN ZOOM IN ON A SUB-REGION AND MASK BAD DATA. CLICK EXIT WHEN FINISHED SCAN_TYPEMAXIMUM_DClick "YES" or "NO"SAVE EACH INTEGRATED SCAN TO FILE"YES", to save scans in output files1-D SCAN OUTPUT FILE EXTENSIONChoose file extension for output files for 1-D scansEnter short character stringPROBLEM IN FORM INPUTINTEGRATION WORK ARRAY: MEMORY ALLOCATION FAILEDOUTPUT SCANS WORK ARRAY: MEMORY ALLOCATION FAILEDAUTOMATIC SEQUENCE INPUT STARTEDINFO: Input WARNING: File not input: INPUTTING FILE: CORRECTING SPATIAL DISTORTIONINFO: Applying spatial distortion correctionINTEGRATING DATAINFO: Integrating dataRadial Distance (mm)2-Theta Angle (Degrees)Q (Inverse Nanometres)D-spacing (Angstroms)IntensityINFO: Saving 1-D scan to fileScan Number to Subroutine F2D_GUI_FILTER V0.1 FIT2D: MAIN MENUnull EXIT ? HELP Welcome to the FIT2D Filteral operations menu. The commands here allow you to perform filter operations. EXCHANGE FULL MEDIAN SMOOTH ZOOM IN Subroutine F2D_GUI_GEOMETRIC V0.7 "YES" or "NO" WELCOME TO THE GENERAL IMAGE PROCESSING GUI GEOMETRIC SUB-MENU FIT2D: GEOMETRY MENUnull EXIT ? HELP Welcome to the FIT2D Geometrical operations menu. The commands here allow you to perform geometric operations. EXTEND FLIP FLIP LEFT / RIGHTClick "YES" to reverse the elements horizontallyFLIP TOP / BOTTOMClick "YES" to reverse the elements verticallyEXCHANGE FULL RE-BIN REFLECT TRANSFORM TRANSPOSE ZOOM IN Subroutine F2D_GUI_MATHS V0.5 Enter real numberFIT2D: MAIN MENUnull EXIT ? HELP Welcome to the FIT2D Mathematical operations menu. The commands here allow you to perform maths operations. SCALAR + ADDITION CONSTANTEnter value to add to active data regionSCALAR / DIVISION CONSTANTEnter value to divide active data regionNOT POSSIBLE TO DIVIDE BY ZEROSCALAR * MULTIPLICATION CONSTANTEnter value to multiple active data regionSCALED SUB ADD DIVIDE LOG(10) MULTIPLY NORMALISE STATISTICS SUBTRACT THRESHOLD X^(n) MEMORY NOT DEFINEDMEMORY DEFINED, BUT NOT IN WHOLE OF ADRSubroutine F2D_GUI_SEQUENCE V0.4 WARNING: The "SEQUENCE" command cannot be used within a macro. (It is used to repeately run a defined macro.)AT PRESENT ONLY WORKS WITH #IN AND #OUT MACROSSELECT MACRO FILE TO RUN Use the file selection tool to select a directory and a macro file to run. Normally macro files end with theextension ".mac". SELECT FIRST INPUT FILE IN THE SEQUENCE and the first file in the sequence. SELECT LAST INPUT Use the file selection tool to select the last file in the sequence. COULD NOT DEDUCE REQUIRED FILE SEQUENCEEnter an integer numberFILE INCREMENTEnter the step between input filesOUTPUT FILES EXTENSIONEnter the extension for output filesEnter valid text string ##COUNTi#INs Input file = #OUT Output file = INFO: *** END OF SEQUENCE ***Subroutine F2D_OPEN_INMACRO V0.1 SELECT MACRO FILE TO RUN Use the file selection tool to select a directory and a macro file to run. Normally macro files end with theextension ".mac". PROBLEM OPENING MACRO FILESubroutine F2D_OPEN_LOG V0.1 SAVE LOG IN: is the default file for saving the log. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR SAVING THE LOG RECORD Use the file selection tool to select a directory and an output file to contain the log record. Normally such a file ends with theextension ".log". PROBLEM OPENING FILE FOR THE LOGSubroutine F2D_OPEN_OUTMACRO V0.1 STORE MACRO IN: is the default file for storing the macro. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR STORING THE MACRO Use the file selection tool to select a directory and an output file to contain the macro. Normally such a file ends with theextension ".mac". PROBLEM OPENING FILE FOR THE MACROSubroutine F2D_1DINITIALISE V0.11The data is only 1 column wide ! If the data is a vertical column, use "TRANSPOSE" to create a 1-D row NOTE: Unlike the program MFIT you need to click on "POLYNOMIAL" for a background polynomial, including a zero order polynomial, to be included in the fit modelN.A.Must be within specified boundsCLICK ON PEAK TOPPlace cursor on centre and topCLICK ON PEAK AT HALF HEIGHTPlace cursor on edge of peak at half its heightCLICK ON MAXIMUM AND START OF DECAYPlace cursor on decay start and maximumCLICK ON DECAY SLOPE AT HALF HEIGHTPlace cursor on decay slope at half heightCLICK ON MAXIMUM OF SINUSOIDAL FUNCTIONPlace cursor on maximum of sinusoidal functionCLICK ON ADJACENT MINIMUMPlace cursor on adjacent minimumENTER MODEL FEATUREEXIT ? HELP UN-ZOOM ZOOM IN POLYNOMIAL The polynomial is already definedPOLYNOMIAL ORDEROrder of polynomial functionINITIALISATION POLYNOMIAL ORDEROrder of initialisation polynomial function Failed to fit polynomial coefficientsGAUSSIAN LORENTZIAN VOIGTIAN EXP. DECAY SINUSOIDAL RESIDUALS OF INTITIAL FIT MODELSubroutine F2D_GUI_VECTORS V0.3 No vectors have been definedEnter integer within given rangeNUMBER OF VECTOREnter number of vector to view, output, etc.SamplesValuesx/y graph VECTORS MENUnull EXIT ? FULL HELP INPUT SELECT FILE TO INPUT (1-D vector) (click on "HELP" for list of formats) OPTIONS image OUTPUT PRINT ZOOM IN DATA NEEDED, BUT NONE IS DEFINEDSubroutine F2D_MFITDISPLAY V0.5 Subroutine F2D_SUBMFITDISPLAY V0.4 WARNING: Problem with variance values ResidualsResiduals Subroutine F2D_MFITOPTIMISE V0.3 : Row Subroutine F2D_BEAMCENTRE V0.22BEAM CENTRE MENUCLICK ON DIRECT BEAM MARKDEFINE PAIRS OF SYMMETRIC COORDINATESINPUT COORDINATES ON ELLIPSE (>=5)INPUT CONCENTRIC COORDINATES (>=3)DEFINE BEAM/SYMMETRY CENTREnull INPUT METHOD FOR BEAM CENTREEnter one of available choices? HELP FIT 1-D PROJECTION 2-D GAUSSIAN FIT AVERAGED GRAPHICAL ELLIPSE COORDINATES GRAPHICAL COORDINATE CIRCLE COORDINATES Click on or near to direct beam mark. So long as you are not too far from the edge of the mark the algorithm should be able to find the centre. REFINING BEAM CENTRE: PLEASE WAITClick on pairs of point which are symmetric about a centre of symmetry e.g. centres of peaks. Make sure that the number of coordinates entered is even. The average of the input points will be used for the beam centre. Click on five or more coordinates on an ellipse, or circle, which is centred about the beam centre. If more than five coordinates are entered, the least squares positional error solution will be used, and an error estimate will be output. WARNING: Less than five coordinates inputINFO: The coordinate radial position error is totally undeterminedClick on three or more coordinates on an ellipse, or more than three coordinates are entered, the least WARNING: Less than three coordinates inputClick directly on the estimated position of the KEYBOARD NO CHANGE CONTROL RETURNED TO TERMINAL WINDOWX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_CAKE V0.17CAKE_START_AZIMUTHCAKE_END_AZIMUTHCAKE_INNER_LIMITCAKE_OUTER_LIMIT! CAKE MENU !END AZIMUTH (CLICK HERE FOR START + 360.0)INNER LIMIT (CLICK HERE FOR BEAM CENTRE)CLICK TO DEFINE OUTER LIMITSTARTING AZIMUTH (CLICK HERE FOR 0.0)Enter "YES" on "NO"null EXIT ? BEAM CENTRE INTEGRATE END AZIMUTH Click on a coordinate to define the end azimuth of the region to be transformed to 2-theta or other scans. If you click in the message box (yellow, therefore active), then the complete 360.0 of data will be used. EXCHANGE FULL HELP INNER RADIUS Click on a coordinate to define the inner radius of the "CAKE" region to be transformed. By clicking in the prompt box (yellow therefore active) the beam centre will be used and the output scans will be defined starting from 0.0 angle or radius in the 2-theta / radial direction. OUTER RADIUS Click on coordinate to define outer limit of "cake" region to be transformed. START AZIMUTH Click on a coordinate to define the starting the X-axis (azimuth 0.0) will be used as the start of the region. UN-ZOOM ZOOM IN Z-SCALING MASK ASPECT RATIO Enter "YES" if you want image display with automatic correct aspect ratios i.e. the pixels are square. Enter "NO" to use all the available display region. This may result in non-square pixels, but may be preferable for very non-square images. AUTOMATIC CORRECT ASPECT RATIO IMAGE DISPLAY THERE IS NO DATA IN THE MAIN PROGRAM ARRAY. (USE "EXCHANGE" OR "EXIT") CONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_CALIBRANT V0.25Select the type of calibrant sample you have used. The choice includes the commonly used samples from the American National Institute of Standards and Technology. "PARAFFIN WAX" is included since many xtall- use this for distance calibration. However don't expect high accuracy, and if only low angle data is available don't try to refine both wavelength and distance together. SELECT CALIBRATION SAMPLEALUMINA (Al2O3) CERIUM DIOXIDE LANTHANUM HEXABORIDEPARAFFIN WAX SILICON SODIUM CHLORIDE USER DEFINED CALI_NUMBER_SECTIONSCALI_REJECT_OUTLIERSCALI_REJECT_LIMITCALI_FULL_INFOCALI_REFINE_BEAMCALI_REFINE_DISTANCECALI_REFINE_WAVELENGTHCALI_REFINE_TILTCALI_EXTRA_ITERATIONSCALI_REFINE_POLARISATIONCALIBRANT PATTERN REFINEMENT OF DISTANCE WAVELENGTH ETC. DISTANCE WAVELENGTH X-PIXEL SIZE Y-PIXEL SIZE ANGULAR SECTIONS REJECT OUTLIERS REJECT LIMIT FULL INFO REFINE BEAM X/Y REFINE DISTANCE REFINE WAVELENGTH REFINE TILT EXTRA ITERATIONS REFINE POLARISATION SAMPLE TO DETECTOR DISTANCE (MM) (STARTING) WAVELENGTH (ANGSTROMS) (STARTING) SIZE OF HORIZONTAL PIXELS (MICRONS) SIZE OF VERTICAL PIXELS (MICRONS) NUMBER OF AZIMUTHAL SECTIONS REJECT OUT-LYING POSITIONS AND RE-REFINE REJECT LIMIT FROM IDEAL (STANDARD DEVIATIONS) OUTPUT FULL INFORMATION REFINE X/Y BEAM CENTRE REFINE SAMPLE TO DETECTOR DISTANCE REFINE X-RAY WAVELENGTH REFINE DETECTOR NON-ORTHOGONALITY FIT INTERMEDIATE NUMBER OF RINGS REFINE VALUE OF POLARISATION FACTOR Enter approximate sample to detector distance (mm) Enter approximate X-ray wavelength (Angstroms) Enter dimension of pixels horizontally, as displayed (mm) Enter dimension of pixels vertically, as displayed (mm) Enter number of azimuthal divisions to find average ring positions Enter "YES" to reject badly fittingpositions and re-fit without them Enter number of standard deviations from ideal before rejection Enter "YES" to output full diagnostics information in terminal window Refine x/y beam centre Refine sample to detector distance Refine x-ray wavelength Refine detector non-orthogonality Enter "YES" to add extra partialfitting iterations for difficult problEnter "YES" to refine valueof the polarisation factor from the data inALUMINA (Al2O3 Click on three or more coordinates on the 1 0 -2 Click on three or more coordinates on the 100 Click on three or more coordinates on the first Click on three or more coordinates on the 200 reflection ring (the second from the centre). Click on three or more coordinates on the 111 reflection ring (the closest to the centre). If 3 or 4 coordinates are entered a circle will fitted, otherwise an ellipse will be fitted. If there are more coordinates than fitted variables, then an estimate of the positional error will be produced. CLICK ON THE 200 (SECOND) SAMPLE RING (>=3) INPUT COORDINATES ON INNER SAMPLE RING (>=3) WARNING: Less than three coordinates inputCALCULATING COORDINATES ON INNER RINGINFO: Fitting ellipse to centre of gravity coordinatesWARNING: The calculated sample to detector distance (given the initial estimate of the wavelength) is too different from the user estimate of the wavelength. Please check the initial values of both the distance and the wavelength and alter them using the graphical entry form. Also check that you are using the correct ring.WARNING: Too poor initial values for distance and wavelengthCALCULATING INTEGRATED INTENSITESSubroutine F2D_GUI_CORRECTION V0.11#OVERLOAD_VALUEFF_CORRECTIONFF_FILEFF_SCALEFF_SCALERSD_CORRECTIONSD_FILEINPUT OF FLAT-FIELD FROM FILE: SELECT FLAT FIELD FILE (click on "HELP" for list of formats) APPLYING FLAT-FIELDAPPLYING SCALE FACTORDYNAMIC MEMORY ALLOCATION FAILEDINPUTTING SPATIAL DISTORTION FUNCTIONTOO MANY COEFFICIENTSWRONG TYPE OF FILEPROBLEM OPENNING FILECALCULATING CORRECTION TRANSFORMATION (ORIGINAL DATA TRANSFERRED TO THE MEMORY) CORRECTION COMPLETESubroutine F2D_INQ_GEOMETRY V0.7 WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLEDETECTOR_ROTATIONX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_INTEGRATE V0.11SCAN_TYPEMAXIMUM_DWORKING: CALCULATING TRANSFORM NOTE: ORIGINAL DATA STORED IN THE MEMORY : Radial ScanRadial Distance (mm): 2-theta Scan2-Theta Angle (Degrees): Q-Space ScanQ (Inverse Nanometres): D-Spacing ScanD-spacing (Angstroms)N.A.Subroutine F2D_SET_GEOMETRY V0.6 WAVELENGTHSAMPLE_DISTANCETILT_ROTATIONTILT_ANGLEDETECTOR_ROTATIONX_BEAM_CENTREY_BEAM_CENTRESubroutine F2D_TILTCENTRE V0.26 WARNING: This is a development routine, user prompts are likely to changeTILT / BEAM CENTRE REFINEMENT (FITTING TO POWDER RINGS) ANGULAR SECTIONS REJECT OUTLIERS REJECT LIMIT FULL INFO REFINE BEAM REFINE TILT NUMBER OF AZIMUTHAL SECTIONS REJECT OUT-LYING POSITIONS AND RE-REFINE REJECT LIMIT FROM IDEAL (STANDARD DEVIATIONS) OUTPUT FULL INFORMATION FIND BEST FIT BEAM CENTRE FIND BEST DETECTOR TILT ANGLES Enter number of azimuthal divisions to find average ring positions Enter "YES" to reject badly fittingpositions and re-fit without them Enter number of standard deviations from ideal before rejection Enter "YES" to output full diagnostics information in terminal window Enter "YES" to refine beam centre position Enter "YES" to refine angle of detector tilt The powder ring is divided into a number of equal angle sections for calculating the radial centre of each section. From the radial centre and the average angle two cartesian coordinates are calculated. These coordinates are used to fit optimum beam centre and detector plane tilt angles. Enter required number of sections for calculations. Enter an integer within the given rangeNUMBER OF ANGULAR SECTIONSThe fitting of tilt angle and beam centre to the estimated ring centres may be performed using weighted fitting or unweighted fitting. If weighted fitting is chosen then the average intensity (3 pixels) around the calculated centre of each radial profile is used to weight the fit. This means that strong rings and strong angular regions of rings will have more influence than weaker ones. This should make the fitting more robust when the data has weak rings and noisy background. As you are using weighted fitting the weight applied to each estimated ring coordinate will depend on the square root of the estimated number of counts for that coordinate. The number of counts is calculated from the averaged pixel intensity divided by the detector gain. Normally the detector gain should be set to the best estimate of the gain, but it may be useful to vary it artifically to change the weighting between strong and weak rings. If the gain is set artifically high, then the fitting will be weighted more towards the weak rings. Enter a real value within the given rangeDETECTOR GAINOutlying coordinate positions which are more than an input number of standard deviations radially from the fitted ring positions may be rejected from the coordinate lists. The beam centre/tilt can then be re-fitted without these coordinates. If erroneous coordinate positions are infuencing the fit, this option may allow them to be removed. Enter "YES" or "NO"REJECT OUTLYING COORDINATESEnter the limit of number of standard deviations after which coordinate positions are to be rejected from the coordinate lists. A three sigma limit should be reasonable for less than about 200 coordinates (assuming they are normally distributed.) REJECT LIMIT (NUMBER OF STANDARD DEVIATIONS)FULL ALGORITHM INFORMATIONYES: if you want step by step diagnostics informationINFO: Control passed to graphics windowCONTROL RETURNED TO TERMINAL WINDOWThe entered beam centre position may be kept fixed or may be refined along with the tilt and powder ring opening angles. If the beam centre is well known e.g. by using a semi-transparant beam-stop then it is probably better not to refine the position. Enter "YES" for the beam centre position to be refined, and "NO" if the present values are to be kept fixed. REFINE BEAM CENTREThe non-orthogonality of the detector plane to the beam may be refined using the shape of the powder rings. If you want to refine this non-orthogonality or "detector tilt" angles, enter "YES". Entering "NO" uses the existing tilt angles as constant in any refinement of the beam centre. REFINE DETECTOR TILTEnter "YES" to refine the sample to detector distance. Normally it is probably best initially to keep this fixed, so answer "NO". Having refined all other parameters, on a second iteration the distance can also be simultaneously refined. REFINE SAMPLE DISTANCEWARNING: There is nothing left to refine !!!NOTHING LEFT TO REFINE !!!INFO: Fitting ellipse to centre of gravity coordinatesINFO: Fitting powder rings to centre of gravity coordinatesINFO: Fit of powder ring to inclined detectorINFO: Alternative fit of powder rings to centre of gravity coordinatesINFO: In the absence of any other information, there are two equally valid solutions to the tilt angle and beam centre which could have formed a powder ring on an inclined detector. Theoretically these should both give the same goodness of fit, so both solutions are output. If the position of the beam-stop is known, then the "correct" solution may be selected.INFO: SOLUTION 1INFO: SOLUTIONINFO: SOLUTION 2You can only input "1" or "2"WHICH SOLUTION (SEE TERMINAL WINDOW)Enter "1" or "2" to choose the solution to saveWHICH SOLUTIONEnter "1" or "2" to chose the solution to saveSubroutine F2D_TILTINFO V0.3 INFO: The coordinate radial position error is totally undeterminedSubroutine F2D_TILT2INFO V0.3 Subroutine F2D_1DTRANSFORMS V0.5 THE DATA IS NOT 1-D ! CONTROL OF TRANSFORMATION TO INTENSITY VERSUS Q SPACE SCAN, OF THE FORM: [Log] I(q)**a * q**b versus [Log]q**c Coeff. a Coeff. b LOG I Coeff. c LOG X a: POWER OF INTENSITIES b: POWER OF Q MULTIPLIED BY I(q) TAKE LOG OF I(q)**a * q**b c: POWER OF Q TAKE LOG OF q**c Integer power a of I(q)**a for transformation Integer power b of I(q)**a * q**b for q tranformation "YES" to take Log of transformed intensities Integer power of q**c for X-axis values "YES" to take Log of transformed q values for the X-axis Subroutine F2D_GUI_PROJECTION V0.7 SCAN_TYPEMAXIMUM_DSCAN_SUMMATIONGEOMETRICAL_CORRECTIONPROJECTION 1-D SCAN CONTROL FORM SCAN TYPE SUMMATION GEOM. CORR. MAX. D-SPACING SCAN TYPE (D, RADIAL, 2-THETA, Q-SPACE) OUTPUT SUMMATION (NO NORMALISATION) CORRECT FOR GEOMETRICAL 1/Cos**3(o) EFFECT MAXIMUM FOR D-SPACINGS SCANS (ANGSTROMS) Select type of output 1-D scan: "RADIAL", "2-THETA", D, or "Q-SPACE" "YES" to output summation (approx), of projected region, "NO" to norma"YES" to applied intensity correction to flat plate geometry Enter maximum of range for calculation of D-spacing scans (Angstroms) PROJECTION RE-BINNING CONTROL FORM (under development) OUTPUT BIN SIZE BIN SIZE NO. BINS SIZE OF OUTPUT BINS (microns) Enter size of output pixels in millimetres for a radial distance scan SIZE OF OUTPUT BINS (degrees) Enter size of output pixels in degrees for a 2-theta scan SIZE OF OUTPUT BINS (Inverse nanometres) Enter size of output pixels in inverse nanometres for a Q-space scan SIZE OF OUTPUT BINS (Angstroms) Enter size of output pixels in Angstroms for a D-spacings scan NUMBER OF OUTPUT SCAN BINS Enter number of binsin output scan OUTPUT BIN SIZE CONTROL FORM : Distance ProjectionDistance (mm): 2-theta Projection2-Theta Angle (Degrees): Q-Space ProjectionQ (Inverse Nanometres): D-Spacings ProjectionD-spacing (Angstroms)Subroutine F2D_SPHERICAL_MOD V0.1 Click on meridian CLICK ON MERIDIANMeridian point must not be on beam centreSubroutine F2D_AXES V0.1 Subroutine F2D_TRIANGLE V0.1 Enter integer number in rangeX-PIXEL FOR 1ST VERTEXEnter X-pixel number of first triangle vertexY-PIXEL FOR 1ST VERTEXEnter Y-pixel number of first triangle vertexX-PIXEL FOR 2ND VERTEXEnter X-pixel number of second triangle vertexY-PIXEL FOR 2ND VERTEXEnter Y-pixel number of second triangle vertexX-PIXEL FOR 3RD VERTEXEnter X-pixel number of third triangle vertexY-PIXEL FOR 3RD VERTEXEnter Y-pixel number of third triangle vertexEnter real numberADDITION CONSTANTEnter real value to add to active data regionSubroutine F2D_DRAW_PEAKS V0.2 Subroutine F2D_GUI_PEAKSEARCH V0.17.peaksdata.peaksPEAK_SEARCH_BLUR_SIZEPEAK_SEARCH_BOX_SIZEPEAK_SEARCH_NUM_MINIMUMPEAK_SEARCH_MIN_SPACINGPEAK_SEARCH_DATA_LIMITPEAK_SEARCH_PEAK_SIGMAPEAK_SEARCH_BAD_SIGMAPEAK_SEARCH_DET_OFFSETPEAK_SEARCH_DET_GAIN#OVERLOAD_VALUEPEAK_SEARCH_DRAW_BADPEAK_SEARCH_OUTPUTCONTROL OF PEAK SEARCH VARIABLES (SAVED BETWEEN FIT2D SESSIONS) This form allows you to control various options controlling the peak search BLUR SIZE DATA MINIMUM MIN BACKGROUND BOX SIZE MIN. SPACING SATURATION PEAK SIGMA BAD SIGMA NUM PIXELS BAD WEAK DATA OFFSET DET. GAIN SAVE PEAKS OUTPUT FILE NUMBER OF PIXELS IN SMOOTHING MINIMUM ACCEPTED "GOOD" DATA VALUE MINIMUM NUMBER OF BACKGROUND PIXELS SIZE OF BACKGROUND BOX MINIMUM SPACING BETWEEN PEAKS DETECTOR SATURATION VALUE NUMBER OF SIGMA ABOVE MEAN NUMBER OF SIGMA BELOW MEAN MINIMUM NUMBER OF PIXELS IN A PEAK DRAW BAD BUT NON-SATURATED "PEAKS" DETECTOR OFFSET VALUE (DATA ZERO) DETECTOR GAIN FACTOR SAVE PEAK X/Y/I IN ASCII FILE NAME OF PEAK SEARCH OUTPUT FILE Enter size of top-hat"smoothing function Enter lowest accepted value for a pixel value (inclusive) Minimum number of background pixels for statistics Size of region for calculatingsigma Enter minimum spacing between peaks Enter value above which pixelswill be considered as saturateEnter number of standarddeviations above background Enter number of standarddeviations below background Enter minimum number of candidatepixels in a peak Enter "YES" to output bad non-saturated "peaks" Enter detector zero level value: detector offset value Enter detector gain (multipler on Poisson statistics Enter "YES" to save peak positions and intensities in an ASCEnter name of ASCII file to store results of peak search WORKING: PEAK SEARCHING WRITEWARNING: Problem outputing peak search resultsWARNING: Peak search failed: too many peaks for peak arraysINFO: Number of peaks with given ranges of estimated I / sigma(I) Lower Upper Number INFO: Number of peaks within given resolution ranges and average I / sigma(I) Lower Upper Number Subroutine F2D_3DSTYLE V0.2 NO LINES NO LINES: No lines drawn around the re-binned pixels LINES LINES: Draw lines around the re-binned pixels NO FILL NO FILL: No area filling of coloured polygons FILL FILL: Fill areas of surface with colour or Z-colours NO AXES NO AXES: Don't draw enumerated axes around the surface AXES AXES: Draw enumerated axis around the surface NO TOP NO TOP: Don't display upper 3-D projected image TOP IMAGE TOP IMAGE: Add 3-D projected image above 3-D surface NO LOWER NO LOWER: Don't display lower 3-D projected image LOW IMAGE LOW IMAGE: Add 3-D projected image below 3-D surface Enter valid integer3-D SURFACE STYLEnull EXIT ? HELP LIMITS MAXIMUM OUTPUT DIMENSIONEnter maximum number of pixelsCOLOUR LEVELSEnter number of colour levelsLINES NO LINES FILL NO FILL AXES NO AXES TOP IMAGE NO TOP: Don't display lower 3-D projected image NO TOP LOW IMAGE NO LOWER Subroutine F2D_DRAW_BANNER V0.14fit2dCopyright 1987-2003 Andy Hammersley / ESRFUse of FIT2D implies acceptance ofthe " Conditions of Use "(Click on "CONDITIONS")(See Reference Manual)NO TITLESubroutine F2D_INP_WAVELENGTH V0.4 Enter the wavelength of the X-ray radiation in Angstroms. (1 Angstrom = 0.1 nm). Some typical values (Angstroms) are: Cu K alpha 1 = 1.540614 (8.04778 keV) Mo K alpha 1 = 0.7093243 (17.47934 keV) Must be valid real numberWAVELENGTH (Angstroms) (0.0 for keV )ENERGY OF RADIATION (keV)Enter energy of X-rays in keV (an average will do)Subroutine F2D_2DDISTORTION V0.10INFO: The grid appears to be hexagonal and distortion values will be calculated on this assumption. (Something is very wrong if the grid is actually cartesian.)INFO: Average rotation (both rows and columns) = Enter required pixel X-size for calculating distortion Value must be within given range IDEAL X-PIXEL SIZE (MICRONS)Enter required pixel Y-size for calculating distortion IDEAL Y-PIXEL SIZE (MICRONS)Enter rotation angle of grid on detector GRID ROTATION ANGLE (DEGREES)Enter number (X-direction) of hole which is considered to have zero distortion X-NUMBER OF IDEAL HOLEEnter number (Y-direction) of hole which is considered to have zero distortion Y-NUMBER OF IDEAL HOLEWARNING: Specified grid position is missing from data image, please specify another peakpositionSubroutine F2D_CAL_DISTORTION V0.3 Subroutine F2D_CAL_DISTORTION V0.3 Value must be within given rangeCALCULATE X-DISTORTIONEnter "YES" for X-distortion, "NO" for Y-distortion WARNING: Active Data Region (ADR) extends outside valid region ofspline. Pixels outside the valid region will be ignored.INFO: The valid region of the spline correction function is:X-Distortion Spline FunctionY-Distortion Spline FunctionSubroutine F2D_CALIBRATE2DGRID V0.15#INPUT_FORMATNone IMAGEQUANT Value must be within given rangeWARNING: The horizontal peak search vector must point to the right and the vertical peak search vector must point upwardsEnter the maximum number of pixels a search for a new peak centre may continue from the original predicted centre (based on previously found peaks). (This does not affect the searching for the starting three peaks, but affects all other peaks). MAXIMUM PEAK SEARCH DISTANCE (PIXELS)Enter ratio above which a new "peak" is considered to be found. This the minimum ratio of maximum cross-correlation value for a new "peak" divided by the maximum cross-correlation value of the last found peak. This value is used to discriminate against noise. If this value is too low, noise may be counted as peaks, if it is too high, then true peaks may be discarded. PEAK DETECTION RATIOEnter standard deviation width of grid peaks in pixel units. An approximate value will work, but will not produce optimum estimates of the peak centres i.e. the average centre will be correct, but the variance will be higher. For the ESRF Berylium tube XRII with the copper grid a value of 2.6 is about optimum. If you do not know a suitable value, then after an initial "FIND PEAKS" you may calculate an averaged peak profile at sub-pixel resolution using the "LEARN HOLE PROFILE" command. This will produce the averaged profile in the memory, which may be fitted with a 2-D Gaussian within the "FIT" sub-menu. PEAK STANDARD DEVIATION WIDTH (PIXELS)NUMBER OF SUB-PIXELSMore takes longer, but can give more accurate resultsINFO: Starting peaks found O.K.WARNING: Problem finding the starting peaks, please re-enterPROGRESS REPORT FREQUENCY (PEAKS)Number of peaks between progress report messages INFO: Starting peak search, this takes some time for big gridsIn order to calibrate the absolute pixel sizes and spatial distortion value the distances between grid holes in the calibration grid need to be input. At the ESRF the beryllium entrance window X-ray image intensifer / CCD detector systems are normally calibrated with a grid with a 5000 micron spacing. The image plates are normally calibrated using a grid which has a grid spacing of 4000 microns, but another finer grid is available with a 2000 micron spacing. GRID SPACING (CENTRE TO CENTRE IN microns)When a mask hole is off-axis (non-orthogonal to the beam) the width of the mask casts a shadow which changes the apparent size and centre of the hole as recorded on the detector. This option allows this effect to be very largely corrected, assuming that the mask is orthogonal to the beam, and that the mask hole sizes are perpendicular to the surface of the mask. CORRECT OFF-AXIS MASK VIGNETTINGSubroutine F2D_CLINEARISE V0.8 INFO: To linearise the data it is necessary to give the name of a file which contains values of the raw intensity values together with corresponding values on the required (linearised) scale. The raw intensity values correspond the X-coordinates and the corresponding linearised intensities the Y-coordinates.Enter name of file containing non-linear and linear intensities valuesSubroutine F2D_CORR_FAST V0.4 Subroutine F2D_CORR_FAST V0.4 #OVERLOAD_VALUEIn order to avoid over-loaded pixels being re-binned and their intensity spread out to an undetermined value, you can enter a "over-loaded" pixel value. All input pixels which have this value or more, will cause one or more output pixels to be incremented by the value regardless of the normal proportional are re-binning algorithm. Thus over-loaded pixels in the output image can be easily identified and ignored. (This can be turned-off by entering a very large value.) Enter a real value within given rangeOVER-LOADED PIXEL VALUENOTE: Corrected data is in the "memory" array. Use "EXCHANGE" in the main menu to transfer to the working current data array.Subroutine F2D_CORR_SPATIAL V0.12Subroutine F2D_CORR_SPATIAL V0.12 WARNING: Active Data Region (ADR) extends outside valid region ofspline. Pixels outside the valid region will be ignored.INFO: The valid region of the spline correction function is:#OVERLOAD_VALUEIn order to avoid over-loaded pixels being re-binned and their intensity spread out to an undetermined value, you can enter a "over-loaded" pixel value. All input pixels which have this value or more, will cause one or more output pixels to be incremented by the value regardless of the normal proportional are re-binning algorithm. Thus over-loaded pixels in the output image can be easily identified and ignored. (This can be turned-off by entering a very large value.) Enter a real value within given rangeOVER-LOADED PIXEL VALUEFor efficiencies sake many rows of the distortion functions can be calculated in one call to the NAG subroutine which performs the task. However, to store the results extra memory is required. (The memory is allocated automatically from the machines virtual memory and is de-allocated after the spatial distortion correction is finished and the storage is no longer necessary.) Thus, the value entered here choses a compromise between using more memory and taking longer to calculate all the necessary distortion values. If the machine has plenty of available memory (virtual) a larger number such as 100 may be more efficient. However, if the machine is short of virtual memory e.g. you have already received an error message that memory allocated has failed, then a smaller value will be appropriate. NOTE: Too big a number may be counter-productive as it may cause excessive page faulting. The sign determines the type of re-binning algorithm which is applied: positive means the centre of the edges of each distorted pixel are calculated and over-lapped areas are approximated by orthogonally aligned edges. Negative means the corner positions will be calculated and straight lines are "drawn" between the corners to provide continuous quadrilaterals. The intensity is re-binned according to the over-lapped areas of these polygons. This takes about three times longer ! Enter an integer within given rangeNUMBER OF ROWS OF DISTORTION FUNCTIONS TO CALCULATED IN A BLOCKWARNING: At least 2 rows must be calculated together i.e. >= -+2NOTE: Corrected data is in the "memory" array. Use "EXCHANGE" in the main menu to transfer to the working current data array.Subroutine F2D_DECAY V0.4 The default decay correction is set up for Fuji white or blue imaging plates read out by the Molecular Dynamics 400E scanner. The decay measurements were taken during the ESRF Experimental Hall summer mode operation. For another scanner, another type of imaging plate, or for data taken at a different temperature you may want to re-define the constants used to calculate the decay correction. Enter "YES" if you want to define different decay fit constants or scanner delay and read-out times. Enter "YES" or "NO"FULL USER CONTROL The decay is approximated by the sum of two exponential decays. Thefraction of remaining signal t seconds after exposure F_t is defined by: F_t = P_fast * Exp(-t/T_fast)+ (1.0 - P_fast) * Exp(-t/T_slow)where: P_fast is the proportion of the fast decay component T_fast is the time constant of the fast decay (in seconds) T_slow is the time constant of the slow decay (in seconds)Enter proportion that the fast decay makes to the intensity decay (P_fast) Must be a valid real number within the given rangePROPORTION FAST DECAYEnter time constant (in seconds) of the fast decay process (T_fast) TIME CONSTANT OF FAST DECAY (SECONDS)Enter time constant (in seconds) of the slow decay process (T_slow) TIME CONSTANT OF SLOW DECAY (SECONDS)The program calculates for each line in the image the average decay thathas taken place from the longest time from first exposure to the scan,to the shortest time from the end of the exposure to the scan. To knowthis it needs to know how long was the exposure, the time between theexposure and the user start of the scan (both these questions are askedlater), the time from the user start of the scan (click with with the mouse, or similar) to the physical scan of the first line of the image,and the time to scan each line of the image. The time to scan each lineis calculated from the total time of the physical scan divided by thenumber of scanned lines.Enter the number of seconds between the user request for the scan and the actual start of scanning the first line in the image Must be valid real number within given rangeSTART-UP TIME (SECONDS)Enter the number of seconds it takes to scan the image IMAGE SCAN TIME (SECONDS)Enter the number of lines scanned in the time entered above Must be valid integer number within given rangeNUMBER OF SCANNED LINES176 MICRON SCAN ("NO" FOR 88 MICRON)Enter scan resolution mode: "YES" for 176 micron, "NO" for 88 micronMust be valid real numberEXPOSURE LENGTH (SECONDS)Enter the length of the exposure in secondsEnter the time in seconds between the end of the exposure and the time that the scan was started (the scan button was pressed on the computer). (The program knows the delay time between the button being pressed and the physical start of the laser scan on the image plate ELAPSE TIME (FROM END OF EXPOSURE TO SCAN, SECONDS)Subroutine F2D_DESTROYPEAKS V0.1 Value must be within given rangeX-PEAK NUMBER TO DESTROY (0 to exit)Enter X-peak number to see it's positionY-PEAK NUMBER TO DESTROYEnter Y-peak number to see it's positionDESTROY PEAKEnter "YES" to destroy the peak, "NO" to leave itINFO: Peak is missingSubroutine F2D_DISPLAY2DDISTORTION V0.2 Subroutine F2D_DISPLAY2DDISTORTION V0.2 Value must be within given rangeDISPLAY X-DISTORTIONEnter "YES" for X-distortion, "NO" for Y-distortion 2-D X-DistortionHorizontal PeaksVertical PeaksX-Distortion in pixels (Ideal - Measured)2-D Y-DistortionY-Distortion in pixels (Ideal - Measured)Subroutine F2D_DIST2MEM V0.1 Subroutine F2D_DIST2MEM V0.1 Enter "YES" or "NO"STORE X-DISTORTION IN MEMORYEnter "YES" for X-distortion, "NO" for Y-distortion 2-D X-DistortionX-Distortion in pixels (Ideal - Measured)2-D Y-DistortionY-Distortion in pixels (Ideal - Measured)Horizontal Grid HolesVertical Grid HolesSubroutine F2D_FALSEPEAK V0.1 Click on peak next to false peak to create Click on centre of peak next to false peakClick on peak away from false peak position Click on peak away from false peak positionClick on background Click on backgroundSubroutine F2D_FIT2DGRID V0.12INFO: Fitting X-Distortion WARNING: Spline fit to X-distortion function failed: Too many spline knots required. Required RMS discrepency too small Invalid calling arguments Work space not big enoughINFO: An interpolating spline has been calculated for the X-distortionINFO: A weighted least-squares polynomial has been calculated for the X-distortionINFO: A minimum norm least-squares spline from a (numerically) rank deficient system has been calculated for the X-distortionINFO: X-Distortion SplineINFO: Fitting Y-Distortion WARNING: Spline fit to Y-distortion function failedINFO: An interpolating spline has been calculated for the Y-distortion Y-distortion deficient system has been calculated for the Y-distortionINFO: Y-Distortion SplineSubroutine F2D_FLATFIELD V0.13ERROR: No enough virtual memory for operationINFO: You are required to input a file which contains a list of angles in degrees and intensity values, for the emission of the flood- field source as a function of angle. This will be used to correct the "flood-field" image to a "flat-field" image. Normally, the angles will vary from slightly above 0.0 to 30 degrees or so. Zero degrees is generally missing because of the beam-stop. You are advised not to input values which were behind the beam-stop, as this is likely to cause a dis-continuity in the data. This dis- continuity would cause problems with the fitting and interpolation of the data. (Previous, various options were available to treat such scan data here. These have been removed, but the same facilities are available in the main menu.)Enter name of file containing 1-D 2-theta scan of sourceMust be valid real numberFLAT-FIELD CENTRE X-COORDINATE Enter X-coordinate of centre flat-field measurementFLAT-FIELD CENTRE Y-COORDINATE Enter Y-coordinate of centre of flat-field measurementNOTE: !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!NOTE: UNITS OF SAMPLE DETECTOR DISTANCE HAVE CHANGED TO MILLIMETRESSAMPLE: DETECTOR DISTANCE (MILLIMETRES)Enter distance from centre of sample to detector (millimetres)PIXEL X-SIZE (MICRONS)Enter X-size of one pixel in microns PIXEL Y-SIZE (MICRONS)Enter Y-size of one pixel in microns Enter fractional absorption; to be used to calculate off-axis absorption correction. If no off-axis correction is required enter 0.0. If off-axis correction is required enter the on-axis axis absorption as a fraction e.g. If the transmission is 80% enter 0.2 for the absorption. ON-AXIS ABSORPTION (FOR OFF-AXIS CORRECTION)NOTE: Corrected flat-field is in the current data array (don't EXCHANGE)Subroutine F2D_IDEALSPACE V0.1 Subroutine F2D_IN_SPATIAL V0.10Name of file for spatial distortion interpolation functionREAD_ASCIISPATIAL DISTORTION SPLINEDISTORTION FUNCTION FROM IDEALWARNING: File is wrong sort of distortion spline function (ideal grid to distorted grid spline)WARNING: File is not a distortion spline function fileSubroutine F2D_INP_DCLUT V0.7 Subroutine F2D_INP_DCLUT V0.7 DCLUT_FILE_NAME.dclttest.dcltUSE is the default file for input of the look-up table. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR DISTORTION CORRECTION LOOK-UP TABLE Use the file selection tool to select a directory and an input file to contain the distortion correction lut. Normally such a file ends with the extension ".dclt". INPUT FILE NAMEName of file containing distortion correction LUTUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)Inverse Flat-Field Response ImageSubroutine F2D_LEARNPROFILE V0.1 Enter size of profile to calculate in terms of input pixels i.e. the number of input pixels whichwill be used to calculate the profile Value must be within given rangeSIZE OF PROFILE (INPUT PIXELS)Enter number of resolution samples per pixel to be used to calculate the average profile e.g. 2 means that each output pixel corresponds to half of the original pixel size NUMBER OF OVER-SAMPLING SUB-PIXELSWARNING: Program arrays are not big enough to calculate required profileAverage Peak ProfileX-directionY-directionIntensitySubroutine F2D_OUT_DCLUT V0.9 Subroutine F2D_OUT_DCLUT V0.9 ERROR: The defined size of the data is not the same as the size of the look-up table..dclttest.dcltUSE is the default file for output of the look-up table. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR DISTORTION CORRECTION LOOK-UP TABLE Use the file selection tool to select a directory and an output file to contain the distortion correction lut. Normally such a file ends with the extension ".dclt". OUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)Click on "YES" or "NO"STORE INVERSE NORMALISED FLAT-FIELD RESPONSE (MUST BE PRESENT)Enter "YES" to save inverse flat-field response dataWRITEWARNING: Error in opening fileDISTORTION CORRECTION LOOK-UP TABLE V02.00 !!! END OF HEADER SECTION !!! ERROR: The relative change in distortion is too large for the storage schemeERROR: Problem writing data to fileDCLUT_FILE_NAMESubroutine F2D_OUT_SPATIAL V0.8 Name of file for spatial distortion interpolation functionWRITEWARNING: Problem outputting spatial distortion file (quota full ?)Subroutine F2D_RESIDUALS V0.2 Subroutine F2D_RESIDUALS V0.2 Enter "YES" or "NO"CALCULATE X-RESIDUALSEnter "YES" for X-distortion fit residuals, "NO" for Y-distortionX-DISTORTION FIT RESIDUALSY-DISTORTION FIT RESIDUALSSubroutine F2D_SAVE2DPEAKS V0.3 Name of file for peak positionsWRITESubroutine F2D_SDLUT V0.4 Subroutine F2D_SDLUT V0.4 Subroutine F2D_SDLUTSUB V0.4 Subroutine F2D_SDLUTSUB V0.4 INFO: Starting to create spatial distortion look-up tableWARNING: At one or more positions the X-distortion was too large to be stored in the look-up table (+-127 pixels). At these points the distortion is set to the maximum storable value. If this only affects the extremes of the detector it is probably not important.WARNING: At one or more positions the Y-distortion was too large to be re-binning into more than three output pixels (X-direction). re-binning into more than three output pixels (Y-direction).Subroutine F2D_VIEW2DPEAKS V0.2 Value must be within given rangeX-PEAK NUMBER TO VIEW (0 to exit)Enter X-peak number to see it's positionY-PEAK NUMBER TO VIEWEnter Y-peak number to see it's positionINFO: Peak was not found Enter "YES" or "NO"Enter integer in given rangeOUTPUT VALUES OF ROW OR COLUMNYES for choice of row or column outputOUTPUT VALUES OF ROW OF PEAKSYES for grid row, "NO" for grid columnNUMBER OF ROWEnter number of row to outputNUMBER OF COLUMNEnter number of column to outputSubroutine F2D_XRIIFLATFIELD V0.1 INFO: The detector system is modelled by two spheres of finite thicknesses: an inner sphere where the X-rays are detected, and an outer sphere (vacuum vessel or the detector) which attenuates the X-ray prior to possible detection. The source position is assumed to be on-axis. Enter radius of curvature of the outer surface of the X-ray detection layer. Units are in metres. (For the ESRF XRII/CCD Beryllium system radius = 0.4m???, and the Aluminium system radius = 0.5m???) Must be valid real number within given rangeRADIUS OF DETECTION LAYER (OUTER SURFACE: METRES) RADIAL THICKNESS OF DETECTION LAYER (METRES) Enter thickness of X-ray detection layer (metres)Enter absorption coefficient for the detection layer at the photon wavelength/energy you wish to correct. The units are per metre and NOT per centimetre. If you have a value in per centimetre units you should multiply it by 100. Values for the ESRF XRII/CCD system at different photon energies/wavelengths are: (to be defined) DETECTION LAYER ABSORPTION COEFFICIENT (PER METRE)Enter radius of curvature of the outer surface of the vacuum vessel RADIUS OF VACUUM LAYER (OUTER SURFACE: METRES) RADIAL THICKNESS OF VACCUM/PROTECTION LAYER (METRES)Enter thickness of vacuum/protection layer (metres)Must be valid real numberFLAT FIELD CENTRE X-COORDINATE Enter X-coordinate of centre flat field measurementFLAT FIELD CENTRE Y-COORDINATE Enter Y-coordinate of centre of flat field measurementEnter the distance from the centre of the sample to the outer edge of the detector vaccum vessel in metres SAMPLE TO DETECTOR (OUTER VACUUM VESSEL) DISTANCE (METRES)RAW PIXEL X-SIZE (MICRONS)Enter X-size of one raw pixel in microns RAW PIXEL Y-SIZE (MICRONS)Enter Y-size of one raw pixel in microns Subroutine F2D_DIFFRACTION V0.8 Subroutine F2D_2THETATORINGS V0.4 WARNING: The 2-theta scan needs to be defined in the X-direction whereas the input data appears to be defined in the Y-direction. Maybe you need to use the "TRANSPOSE" command in the keyboard interface main menu.CONTROL OF POWDER PATTERN SIMULATION FROM A 2-THETA SCAN X-START PIXEL Y-START PIXEL X-END PIXEL Y-END PIXEL X-PIXEL SIZE Y-PIXEL SIZE POLARISATION FACTOR DISTANCE X-BEAM CENTRE Y-BEAM CENTRE TILT PLANE TILT X-PIXEL FOR START OF OUTPUT REGION Y-PIXEL FOR START OF OUTPUT REGION X-PIXEL FOR END OF OUTPUT REGION Y-PIXEL FOR END OF OUTPUT REGION X-PIXEL SIZE (HORIZONTAL) IN MICRONS Y-PIXEL SIZE (VERTICAL) IN MICRONS APPLY POLARISATION EFFECT POLARISATION FACTOR SAMPLE TO "DETECTOR" DISTANCE (MM) X-PIXEL COORDINATE OF DIRECT BEAM Y-PIXEL COORDINATE OF DIRECT BEAM ROTATION ANGLE OF PLANE OF TILT (DEGREES) TILT ANGLE OF DETECTOR (DEGREES) Enter X-pixel number for start of output region Enter Y-pixel number for start of output region Enter X-pixel number for end of output region Enter Y-pixel number for end of output region Enter size of pixel in the X-direction (horizontal) in microns Enter size of pixel in the Y-direction (vertical) in microns Enter "YES" to apply polarisation effect Enter ratio of horizontal to vertical polarisation ((I_h - I_v) / (I_hEnter sample to detector distance (mm) Enter X-pixel coordinate of centre of the direct beam Enter Y-pixel coordinate of centre of the direct beam Enter rotation angle anti-clockwise from the X-axis of the plane of tiEnter angle of tilt of the detector in the tilt plane (degrees) HELP TEXT; NOT YET AVAILABLEWORKING: SIMULATING PATTERN NOTE: ORIGINAL DATA STORED IN THE MEMORY X-directionY-directionSubroutine F2D_CHEBYSHEV V0.4 Must be within specified boundsPOLYNOMIAL X ORDEROrder of polynomial function in X-directionPOLYNOMIAL Y ORDEROrder of polynomial function in Y-directionINFO: 2-D Chebyshev polynomial coefficients calculatedWARNING: The polynomial could not be fitted in the X-direction owing to insufficient number of data pointsSubroutine F2D_CONSTRAIN V0.4 VIEW Enter valid numberMust be within set limitsContraints sub-menu: enter commandEnter one of the available commandsMODIFY LOWEST PARAMETER NUMBER TO MODIFYEnter number of lowest parameter to be modified (0 for no modification)HIGHEST PARAMETER NUMBER TO MODIFYEnter number of highest parameter to be modified (0 for no modification)CONSTRAINED UNCONSTRAIN UNCONSTRAINEDCONSTRAIN CONSTRAIN SET UNCONSTRAIN CONSTRAIN - Constrain value to a constant value SET - Set to new value UNCONSTRAIN - Allow value to be varied ENTER MODIFICATIONEnter one of the avialable choicesSET ENTER NEW PARAMETER VALUEEnter new value for parameterLOWEST PARAMETER NUMBER TO VIEWEnter number of lowest parameter to view HIGHEST PARAMETER NUMBER TO VIEWEnter number of highest parameter to view ('PARAMETER NUMBER ', i3, 1x, a, 1x, a, ' Value = ', g14.5) EXIT WARNING: Unknown command, please type againSubroutine F2D_FEATURE V0.6 Subroutine F2D_MASKCOLOUR V0.2 COLOUR FOR MASKED OFF ELEMENTSSubroutine F2D_MASKMEMORY V0.1 Data Mask(1.0 equals masked element)Subroutine F2D_MASKSTATS V0.2 Subroutine F2D_MASKTHRESHOLD V0.2 INFO: This option allows masked-off elements with the ADR to be defined automatically depending on the data values. The user can set a threshold operation ( or ) and a threshold level. All data values which CONFORM WITH the defined test will be set to be masked-off. All others will be changed. WARNING: This option used to also "un-mask" elements; this behaviour has been changed so now elements are only masked or left in their previous state. To un-mask elements, use "CLEAR MASK" before this command."YES" if mask elements are to be selected by a lesser than comparison (exclusive), "NO" if mask elements are to be selected by a greater than comparison (exclusive) Enter "YES" or "NO"LESS THAN COMPARISONEnter real numberDECISION THRESHOLD DATA VALUEInput pixel data value for threshold decisionCALCULATING MASK: PLEASE WAITUNKNOWNDIRECTUNFORMATTEDSubroutine F2D_OUT_PARAMETERS V0.5 fit2d.par OUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)WARNING: Error in opening fileTRUE FALSE$FFF_STARTFIT2D Parameter File$BIG_ENDIANheaderFIT2D parameter filedata_masktotal_paramsnumber_featuresnumber_resultsx_ordery_orderx_min_polyy_min_polyx_max_polyy_max_polyapply_weightsaccuracyiters_per_parammodel_evolvedisplay_frequencyfast_displayhalt_criterionhalt_valueparameter_valuesparameter_descriptionsparameter_scalesparameter_namesresult_names$FFF_ENDEnd of parameter dataSubroutine F2D_PARAMETERS V0.8 GRAPHICALLY Input methodEnter one of the available choicesFILE Subroutine F2D_POWDERDIFFRACTION V0.18Enter "YES" or "NO"CHANGE BEAM CENTRE AND/OR TILT VALUESYES: to specific new values for parametersEnter: "YES" if you want to produce a 1-D scan as a function of equal angle pixels. "NO" if you want to produce a 1-D scan as a function of equal radial distance pixels (on an orthogonal detector). (The two are not the same.) The best choice will depend on the capabilities on any further processing software. e.g. If a Rietveld program requires equal angle pixels then this is clearly the choice. If either type of scan may be treated then the equal radial re-binning is probably perferable. PRODUCE EQUAL ANGLE PIXEL SCANEnter required angle step between bins for the calculation of the 1-D 2 theta scan. (The default value corresponds to the angular size of the average pixel size at the beam centre.) Must be within given range2 THETA SCAN ANGULAR PIXEL STEP (DEGREES)Enter required spacing between pixel positions for the calculation of the radial profile i.e. Each pixel in the radial profile should correspond to what pixel distance from the image. RADIAL PIXEL SIZE (MICRONS)YES: if a the detector spatial distortion has been characterised and is to be taken into account. If you answer "YES" you will be required to input the name of a valid spatial distortion interpolation file. TAKE ACCOUNT OF SPATIAL DISTORTIONIf the data is to be Rietveld refined it is probably appropriate to output it now into a "PDS" file (Powder Diffraction Standard) file. (The scan will be saved in the memory, but the number of pixels contributing to each scan bin will be lost if the file is not created now.) SAVE DATA IN "POWDER DIFFRACTION STANDARD" FORMAT: Angular ProfileTwo-Theta Angle (degrees): Radial ProfileRadial distance (mm)Intensity (normalised)Subroutine F2D_RADIAL V0.2 The world-coordinate spacing between pixel positions for the calculation of the radial profile Must be in set rangeRADIAL PIXEL SPACINGMust be valid realX-COORDINATE OF RADIAL SYMMETRYX-centre for radial profileY-COORDINATE OF RADIAL SYMMETRYY-centre for radial profileSubroutine F2D_RTHETA V0.9 WARNING : This option is still in a developmental stage User input will change, check results carefullyEnter "YES" or "NO"CHANGE BEAM CENTRE AND/OR TILT VALUESYES: to specific new values for parametersEnter: "YES" if you want to produce a 1-D scan as a function of equal angle pixels. "NO" if you want to produce a 1-D scan as a function of equal radial distance pixels (on an orthogonal detector). (The two are not the same.) The best choice will depend on the capabilities on any further processing software. e.g. If a Rietveld program requires equal angle pixels then this is clearly the choice. If either type of scan may be treated then the equal radial re-binning is probably perferable. PRODUCE EQUAL ANGLE PIXEL SCANThe active data region, with the exception of masked-off areas is rebinned to a azimuth/radial binned array. Where each pixel represents an equal angular/radial area. You may chose the number of azimuth and radial bins to be used. Must be within given rangeNUMBER OF AZIMUTH BINSNUMBER OF 2-THETA ANGLE BINSNUMBER OF RADIAL DISTANCE BINSEnter the maximum 2-theta angle (degrees) for the output re-binned region. MAXIMUM 2-THETA LIMIT (DEGREES)Enter the maximum radial distance (X-pixel units) MAXIMUM RADIAL LIMIT (X PIXELS)YES: if a the detector spatial distortion has been characterised and is to be taken into account. If you answer "YES" you will be required to input the name of a valid spatial distortion interpolation file. The total integrated intensity in the transformed region can be preserved by answering "YES". The integrated intensity in defined azimuthal/radial regions should also be approximately preserved. However, for producing a number of 2 theta scans, it is probably better not to preserve total intensity. Answering "NO" means that each output pixel is normalised by the number of input pixels CONSERVE INTEGRATED INTENSITY: Azimuth/2-thetaAzimuth (Degrees)2-Theta Angle (Degrees): Azimuth/Radial DistanceRadial Distance (mm)Subroutine F2D_SCALE V0.3 VIEW ENTER COMMANDMODIFY Enter number of parameter to be modified, (0 if no parameter is to be modified) PARAMETER NUMBER('PARAMETER NUMBER ', i3, 1x, a, ' Value = ', g12.5, 'Scale = ', g12.5) NEW SCALE SIZEEXIT WARNING: Unknown command, please re-enterSubroutine F2D_SETUP V0.2 VIEW FITTING SETUP SUB-MENU: ENTER COMMANDACCURACY Required accuracy: 1.0 = An one sigma fit (on average) throughout the data region. ( < 1.0 higher accuracy, closer fit to data > 1.0 Lower accuracy, looser fit to data ) ACCURACY LEVELDISPLAY FREQUENCY How often should the result of the fit be displayed. (0 = No display) Must be within set limits GRAPH FREQUENCYCHANGE FIT ORDER Multiple frame fitting will now be in reverse order Multiple frame fitting will now be in normal order EXIT FAST DISPLAY Minimal text will be added to fit graphical output Full text will be added to fit graphical output HALT CRITERION What halt criterion do you want to use to permaturely stop the fitting 0 = No halt criterion 1 = Upper limit on goodness of fit HALT CRITERIONEnter upper limit for the goodness of fit MAXIMUM GOOD FITMAXIMUM LIKELIHOOD The Maximum Likelihood method (MLM) will be applied Least Squares fitting will be applied MODEL EVOLUTION The minimised fit parameters for one will be used as the starting parameters for the next fit The user input fit parameters will be used as the starting parameters for all the fits NUMBER ITERATIONS Maximum number of iterations per fit per unconstrained parameter NUMBER PER PARAMETERPOISSON STATISTICS Poissonian statistics will be taken into account by model derived weighting Gaussian statistics weighted by entered data errors REQUEST CONTINUATION How many frames are to be fitted between continuation requests Return "0" for no requests Must be within defined limits REQUEST INTERVAL('ACCURACY : ', g12.5, ' (Average ','standard deviations per data point)') ('DISPLAY FREQUENCY : ', i6,' (Frequency of graphical output)') FAST DISPLAY : TRUE (Minimal text will be added to fit graphical output) FAST DISPLAY : FALSE (Full text will be added to fit graphical output) REVERSE : TRUE (Multiple frame fitting in reverse order) REVERSE : FALSE (Multiple frame fitting in normal order) ('HALT CRITERION : ', i1, ' (','No halt criterion)') ('HALT CRITERION : ', i1 ,' (','Upper limit on goodness of fit)') ('HALT VALUE : ', g12.5,' (','Meaning defined by HALT CRITERION)') MODEL EVOLUTION : TRUE (Minimised parameters used for next fit) MODEL EVOLUTION : FALSE (Initial parameters used for all fits) ('NUMBER ITERATIONS : ', g12.5, ' (Per unconstrained parameter)') WEIGHTED FIT : TRUE (Fit weighted by error values) WEIGHTED FIT : FALSE (Fit unweighted) POISSON STATISTICS : TRUE ( Model derived weighting) POISSON STATISTICS : FALSE ( Weighting by ERROR array) MAXIMUM LIKELIHOOD METHOD : TRUE (Applied to fitting) MAXIMUM LIKELIHOOD METHOD : FALSE (Fit by Least Squares Method) No user CONTINUATION requests ('User CONTINUATION ''prompts every ', i4, ' frames') WEIGHTED FIT Error weighting will now to be used for the fit minimisation No weighting will now to be used for the fit minimisation WARNING: Unknown command, please re-enterSubroutine F2D_UNINORMALISE V0.4 Enter "YES" or "NO"HORIZONTAL NORMALISATION"YES" if normalisation for horizontal direction, "NO" for verticalWARNING: Work arrays too small, operation not performedSubroutine F2D_GUI_GEOMETRY V0.7 EXPERIMENTAL GEOMETRY CONTROL FORM X-PIXEL SIZE Y-PIXEL SIZE DISTANCE WAVELENGTH X-BEAM CENTRE Y-BEAM CENTRE TILT ROTATION ANGLE OF TILT SIZE OF HORIZONTAL PIXELS (MICRONS) SIZE OF VERTICAL PIXELS (MICRONS) SAMPLE TO DETECTOR DISTANCE (MM) WAVELENGTH (ANGSTROMS) X-PIXEL COORDINATE OF DIRECT BEAM Y-PIXEL COORDINATE OF DIRECT BEAM ROTATION ANGLE OF TILTING PLANE (DEGREES) ANGLE OF DETECTOR TILT IN PLANE (DEGREES) Enter dimension of pixels horizontally, as displayed (micronEnter dimension of pixels vertically, as displayed (microns)Enter sample to detector distance (mm) Enter the wavelength of the radiation in Angstrom units Enter X-pixel coordinate of centre of the direct beam Enter Y-pixel coordinate of centre of the direct beam Enter rotation angle of the plane in which the tilt occurs Enter angle of detector tilt within the tilt plane X_PIXEL_SIZEY_PIXEL_SIZEWAVELENGTHSAMPLE_DISTANCEX_BEAM_CENTREY_BEAM_CENTRETILT_ROTATIONTILT_ANGLESubroutine F2D_INP_DETECTORTILT V0.2 The detector would ideally be orthogonal to the direct X-ray beam, but in practice it is unlikely to be completely orthogonal, but hopefully any tilt is small. To define the tilt two angles are specified. The first angle is the rotation angle within the ideal orthogonal plane anti-clockwise from the X-axis (horizontal rightwards, looking from the sample to the detector). This rotation defines the "tilt plane" within which the detector is tilted by a single rotation angle. The beam is in the tilt plane. The tilt angle is the angle anti-clockwise from the ideal orthogonal detector plane to the actual tilted detector plane. Must be valid real number within given rangeTILT PLANE ROTATION ANGLE (DEGREES)DETECTOR TILT ANGLE (DEGREES)Subroutine F2D_INP_PIXELSIZES V0.5 Must be valid real numberX-DIRECTION PIXEL SIZE (MICRONS)Enter X-dimension size of one raw pixel in microns Y-DIRECTION PIXEL SIZE (MICRONS)Enter Y-dimension size of one raw pixel in microns X_PIXEL_SIZEY_PIXEL_SIZESubroutine F2D_INP_SAMPLEDISTANCE V0.2 Enter distance from the sample to the detector in millimetres. As the detector may be tilted this is the distance from the centre of the sample to the intersection of the direct beam and the detector or in the case of a spatially corrected image the grid mask. Must be valid real number within given rangeSAMPLE TO DETECTOR DISTANCE (MILLIMETRES)Subroutine F2D_ADDPOWDERRING V0.2 Subroutine F2D_INP_BEAMCENTRE V0.1 Must be valid real numberX-PIXEL COORDINATE OF BEAM CENTREEnter X-pixel coordinate of beam centreY-PIXEL COORDINATE OF BEAM CENTREEnter Y-pixel coordinate of beam centreSubroutine F2D_RECIP2UNIT V0.1 Subroutine F2D_UNIT2RECIPROCAL V0.1 Subroutine F2D_INP_DATATYPE V0.1 iINTEGER VALUE lLOGICAL (BOOLEAN) VALUE rFLOATING POINT (REAL) VALUE suCHARACTER STRING VALUE ENTER DATA TYPE OF VARIABLEChoice one of the available data typesBOOLEAN VALUE REAL VALUE STRING VALUE Subroutine F2D_ARCSLICE V0.8 In order to define an arc, three coordinates must be input in the following order: starting point, a point on the arc, and the end point. Note that changing the order of the first and third point will result in the 1-D slice being the opposite way round. ENTER ARC THREE COORDINATES (START, MIDDLE, END)Arc Slice: PixelsNot definedINFO: The "Arc-Slice" is stored in the memorySubroutine F2D_CONTINUE V0.4 FIT2D: DISPLAY WAIT MENUnull EXIT ? PRINT DISPLAY WAIT MENUSubroutine F2D_DISTANCE V0.1 ENTER POINTS FOR DISTANCE CALCULATIONClick on 2 X/Y coordinatesSubroutine F2D_GSTATISTICS V0.12Click on points to define an arbitrary polygon region, in which various statistics will be calculated. ENTER COORDINATES TO DEFINE POLYGON REGIONPLEASE WAIT: CALCULATING POLYGON STATISTICS##MINIMUMr##MAXIMUM##MEAN##RMS##SIGMA##TOTAL##INTEG_MINUS_BACKSubroutine F2D_NUMBERS V0.5 CLICK ON IMAGE PIXELClick on centre of region, for which intensity values are to be output. The intensity information of the 11 * 11 region centred on the clicked pixel will be output in the terminal window. When finished click in the text prompt box. . . . . . . . . . . . . .Subroutine F2D_PIXELXY V0.10CLICK ON IMAGE PIXELClick on coordinate to obtain information on position and intensity. If the experimental geometry has been defined, d-spacing information will also be output. Subroutine F2D_PROJECTION V0.7 CALCULATING PROJECTION (this may take a while)1-D Projection: PixelsNot definedINFO: The "Projection" is stored in the memorySubroutine F2D_SATURATED V0.3 Enter valid realTHRESHOLD VALUE (INCLUSIVE)Enter threshold value for counts pixelsSubroutine F2D_SLICE V0.7 ENTER ENDS OF SLICE (TWO COORDINATES)Click on 2 X/Y coordinates, to define slice1-D Slice: PixelsNot definedINFO: The "Slice" is stored in the memorySubroutine F2D_INPUTMODEL V0.6 Must be within specified boundsCLICK ON SYMMETRY CENTREPlace cursor on centre of polar symmetryCLICK ON PEAK CENTREPlace cursor on centre of peak to be definedCLICK ON FIRST (OR RADIAL) HALF HEIGHT COORDINATEPlace cursor on first half height positionCLICK ON SECOND (OR ANGULAR) HALF HEIGHT COORDINATEPlace cursor on second half height positionCLICK ON TWIN PEAK CENTREPlace cursor on centre of twin peakENTER PEAK TYPEEXIT ? 2-D POLYNOMIAL The 2-D polynomial is already defined2-D POLYNOMIAL X ORDEROrder of polynomial function in X-directionPOLYNOMIAL Y ORDEROrder of polynomial function in Y-directionINITIALISATION POLYNOMIAL X ORDEROrder of initialisation polynomial function in X-directionINITIALISATION POLYNOMIAL Y ORDEROrder of initialisation polynomial function in Y-directionFailed to fit polynomial coefficientsMASK ROW-LINE A "row-line" is already defined (1 maximum)GAUSSIAN POLAR GAUSSIAN TWIN POLAR GAUSSIAN REMOVE LAST PEAK Subroutine F2D_CAL_PROJECTION V0.1 Subroutine F2D_FUNTYPE V0.1 Subroutine F2D_PGAUINT V0.1 Subroutine F2D_1DMASK V0.1 FIT: MASK MENU null CLEAR MASK EXIT ? HELP UN-ZOOM MASK REGION UN-MASK REGION ZOOM IN CONTROL RETURNED TO TERMINAL WINDOW Subroutine F2D_MASKARC V0.3 In order to define an arc, three coordinates must be input in the following order: starting point, a point on the arc, and the end point. Note that (This option can be used to define a straight line !) ENTER ARC THREE COORDINATES (START, MIDDLE, END)WARNING: Arc centre cannot be calculatedEnter integer within given rangeWIDTH OF ARC (PIXELS)Enter number of pixels for width of masking arcSubroutine F2D_MASKPEAKS V0.6 Click on coordinates to define centre of circular regions to mask-out. Click in prompt test region to end defining coordinates. CLICK ON PEAKS TO REMOVESubroutine F2D_MASKPOLYGON V0.9 Click on coordinates to define vertices of polygon region. (Clicking just outside the image region is equivalent to clicking on the edge.) Click in the prompt text box to finish entering vertices. ENTER COORDINATES OF MASKED REGIONPLEASE WAIT: CALCULATING POLYGON MASKSubroutine F2D_COLOURS V0.13FIT2D: IMAGE: COLOURS MENUEXIT ? HELP COLOUR_TABLESubroutine F2D_GUI_GRID V0.6 NO HORIZONTAL COARSENO HORIZONTAL COARSE: Remove horizontal coarse grid lines NO VERTICAL COARSE NO VERTICAL COARSE: Remove vertical coarse grid lines NO HORIZONTAL FINE NO HORIZONTAL FINE: Remove horizontal fine grid lines NO VERTICAL FINE NO VERTICAL FINE: Remove vertical fine grid lines FIT2D: IMAGE: OPTIONS: GRIDnull EXIT ? HELP The grid option allows the addition or removal of grid lines overlaid on the graphics. The "coarse" grid lines will appear where large ticks appear on the axes, and the "fine" grid lines will appear where the small tick marks appear on the axes. The style (colour, width, line type) of each of the grid line categories may be changed using the main keyboard menu "SET GRID STYLE" command. HORIZONTAL COARSE NO HORIZONTAL COARSE HORIZONTAL COARSE HORIZONTAL COARSE: Add horizontal coarse grid lines VERTICAL COARSE NO VERTICAL COARSE VERTICAL COARSE VERTICAL COARSE: Add vertical coarse grid lines HORIZONTAL FINE NO HORIZONTAL FINE HORIZONTAL FINE HORIZONTAL FINE: Add horizontal fine grid lines VERTICAL FINE NO VERTICAL FINE VERTICAL FINE VERTICAL FINE: Add vertical fine grid lines UPDATE Subroutine F2D_POSITION V0.3 CLICK ON A CORNER OF REQUIRED DISPLAY REGIONCLICK ON A CORNER OF DISPLAY REGIONCLICK ON OPPOSITE CORNER OF REQUIRED DISPLAY REGIONCLICK ON OPPOSITE CORNER OF DISPLAY REGIONSubroutine F2D_DEF_FS V0.3 Enter an integer numberSELECT FIRST FILE IN SERIES (click on "HELP" for list of formats) FILE O.K.Enter "YES" if the file is O.K.Select LAST Input file in series (click on "INFO" for details of file types) Select the last file in the series to be input. The file selection tool will help you to search directories and find the required file. COULD NOT DEDUCE REQUIRED FILE SEQUENCEThe "FILE INCREMENT" is the numerical step between input files. This allows, for example, every alternative file to be input by entering 2, or to define a series where the file number changes, 10, 20, 30, etc. by entering 10. Normally, to input every file, 1 should be entered. Enter integer in rangeFILE INCREMENTSubroutine F2D_GUI_ROI V0.1 imageFIT2D: REGION OF INTEREST MENUnull EXIT ? HELP UN-ZOOM FULL ZOOM IN Subroutine F2D_CAL2_CAKE V0.13INFO: Starting to transform active data region (this may take some time) INFO: (The reciprocal value is applied to the data.)Subroutine F2D_INP_CORRECTION V0.1 CONTROL OF DETECTOR DISTORTION CORRECTION FLAT-FIELD FF FILE FF SCALE FF MULTIPLIER SPATIAL DIS. SD FILE APPLY FLAT FIELD CORRECTION NAME OF FLAT-FIELD FILE APPLY SCALING AFTER FLAT FIELD CORRECTION FLAT FIELD MULTIPLIER TO APPLY APPLY SPATIAL DISTORTION CORRECTION NAME OF SPATIAL DISTORTION FILE Enter "YES" to input a flat fieldimage and apply a correction Select file containing the flat-fieldimage for correction Enter "YES" to multiply correctedimage by the user controlled scale faScale factor to multiple imageafter flat-field correction Enter "YES" to input a spatial distortion defining function and apply Select file containing the spatialdistortion defining function Control flat-field and spatial distortion correction Subroutine F2D_INQ_INTEGRATE V0.6 PANIC: The type of Lorentz/geometrical correction is unknownCONTROL OF RADIAL, 2-THETA, OR Q SCAN RE-BINNING PARAMETERS SCAN TYPE CONSERVE INT. POLARISATION FACTOR GEOMETRY COR. MAX. ANGLE SCAN BINS MAX. D-SPACING SCAN TYPE (D, RADIAL, 2-THETA, Q-SPACE) INTENSITY CONSERVATION APPLY POLARISATION CORRECTION POLARISATION FACTOR GEOMETRICAL CORRECTION TO INTENSITIES MAXIMUM 2-THETA ANGLE OF SCAN (DEGREES) NUMBER OF BINS IN OUTPUT SCAN MAXIMUM FOR D-SPACINGS SCANS (ANGSTROMS) Select type of output 1-D scan: "RADIAL", "2-THETA", or "Q-SPACE" Enter "YES" to conserve total intensity, "NO" for "2-theta scans"(inteEnter "YES" to apply polarisation correction Enter ratio of horizontal to vertical polarisation Enter "YES" if scan intensities are corrected for geometry Enter maximum 2-theta angle of scan (degrees) Enter number of 2-theta or radial bins in output scan Enter maximum of range for calculation of D-spacing scans (Angstroms) SCAN_TYPESubroutine F2D_TRANSFORM V0.4 ROTATION PARAMETER CONTROL FORM X-PIXEL SIZE Y-PIXEL SIZE X-CENTRE Y-CENTRE ANGLE X-TRANSLATION Y-TRANSLATION X-START OUT Y-START OUT X-END OUT Y-END OUT SIZE OF HORIZONTAL PIXELS (MICRONS) SIZE OF VERTICAL PIXELS (MICRONS) X-CENTRE OF ROTATION (PIXELS) Y-CENTRE OF ROTATION (PIXELS) ROTATION ANGLE (DEGREES) X-COMPONENT OF TRANSLATION VECTOR Y-COMPONENT OF TRANSLATION VECTOR STARTING PIXEL OF OUTPUT REGION (X) STARTING PIXEL OF OUTPUT REGION (Y) END PIXEL OF OUTPUT REGION (X) END PIXEL OF OUTPUT REGION (Y) Enter dimension of pixels horizontally, as displayed (micronEnter dimension of pixels vertically, as displayed (microns)X-coordinate of centre of rotation (pixels) Y-coordinate of centre of rotation (pixels) Angle of rotation anticlockwise (degrees) Number of pixels to translate horizontally Number of pixels to translate vertically Minimum pixel of output region (horizontally) Minimum pixel of output region (vertically) Maximum pixel of output region (horizontally) Maximum pixel of output region (vertically) Enter rotation centre, angle of rotation, and output region limits TRANSFORMING: Please waitSubroutine F2D_GUI_SCALEDSUB V0.3 MATHS_SUB_SCALE_FACTORFailed to allocate temporary memoryEnter the scale factor to be applied to the data in the memory prior to the result being subtracted from the data in the current (displayed) image Enter value within given rangeSCALE FACTOR APPLIED TO MEMORY PRIOR TO SUBTRACTIONnull O.K. ? HELP CANCEL FACTOR INCREASE 1% INCREASE 10% INCREASE 50% DECREASE 1% DECREASE 9% DECREASE 33% Z-SCALING Subroutine F2D_1DFEATURE V0.3 Subroutine F2D_LSQMFIT V0.15WARNING: Problem fitting the model to the dataoptimiseSubroutine F2D_BEAMGAUSSIAN V0.7 ERROR: Problem with finding initial parameters for the Gaussian fitSubroutine F2D_LSQCIRCLE V0.4 WARNING: Problem fitting the circleSubroutine F2D_LSQELLIPSE V0.4 WARNING: Problem fitting the ellipseSubroutine F2D_PROJECTFIT V0.2 CALCULATING PROJECTION (this may take a while)ProjectionPixelsMASK OUT POINTS TO IGNOREOPTIMISING SYMMETRY POINTCLICK TO CONTINUESubroutine F2D_CAL_CAKE V0.13SCAN_TYPEMAXIMUM_DPANIC: The type of Lorentz/geometrical correction is unknownTYPE OF AZIMUTH/RADIAL OR 2-THETA TRANSFORMATION This form allows you to control various options in the re-binning from the 2-D detector data to an azimuthal versus 2-theta or radial distance coordinate system. Further help will be added when this option is completed. START AZIMUTH END AZIMUTH INNER RADIUS OUTER RADIUS SCAN TYPE AZIMUTH BINS RADIAL BINS CONSERVE INT. POLARISATION FACTOR MAX. D-SPACING GEOMETRY COR. STARTING AZIMUTH ANGLE (DEGREES) END AZIMUTH ANGLE (DEGREES) INNER RADIAL LIMIT (PIXELS) OUTER RADIAL LIMIT (PIXELS) SCAN TYPE (RADIAL, 2-THETA, Q-SPACE) NUMBER OF AZIMUTHAL BINS NUMBER OF RADIAL/2-THETA BINS INTENSITY CONSERVATION APPLY POLARISATION CORRECTION POLARISATION FACTOR MAXIMUM FOR D-SPACINGS SCANS (ANGSTROMS) GEOMETRICAL CORRECTION TO INTENSITIES Enter azimuth angle for start of region to be integrated (degrees) Enter azimuth angle for end of region to be integrated (degrees) Enter radius for inner radial limit of region to be integrated (pixelsEnter radius for outer radial limit of region to be integrated (pixelsSelect type of output 1-D scan: "RADIAL", "2-THETA", or "Q-SPACE" Number of bins azimuthally Number of bins in the 2-theta/radial direction Enter "YES" to conserve total intensity, "NO" for "2-theta scans"(inteEnter "YES" to apply polarisation correction Enter ratio of horizontal to vertical polarisation Enter maximum value of range for calculation of D-spacing scans (AngstEnter "YES" if scan intensities are corrected for geometry ! OUTER LIMIT MUST BE GREATER THAN INNER LIMIT !WORKING: CALCULATING TRANSFORM NOTE: ORIGINAL DATA STORED IN THE MEMORY : Azimuth/Radial DistanceRadial Distance (mm): Azimuth/2-theta2-Theta Angle (Degrees): Q-Space ScanQ (Inverse Nanometres): D-Spacings ScanD-spacing (Angstroms)Azimuth (Degrees)Subroutine F2D_DRAW_CAKE V0.3 Subroutine F2D_INP_CAKE V0.6 Click on a coordinate to define the starting azimuth of the region to be transformed to 2-theta or other scans. If you click in the message box (yellow, therefore active), then the X-axis (azimuth 0.0) will be used as the start of the region. STARTING AZIMUTH (CLICK HERE FOR 0.0)Click on a coordinate to define the end the complete 360.0 of data will be used. END AZIMUTH (CLICK HERE FOR START + 360.0)INNER LIMIT (CLICK HERE FOR BEAM CENTRE)CLICK TO DEFINE OUTER LIMITClick on a coordinate to define the inner radius of the "CAKE" region to be transformed. By clicking in the prompt box (yellow therefore active) the beam centre will be used and the output scans will be defined starting from 0.0 angle or radius in the 2-theta / radial direction. Click on coordinate to define outer limit of "cake" region to be transformed. WARNING: Outer radial limit is less than inner limitSubroutine F2D_CALIBRANT_USER V0.2 CALIBRANT_USER_FILESelect file containing list of D-spacings (In Angstroms, and in decreasing order) Select ASCII file with D-spacings to be used for calibration. One value per line, in units of Angstroms. e.g. The first 6 D-spacings for Silicon would be defined: 3.1355 1.9201 1.6375 1.3577 1.2459 1.1086 Subroutine F2D_ELLIPSE V0.4 Subroutine F2D_FINDRINGS V0.5 INFO: Calculating integrated intensities on 1 powder ringINFO: Calculating centre of gravity coordinates on 1 powder ringINFO: Calculating integrated intensities on powder ringsINFO: Calculating centre of gravity coordinates on powder ringsSubroutine F2D_FITCALIBRANT V0.5 ERROR: There are no coordinates to fit !Subroutine F2D_LSQPOLARISATION V0.1 WARNING: Problem fitting the polarisation factorSubroutine F2D_TILTDISPLAY V0.3 Subroutine F2D_FITPOWDER V0.4 Subroutine F2D_INP_ELLIPSE V0.13Click on initial powder ring to be used for determining the tilt/ beam centre. CLICK ON POWDER RING TO FITClick on a coordinate to define one side of theprofile search limit. The search limit will be symmetric either side of ring positions. Ideally the whole of the choosen powder rings should lie within the search annuli. Similarly other rings should not enter the search region. However a double ring which lies completely within the search region may be fitted successfully provided that the intensities of the two components are constant around the azimuth or vary together. CLICK ON RING PROFILE SEARCH LIMIT Subroutine F2D_INPRADIA V0.7 Click on any other rings to be used in fitting the tilt / beam centre. It is possible to continue without further rings, but generally it is better to use several rings. CLICK ON OTHER RINGS TO USE IN FITTING TILT Subroutine F2D_CAL_GISAXS V0.6 Subroutine F2D_INP_PROJECTION V0.4 ENTER END OF PROJECTION LINE (ONE COORDINATE)ENTER ENDS OF PROJECTION LINE (TWO COORDINATES)ENTER LIMITS OF PROJECTION REGIONEnter "YES" or "NO" onlyClick on a coordinates to define the end of the projection line of the 1-D scan. Click on two coordinates to define the projection line i.e. the line to form the X-axis of the 1-D output. Click on two coordinates to define the extent of the region to be projected onto the line. These two coordinates should normally define a line roughly perpendicular to the projection line. A rectangle has been drawn around the projection region. Press the "YES" button to proceed, or the "NO" button to re-define the region IS THE DEFINED PROJECTION REGION O.K.Subroutine F2D_EDITPEAKS V0.3 CLICK ON PEAK CENTRES TO ADDCLICK ON PEAK CENTRES TO REMOVEEDIT PEAK LISTnull EXIT ? HELP ADD PEAKS Click on coordinates for new peaks PEAK LIST FULL: NO MORE PEAKS CAN BE STOREDREMOVE PEAKS Click on peaks to remove from list FULL UN-ZOOM UN-ZOOM Z-SCALING ZOOM IN Subroutine F2D_PEAKSEARCH V0.9 INFO: Data smoothed or copiedSubroutine F2D_CAL2_DISTORTION V0.5 Subroutine F2D_CALTEMPLATE V0.1 Subroutine F2D_FIND2DGRID V0.2 INFO: Central cross peaks foundERROR: Peak position arrays are too smallERROR: Peaks are missing from central crossSubroutine F2D_FINDCENTRE V0.1 Subroutine F2D_FINDROTATE V0.2 Subroutine EXPG_F2D_FINDLINE V0.2 Subroutine F2D_INITGRIDSEARCH V0.11Click on peak to define starting point for the peak search. It is best to choose a reasonably central peak, by it must be positioned such that the row and column do not contain any missing peaks, and neither does the row above, nor the column to the left. Click on centre of starting peakClick on next peak to the right of the starting peak. This defines a horizontal search vector. Click on centre of next peak right horizontallyClick on next peak above the starting peak. This defines a vertical search vector. Click on next peak vertically upwards (left most)CONTROL RETURNED TO TERMINAL WINDOWSubroutine F2D_VIGNETTING V0.4 Enter the thickness of the grid mask in microns, which causes off-axis shadowing. If the grid mask has been manufacturered with counter-sunk holes, e.g. the brass masks for the X-ray Image Intensifiers at the Photon Factory, this will probably be the thickness of the final small hole. (This of course assumes that the largest off-axis angle is small enough that it is only the final part which shadows the hole.) At the ESRF the thin copper plated masks used for the Beryllium XRII have been measured to be 255 microns thick, and the solid copper mask used for the larger alumimium XRII should be 500 microns. Value must be within given rangeMASK THICKNESS (microns)INFO: The beam centre does not need to be specified accurately. An approximate centre is appropriate.Subroutine F2D_POLYNOMIAL V0.7 Value must be within given rangeORDER OF POLYNOMIALEnter order of polynomial for fitting scanSubroutine F2D_CORR5_SPATIAL V0.3 Subroutine F2D_CORR5_SPATIAL V0.3 INFO: Starting to correct data for spatial distortion re-binning into more than four output pixels (X-direction). re-binning into more than four output pixels (Y-direction).Subroutine F2D_CORR6_SPATIAL V0.6 Subroutine F2D_CORR6_SPATIAL V0.6 INFO: Starting to correct data for spatial distortion re-binning into more than three output pixels (X-direction). re-binning into more than three output pixels (Y-direction).Subroutine F2D_FIT2DTEST V0.4 INFO: Worst case fit discrepancies in pixels (spline value - measured)Subroutine F2D_CALFLATFIELD V0.1 Subroutine F2D_CALPROFILE V0.6 Subroutine F2D_IN2DCLUT V0.2 Subroutine F2D_IN2DCLUT V0.2 READWARNING: Error in opening file: ERROR: Problem in inputting header; wrong format ?DISTORTION CORRECTION LOOK-UP TABLE V02.00ERROR: This file is not a valid distortion correction LUT fileX_PIXEL_SIZE =ERROR: "X_PIXEL_SIZE" Corrupted fileY_PIXEL_SIZE =ERROR: "Y_PIXEL_SIZE" Corrupted fileX_NUMBER =ERROR: "X_NUMBER" Corrupted fileY_NUMBER =ERROR: "Y_NUMBER" Corrupted fileBYTES_PER_PIXEL_LUT =ERROR: "BYTES_PER_PIXEL_LUT =" Corrupted fileWARNING: Only 1 byte per pixel LUT is availableFLAT_FIELD_STORED =ERROR: "FLAT_FIELD_STORED" Corrupted fileFF_OFFSET =ERROR: "FF_OFFSET" Corrupted fileFF_SCALING =ERROR: "FF_SCALING" Corrupted file!!! END OF HEADER SECTION !!!ERROR: Header terminator corrupted ERROR: The look-up table is too big for the internal arraysSubroutine F2D_CALABSORPTION V0.3 ERROR: The source/detector geometry is impossible, the source cannot be on the surface of the detection sphereERROR: The detector cannot be hit by the X-ray !Subroutine F2D_PEAKXY V0.4 Subroutine F2D_FITCHEBYSHEV V0.2 Subroutine F2D_ROWLINE V0.4 Subroutine F2D_ROWLINE V0.4 : Experimental geometry not definedOLDDIRECTUNFORMATTEDSubroutine F2D_INP_PARAMETERS V0.7 fit2d.par PARAMETER FILE NAMEName of input file containing fit parametersUnacceptable inputWARNING: Error in opening file$FFF_STARTWARNING: This is not a Flexible File Format (FFF) file and cannot be read$BIG_ENDIANTRUE data_maskWARNING: Data mask not found setting mask to zero (no mask)WARNING: Not all of the mask data could be input (too big)total_paramsnumber_featuresnumber_resultsx_ordery_orderx_min_poly ERROR: Old parameter file: not compatible with new polynomial fittingy_min_polyx_max_polyy_max_polyapply_weightsaccuracyiters_per_parammodel_evolvedisplay_frequencyfast_displayhalt_criterionhalt_valueparameter_valuesparameter_descriptionsparameter_scalesparameter_namesresult_namesSubroutine F2D_INP_POLARISATION V0.3 Enter "YES" if you want to correct for the effects of beam polarisation. FIT2D will take into account the 2-D effects as function of both 2-theta angle and azimuth angle. However, if you correct for the effects of polarisation here it will be important to make sure that they are not corrected a second time by subsequent processing software ! Enter "YES" or "NO"CORRECT FOR X-RAY BEAM POLARISATIONEnter the "polarisation" of the main beam on the sample. This is defined as (I_h - I_v) / (I_h + I_v), where I_h is the horizontal component of the intensity and I_v is the vertical. (The horizontal should correspond with the X-direction on an image. Normally for a synchrotron the polarisation is positive and approaches 1.0. e.g. Station 9.6 at the SRS Daresbury has been measured to have a polarisation of 0.86. This is a value which is dependent on the X-ray source, beam-line mirrors, and on the monochromator. The beam-line scientist should be able to give a good estimate of this number. Must be valid real number within given rangeBEAM POLARISATION (AT SAMPLE)Enter the type of "Lorentz" correction which you want to apply to the output intensities. At present the following choices are available: NONE: No correction factors applied PARTIAL POWDER (2-THETA SCAN): Correct intensities to be equivalent to a 2-theta scan with a single counter. This allows standard powder diffraction software to apply their own Lorentz corrections. TYPE OF LORENTZIAN CORRECTION TO APPLYENTER ONE OF AVAILABLE CHOICESnull NONE PARTIAL POWDER (2-THETA SCAN) ERROR: Unknown user choiceSubroutine F2D_LORENTZ V0.2 Subroutine F2D_SRADIAL V0.7 WARNING: Active Data Region (ADR) extends outside valid region ofspline. Pixels outside the valid region will be ignored.INFO: The valid region of the spline correction function is:In order to avoid over-loaded pixels being re-binned and their intensity spread out to an undetermined value, you can enter a "over-loaded" pixel value. All input pixels which have this value or more, will cause one or more output pixels to be incremented by the value regardless of the normal proportional are re-binning algorithm. Thus over-loaded pixels in the output image can be easily identified and ignored. (This can be turned-off by entering a very large value.) Enter a real value within given rangeOVER-LOADED PIXEL VALUEFor efficiencies sake many rows of the distortion functions can be calculated in one call to the NAG subroutine which performs the task. However, to store the results extra memory is required. (The memory is allocated automatically from the machines virtual memory and is de-allocated after the spatial distortion correction is finished and the storage is no longer necessary.) Thus, the value entered here choses a compromise between using more memory and taking longer to calculate all the necessary distortion values. If the machine has plenty of available memory (virtual) a larger number such as 100 may be more efficient. However, if the machine is short of virtual memory e.g. you have already received an error message that memory allocated has failed, then a smaler value will be appropriate. NOTE: Too big a number may be counter-productive as it may cause excessive page faulting. Enter an integer within given rangeNUMBER OF ROWS OF DISTORTION FUNCTIONS TO CALCULATED IN A BLOCKSubroutine F2D_TILTRADIAL V0.10INFO: Starting to re-bin 2-D data to a 1-D profile, this can take some time for large arrays. INFO: (The reciprocal value is applied to the data.)Subroutine F2D_RTHETA2 V0.10INFO: Starting to transform active data region (this may take some time) INFO: (The reciprocal value is applied to the data.)Subroutine F2D_INPUTROWLINE V0.7 DataRowsColumnsIntensityMust be within set limit, which are program definedLOWEST ORDERLowest order to be simulatedHIGHEST ORDERHighest order to be simulatedEnter valid real valueROW-LINE CENTRE X-COORDINATEX-coordinate of centre of lower (or right) row-lineROW-LINE CENTRE Y-COORDINATEY-coordinate of centre of lower (or right) row-lineRotation angle of the row line from row-line "equator" The angle is to be defined in degrees (positive means anticlockwise) Must be within set limitsROW LINE ROTATIONPEAK TO PEAK DISTANCESpacing between Bragg peaksZERO ORDER PEAK DISTANCEDistance from row line centre to zero order peak centreRatio of reflected row-line peak intensities to those of the primary row-line peaks LEFT RIGHT INTENSITY RATIORADIAL STANDARD DEVIATIONStandard deviation of peaks in the radial directionStandard deviation of peaks in the angular direction (in degrees) ANGULAR STANDARD DEVIATION('Centre of Peak order ', i3,' is outside data region') please input intensity Subroutine F2D_1DMASKREGION V0.1 CLICK ON OPPOSITE CORNERS OF THE RECTANGLEClick on 2 X/Y coordinates, to define rectangleSubroutine F2D_LSQGAUSSIAN V0.6 WARNING: Problem fitting the GaussianSubroutine F2D_LSQ1DSYMMETRY V0.1 WARNING: Problem fitting the symmetry centreSubroutine F2D_RINGCOORDS V0.8 ERROR: There are no coordinates to fit !Subroutine F2D_LSQCALIBRANT V0.6 WARNING: Problem fitting the powder patternSubroutine F2D_RINGOUTLIERS V0.1 ERROR: There are no coordinates to fit !Subroutine F2D_LSQPOWDER V0.8 WARNING: Problem fitting the powder patternSubroutine F2D_PEAKSTRIP V0.10Subroutine F2D_FINDLINE V0.2 Subroutine F2D_FINDLLQUAD V0.5 WARNING: Peak search problem, starting cross contains missing peakSubroutine F2D_FINDLRQUAD V0.5 WARNING: Peak search problem, starting cross contains missing peakSubroutine F2D_FINDULQUAD V0.5 WARNING: Peak search problem, starting cross contains missing peakSubroutine F2D_FINDURQUAD V0.5 WARNING: Peak search problem, starting cross contains missing peakSubroutine F2D_GRIDBEAMCENTRE V0.1 Subroutine F2D_POLYFIT V0.7 X-axisFitted ValuesAnswer "YES", or "NO"Value must be within given rangePolynomial Fit to DataACCEPT FIT ("NO" TO TRY ANOTHER ORDER)Enter "YES" to accept this fit, "NO" to try another order of fitORDER OF POLYNOMIALEnter order of polynomial for fitting scanSubroutine F2D_PEAKRZ V0.1 Subroutine F2D_CORR2_RADIAL V0.8 INFO: Starting to re-bin 2-D data to a 1-D profile, with correction for spatial distortion, this can take some time for large arrays. Subroutine F2D_PEAKINTEGRATE V0.3 Subroutine FIO_INPUT V0.54GAS 2-D DETECTOR (ESRF) PHOTOMETRICS CCD FORMAT PRINCETON CCD FORMAT NEW MAR CODE FUJI BAS-2000 IMAGEQUANT RIGAKU R-AXIS 1-D ASCII FREE FORMAT FIT2D STANDARD FORMAT FILE FORMATEnter one of available choices? Enter name of file containing 1-D dataX-axis Intensity2-D ASCII FREE FORMAT ADSC DETECTOR FORMAT BINARY (UNFORMATTED) BRUKER FORMAT BSL FORMAT CHIPLOT FORMAT COMPRESSED DIFFRACTION DATA DIP-2000 (MAC SCIENCE) KLORA ESRF DATA FORMAT INFO: Problems caused by the "ESRF data format" are unfortunately far too common. The orginal software available from the ESRF is far too bugged to be usable. It is not available for many of the operating systems on which FIT2D is required to run, and users use. Therefore I (and others) have written their own input routines. However, this is only a partial solution. This is because the "format" is totally inadequately defined, and even where defined there are huge differences between the specification and the files actually produced. It is also an unnecessarily complicated format with certain data compression schemes almost totally undefined. Therefore this code has only been written to input a small subset of the possible file formats which could be produced. In particular all header information must be found before the image data, and data compression is not supported.INFO: imgCIF/CBF is a format developed with support of the IUCr, to try to end this sort of problem.HAMAMATSU PHOTONICS HELP HUFFMAN MAR RESEARCH FORMAT NOTE: USING NEW INPUT CODEMAR-PCK FORMAT PDS FORMAT PMC FORMAT WARNING: Format support removedTIFF UNKNOWN USER INTENSITIES WESS FORMAT #OVERLOAD_VALUE#INPUT_FORMATX_PIXEL_SIZEY_PIXEL_SIZEWARNING---WARNING---WARNING---WARNING---WARNING---WARNING---WARNING--WARNINGWARNING: File input failed during a macro. Macro automatically terminated.WARNING: File input failed during a sequence. Sequence terminated.Subroutine FIO_OUTPUT V0.30FILE FORMATEnter one of available choices3CAM 4-BYTE INTEGERS BINARY (UNFORMATTED) DUMP BSL FORMAT CBF WARNING: NOT PRESENTLY AVAILABLECHIPLOT DENZO MAR FORMAT COMPRESSED DIFFRACTION DATA FIT2D STANDARD FORMAT GSAS HEADER FILES MCA FORMAT HUFFMAN "KLORA" FORMAT klora.edfNO HEADER FILES PowderCIF SPREAD SHEET TIFF INTEGERS Subroutine FIO_GUI_INPUT V0.51Data for the program main data array is required, normally input a file stored on disk. The file selection tool will help you to search directories and find the required file. The following file formats are presently supported: . : (no extension) ESRF Gas detector format .bin: BINARY user specified format .bsl: BSL (Daresbury) / OTOKO (Hamburg) format .chi: CHIPLOT ASCII 1-D X/Y graph format .cor: BINARY user specified format .cor2: BINARY user specified format .corr: BINARY user specified format .edf: "KLORA" or BINARY format .f2d: FIT2D format .final: BINARY user specified format .gel: Molecular Dynamics IMAGEQUANT (tiff) format .inf: FUJI BAS-2000 (BAS-1500) format .info: BINARY user specified format .image: MarResearch IP scanner format .img: FUJI BAS-2000 (BAS-1500) format OR HAMAMATSU CCD format OR ADSC format .mar1200: MarResearch IP scanner format .mar1600: MarResearch IP scanner format .mar2000: MarResearch IP scanner format .mar2300: MarResearch IP scanner format .mar3450: MarResearch IP scanner format .mccd: TIFF format from MAR CCD camera .osc: Rigaku R-AXIS IV format .pck: Old compressed MarResearch format .pmi: PHOTOMETRICS CCD format .spe: PRINCETON INSTRUMENTS CCD format .tif: Adobe TIFF format .tiff: Adobe TIFF format Files with numerical extensions e.g. .001 will be tested to see if they appear to be Bruker area detector frame data file Files with unknown extensions will invoke a menu containing the available choices. hmGAS 2-D DETECTOR (ESRF) _dk _ff BRUKER gel IMAGEQUANT bin cor cor2 corr final bsl BSL/OTOKO chi CHIPLOT edf KLORA BINARY image inf FUJI BAS-2000 info img infINFADSC HAMAMATSU PHOTONICS f2d FIT2D STANDARD FORMAT mar1200 mar1600 mar1800 mar2000 mar2300 mar3450 MAR FORMAT osc RIGAKU R-AXIS pck MAR-PCK pmi PHOTOMETRICS CCD FORMAT spe PRINCETON CCD FORMAT tif tiff mccd TIFF UNKNOWN EXTENSION: SELECT FILE FORMAT:CANCEL ? HELP The file format of the file that you have specified is not known from it's file extension type. You can choose one of the available input formats. If the format you need is not available press the "CANCEL" button. (In the "INPUT" command of the "KEYBOARD" interface there may be more input file formats available.) ADSC BINARY BRUKER BSL/OTOKO CHIPLOT FIT2D FUJI (BAS) HAMAMATSU IMAGEQUANT KLORA MAR MAR-PCK PHOTOMETRICS PRINCETON RIGAKU R-AXIS TIFF FAILED TO FIND NEW "SEQUENCE" FILE: CAN'T INPUT ANOTHER FILE IN AN UNDEFINED SEQUENCEINPUTTING DATA FROM FILE WARNING: Unknown file formatWARNING: PROBLEM INPUTTING DATA FROM FILE: #OVERLOAD_VALUE#INPUT_FORMATX_PIXEL_SIZEY_PIXEL_SIZEWARNING: DATA NOT DEFINED CORRECTLY Subroutine FIO_GUI_OUTPUT V0.10WAVELENGTHSAMPLE_DISTANCESubroutine FIO_GUI_OUT V0.6 BINARYBSL/OTOKOCBFCHIPLOTDENZO MARFIT2D FORMATGSASPowderCIFSPREAD SHEETTIFF 8 BITTIFF 16 BITOUTPUT FILE COULD NOT BE OPENEDERROR OCCURRED DURING FILE OUTPUTSubroutine FIO_INP_OUTPUT V0.3 CHOOSE OUTPUT FILE FORMATnull ? HELP CANCEL Subroutine FIO_IN_FREEFORMAT V0.3 READWARNING: File could not be opened successfullySample of start of the input file:VERTICAL COLUMNS Enter general type of data format or file layout from one of the following catergories: (more choices will be added) VERTICAL COLUMNS : file with one or more data-sets on each line TYPE OF DATA FORMATEnter one of the given choicesEnter integer in given rangeNUMBER OF LINES TO IGNORENumber of lines at the start of the file to ignoreNUMBER OF CHARACTERS TO IGNORENumber of characters/spaces to ignore at the start of each lineNumber of coordinates read from the file for the data-set. Enter 0 or a number larger than the number of values in the file to read until the end of the file. NUMBER OF COORDINATESCOLUMN NUMBER FOR X-COORDINATESEnter number of column of numbers containing X-values or 0 for no X-coordinatesCOLUMN NUMBER FOR Y-COORDINATESEnter number of column of numbers containing Y-values Token =Subroutine FIO_OPENFILE V0.3 FILE NAMEEnter Name of fileUnacceptable inputError in opening file, Please retype nameSubroutine FIO_FILEOPEN V0.3 READWRITEREAD_ASCIIWRITE_ASCIISubroutine FIO_OUT_PDS V0.3 Enter name of output file WRITESubroutine FIO_IN_1DASCII V0.1 READ_ASCIIWARNING: Problem opening input file WARNING: Problem inputting data value:WARNING: Data items missing from fileSubroutine FIO_FREAD_CARRAY V0.3 Subroutine FIO_FREAD_IARRAY V0.4 Subroutine FIO_FREAD_INTEGER V0.2 Subroutine FIO_FREAD_L1ARRAY V0.3 Subroutine FIO_FREAD_RARRAY V0.4 Subroutine FIO_FREAD_REAL V0.2 Subroutine FIO_FREAD_STRING V0.4 Subroutine FIO_IN_2DASCII V0.3 READWARNING: File could not be opened successfullyEnter integer in rangeX NUMBER PIXELSNumber of data elements horizontally in each line of dataY NUMBER PIXELSNumber of data elements vertically (number of lines)WARNING: Internal dimensions are too small to input all of the dataSample of start of the input file:Enter integer in given rangeNUMBER OF LINES TO IGNORENumber of lines at the start of the file to ignoreWARNING: Failed to convert: ColumnsRowsIntensitySubroutine FIO_IN_ADSC V0.1 ADSC DETECTOR DATA FILE NAMEName of file containing ADSC detector format dataUnacceptable inputREADError in opening file, Please retype name BYTE_ORDER big_endian little_endian TYPE unsigned_short WARNING: The image data in this file has been written using an unsupported data type. It cannot be input.SIZE1 SIZE2 HEADER_BYTES DIM WARNING: Problem of converting key valueERROR: The size of header was not foundERROR: The size of the image was not foundWARNING: Error in reading start of header: image not inputWARNING: Error in reading keywordWARNING: Error in reading key valueERROR: Only 2-dimensional data supported at presentColumnsRowsIntensitySubroutine FIO_IN_BAS2000 V0.10READ_ASCIIDATA FILE NAME (.inf file)Name of file containing file headerUnacceptable inputWARNING: Error in opening header file, Please retype name WARNING: Problem reading from .inf file X PIXEL SIZE NOT PROPERLY DEFINEDWARNING: X pixel size not properly definedY PIXEL SIZE NOT PROPERLY DEFINEDWARNING: Y pixel size not properly definedNUMBER OF BITS IS NOT PROPERLY DEFINEDWARNING: Number of bits is not properly definedNUMBER OF PIXELS IN X-DIRECTION UNDEFINEDWARNING: Number of pixels in X-direction undefinedNUMBER OF PIXELS IN Y-DIRECTION UNDEFINEDWARNING: Number of pixels in Y-direction undefinedSENSITIVITY UNDEFINEDWARNING: Sensitivity undefinedLATITUDE UNDEFINEDWARNING: Latitude undefinedWARNING: The image is bigger than the presently defined program arrays only a part of the image will be input..imgIMGimgTHE MATCHING .IMG FILE HAS NOT BEEN FOUND PLEASE SELECT THE BINARY FILE BINARY DATA FILE NAME (.img file)Name of file containing the binary dataREADWARNING: Error in opening binary file Name of required binary file: INPUTTING DATA FROM FILEINFO: Inputting data from fileLINEARISING DATAINFO: Linearising dataColumnsRowsIntensitySubroutine FIO_IN_BINARY V0.10IN_BIN_SIGNEDIN_BIN_SWAPIN_BIN_STARTIN_BIN_DATA_TYPEINPUT FILE NAMEName of input file containing dataUnacceptable inputINTEGER (2-BYTE) 4-BYTE INTEGER Enter integer in rangeX NUMBER PIXELSNumber of data elements horizontally in each line of dataY NUMBER PIXELSNumber of data elements vertically (number of lines)WARNING: Internal dimensions are too small to input all of the dataDATA TYPEEnter type of data from available choicesEnter "YES" or "NO"PERFORM BYTE SWAPPING"YES" if the byte order needs to be changedSIGNED DATA"YES" if the data is signed, "NO" for unsigned dataINPUTTING DATA FROM FILEBYTE VALUES REAL (4-BYTE IEEE) WARNING: Unknown data typeREADWARNING: Error in opening fileColumnsRowsIntensitySubroutine FIO_IN_BRUKER V0.3 "BRUKER" AREA DETECTOR DATA FILE NAMEName of file containing "BRUKER" area detector format dataUnacceptable inputREADError in opening file, Please retype nameColumnsRowsIntensitySubroutine FIO_IN_BSL V0.14INPUT FILE NAMEName of input header fileUnacceptable inputREAD_ASCIIWARNING: The entered file could not be opened (probably it doesn't exist) (You can enter user escape (\\) to exit this command.)WARNING: Could not input header file information.Enter integer in rangeDATA-SET ("MEMORY") NUMBEREnter number of data-set ("memory") to input WARNING: Internal dimensions are too small to input all of the dataWARNING: File data type not presently supportedIMAGE NUMBEREnter number of image within the data-set ("memory") to inputREADWARNING: Error in opening binary image file:WARNING: Could not input number of X-pixelsWARNING: Could not input number of Y-pixelsWARNING: Could not input frame numberWARNING: Could not input file byte orderingWARNING: Could not input data type (Maybe wrong file type ?)ColumnsRowsIntensityOLDDIRECTUNFORMATTEDSubroutine FIO_IN_CDD V0.6 DATA FILE NAMEName of file containing compressed diffraction dataUnacceptable inputError in opening file, Please retype nameCDD VWARNING: The file is not a "Compressed Diffraction Data" fileX NUMBER =Y NUMBER =DATA (C1) =ERROR: NOT IMPLEMENTEDColumnsRowsIntensitySubroutine FIO_IN_CHIPLOT V0.8 READ_ASCIIWARNING: Problem opening input file WARNING: Problem reading from input fileWARNING: Error converting number of data points in fileError reading in the number of data pointsWARNING: Too many coordinates, the end ones will not be inputWARNING: Data items missing from fileWARNING: Problem inputting X-coordinate valueWARNING: Problem inputting Y-coordinate valueOLDDIRECTUNFORMATTEDSubroutine FIO_IN_DIP2000 V0.4 DATA FILE NAMEName of file containing data setUnacceptable inputError in opening file, Please retype nameEnter "YES" or "NO"PERFORM BYTE SWAPPING"YES" if the byte order needs to be changedColumnsRowsIntensityOLDDIRECTUNFORMATTEDSubroutine FIO_IN_FIT2D V0.8 INPUT FILE NAMEName of input file containing dataUnacceptable inputWARNING: Error in opening file$BIG_ENDIANTRUE titlex_axis_labely_axis_labelz_axis_labelx_pixel_sizey_pixel_sizeoverload_valuedata_arrayWARNING: Data array not foundWARNING: Not all of the data could be inputx_axisy_axisvariances_arrayOLDDIRECTUNFORMATTEDSubroutine FIO_IN_GAS2D V0.14Enter the name of input file containing image header data. (Normally this is the file without "hm" attached to the name.) INPUT HEADER FILE NAMEUnacceptable inputREADWARNING: The entered file could not be opened (probably it doesn't exist) (You can enter user escape (\\) to exit this command.)INFO: This format used to be defined with the binary "histogramming memory" file starting with a 512 byte "header". This header no longer seems to exist. You need to specify whether this header exists or not. If you have trouble inputting the data, try the opposite choice. (Unfortunately, the ASCII header is not always correct, which may be a further problem.)-1 3 WARNING: End of file found, before image header section. No data inputPROBLEM WITH HEADER FILE: EOF, NO IMAGE HEADER SECTION WARNING: Bad input, before image header section. No data inputBAD DATA BEFORE IMAGE HEADER SECTION WARNING: No image header section. No data inputIMAGE HEADER SECTION NOT FOUND WARNING: The program arrays are not big enough to input an image.IMAGE TOO BIG FOR PROGRAMS ARRAYShmThe binary file ("hm") which contains the image data may or may not a 512 byte header record at the start of the file (old files used to be defined this way, the new files no longer seem to have this record. Enter "YES" if your file has a header record, "NO" if it does not. If you don't know, just try both, or count the number of bytes in the file and compare to sensible image sizes. The default should now be correct. Enter "YES" or "NO"BINARY "HM" FILE HEADEREnter integer within given rangeIMAGE NUMBEREnter number of the required image to input from the image sequenceEnter "YES" to swap the byte order on input. Normally byte swapping should not be necessary for HP, Sun, and Silicon Graphics workstations. It will normally be necessary for VAX workstations. PERFORM BYTE SWAPPINGSIGNED DATA"YES" if the data is signed, "NO" for unsigned dataWARNING: Error in opening histogram memory filePROBLEM WITH HISTOGRAM MEMORY FILE: FILE NOT OPENED WARNING: Unknown number of bits per pixel (data length)UNKNOWN IMAGE HEADER FILE TYPE ColumnsRowsIntensitySubroutine FIO_IN_HAMAMATSU V0.10DATA FILE NAMEName of file containing data setUnacceptable inputREADWARNING: Error in opening file, Please retype nameWARNING: The image width has more pixels than the current program array X-dimension; only part of the image will be inputWARNING: The image height has more pixels than the current program array Y-dimension; only part of the image will be inputColumnsRowsIntensitySubroutine FIO_IN_HUFFMAN V0.5 DATA FILE NAMEName of file containing Huffman compressed dataUnacceptable inputREADError in opening file, Please retype nameColumnsRowsIntensitySubroutine FIO_IN_IQ V0.20DATA FILE NAMEName of tiff file containing imageUnacceptable inputREADError in opening file, Please retype nameIMAGE SIZE NOT RETURNED FROM FILEWARNING: Image size not returned from fileNumber of pixels must be postiveValue must be within given rangeINPUT REGION AND RE-BIN FACTOR FORM This form allows you to specify the size and position of the region of data to be input, and if required to re-bin the raw data on input. These options allow handling of very large images, by working on sub-regions, or by working at reduced resolution. By default the whole of the image will be input at full resolution (provided that the program arrays are large enough). Take care to define valid regions e.g. The end pixel must be greater of equal to the start pixel in each dimension. X-START Y-START X-END Y-END X RE-BIN Y RE-BIN LEFT-HAND PIXEL INPUT LIMIT LOWER PIXEL INPUT LIMIT RIGHT-HAND PIXEL INPUT LIMIT UPPER PIXEL INPUT LIMIT HORIZONTAL RE-BIN FACTOR VERTICAL RE-BIN FACTOR Enter number of horizontal pixel for left limit of input region Enter number of vertical pixel for lower limit of input region Enter number of horizontal pixel for right limit of input region Enter number of vertical pixel for upper limit of input region Enter number of horizontal raw data pixels to be re-binned into one piEnter number of vertical raw data pixels to be re-binned into one pixeINPUT REGION IMPOSSIBLY DEFINEDINPUT REGION TOO LARGE FOR ARRAYSX REBIN NUMBERNumber of pixels for rebinning in X-directionY REBIN NUMBERNumber of pixels for rebinning in Y-directionLEFT-HAND PIXEL OF IMAGE REGIONEnter number of pixel of region of image to inputLOWER PIXEL OF IMAGE REGIONRIGHT-HAND PIXEL OF IMAGE REGIONUPPER PIXEL OF IMAGE REGIONWARNING: Program arrays are not large enough to hold requested image.Redefine smaller region (or change array sizes).INPUTTING DATA FROM FILEWARNING: Image does not contain all of desired regionWARNING: Image not found WARNING: Cannot decode image WARNING: Bad tiff file WARNING: Image contains none of desired region ColumnsRowsIntensitySubroutine FIO_IN_KLORA V0.20"KLORA" (limited ESRF) DATA FILE NAMEName of file containing "KLORA" (ESRF sub-set) format dataUnacceptable inputREADError in opening file, Please retype nameEnter valid integer within given rangeIMAGE NUMBERIndex number of required image BYTEORDER HIGHBYTEFIRST LOWBYTEFIRST COMPRESSION NOSPECIFICVALUE NONE WARNING: The image data in this file has been written using a compression algorithm. It cannot be input.DATATYPE UNSIGNEDINTEGER UNSIGNEDLONG SIGNEDINTEGER UNSIGNEDSHORT SIGNEDSHORT FLOAT FLOATVALUE REAL WARNING: The image data in this file has been written using an unsupported data type. It cannot be input.DIM_1 DIM_2 HEADERID EH:IMAGE SIZE TITLE WARNING: Problem of converting key valueERROR: The required "Image" number has not been found and I think that there are no more "Image" sections, since the "Size" keyword has not been found either WARNING: Error in reading start of header: image not inputWARNING: Error in reading keywordWARNING: Error in reading key valueColumnsRowsIntensitySubroutine FIO_IN_MAR V0.7 DATA FILE NAMEName of file containing data setUnacceptable inputREADWARNING: Problem in opening file (data is not defined):WARNING: Problem reading in file headerWARNING: Problem in opening file (bad file directory path)ColumnsRowsIntensitySubroutine FIO_IN_PDS V0.2 READError with start angle Error with step angleError with end angle Error reading in the number of data pointsWARNING: Too many coordinates, the end ones will not be input2 Theta Angle (degrees)IntensitySubroutine FIO_IN_PHOTOMETRICS V0.11DATA FILE NAMEName of file containing data setUnacceptable inputREADError in opening file, Please retype nameWARNING: Problem reading in file headerWARNING: The image width has more pixels than the current program array X-dimension; only part of the image will be inputWARNING: The image height has more pixels than the current program array Y-dimension; only part of the image will be inputEnter integer within given rangeIMAGE NUMBEREnter number of the required image to input from the image sequenceColumnsRowsIntensitySubroutine FIO_IN_PRINCETON V0.9 DATA FILE NAMEName of file containing data setUnacceptable inputREADWARNING: Error in opening file, Please retype nameWARNING: Problem reading in file headerWARNING: The image width has more pixels than the current program array X-dimension; only part of the image will be inputWARNING: The image height has more pixels than the current program array Y-dimension; only part of the image will be inputEnter integer within given rangeIMAGE NUMBEREnter number of the required image to input from the image sequenceColumnsRowsIntensitySubroutine FIO_IN_RAXIS V0.1 RAXIS DETECTOR DATA FILE NAMEName of file containing RAXIS detector format dataUnacceptable inputREADError in opening file, Please retype nameColumnsRowsIntensityOLDDIRECTUNFORMATTEDSubroutine FIO_IN_UNKNOWN V0.6 Enter integer within given rangeDATA FILE NAMEName of file containing image dataUnacceptable inputWARNING: The specified file doesn't exist LOWER LIMIT, PIXELS PER ROWEnter lowest considered number of pixels per rowError in opening file, Please retype nameINFO: The data values may be 4-byte floating point or integer values Integer values will be ASSUMED (?)INFO: The data appears to be little endian (this assumes that any header is an even number of bytes in length)INFO: The data appears to be big endian (this assumes that any (This data type is not supported)WARNING: NOT IMPLEMENTED YET header bytesEnter "YES" or "NO"INPUT DATAEnter "YES" to input imageWARNING: The specified file exists, but is emptyWARNING: The specified file is too small to deduce its typeX-axisY-axisIntensitySubroutine FIO_IN_USER V0.4 INFO: Continue entering numbers as required, then use "USER ESCAPE"INFO: "USER ESCAPE" is double backslash: \\Enter valid real value, or "USER ESCAPE"ENTER DATA VALUEUser Entered DataArbitraryUndefinedIntensityEnter valid integer in given rangeEnter valid real valueDATA VALUE TO CHANGE (O = quit)Enter number of data point to changeENTER NEW DATA VALUEInput intensity value for data pointOLDDIRECTUNFORMATTEDSubroutine FIO_IN_WESS V0.5 Must be within defined limitsDATA FILE NAMEName of file containing data setUnacceptable inputINPUT DATA X-SIZENumber of pixels in the input data image in the X-dimensionINPUT DATA Y-SIZENumber of pixels in the input data image in the Y-dimensionError in opening file, Please retype nameNumber of pixels must be postiveX-START ELEMENTStart of input region in the X-dimensionY-START ELEMENTStart of input region in the Y-dimensionX-END ELEMENTEnd of input region in the X-dimensionY-END ELEMENTEnd of input region in the Y-dimensionX REBIN NUMBERNumber of pixels for rebinning in X-directionY REBIN NUMBERNumber of pixels for rebinning in Y-directionWARNING: Dynamic arrays not large enough to hold requested image.Redefine smaller region (or change array sizes).CollagenColumnsRowsIntensitySubroutine FIO_OUT_3CAM V0.2 Enter name of output file WRITEEnter "YES" or "NO"OUTPUT ROWS"YES" to output a row of data, "NO" for a columnEnter an integer within given rangeNUMBER OF ROW TO OUTPUTEnter number of row to be output to fileNUMBER OF COLUMN TO OUTPUTEnter number of column to be output to fileUNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_BINARY V0.10.binfit2d.binBINARY OUTPUT CONTROL VARIABLES FORM This form allows you to control a number of parameters affecting the layout of the binary data written to file. Often the default values will be suitable, but these parameters offer flexibility in the binary format to help input to other programs. The "FILE NAME" button allows the output file to be selected, and changed from the default suggestion. The "RECORD LEN." button allows the record length in bytes to be specified for the output file. The concept of record length does not really exist for Un*x systems, but this can nevertheless be useful in allowing blank "records" to be written at the start of the file, and for writing only partially filled "records". The "PAD" button, together with the "RECORD LEN." choice, allows partially filled records to be output when needed. (If you don't understand this, it almost certainly means that it is not necessary for your applicable and may be ignored.) If "PAD" is "NO" then the image data will be written contiguously into the output records. If "PAD" is "YES" and the record length is greater than that needed by a line of the image, then the remaining bytes in the record will be set to zero, and each line will be on a separate record. The "1ST RECORD" button allows the start of the output image data to be controlled. Some formats may use the first few records for header data, so this choice may help to simulate data for these formats. The "BIG ENDIAN" button allows the manner in which integer values are stored to be selected. This allows the output file to be suitable for input into different computer systems regardless of the type of system which is being used. "YES" corresponds to the integer type used on HP, SUN, Silicon Graphics, and most Un*x workstations. "NO" corresponds to the PC and DEC-VAX integer format. The internal array may contain data covering any scaling range, including very large numbers, or only very small numbers, and maybe negative numbers. The output integer format can only cover 65536 different values, so the internal data has to be scaled to this range. The "LOWER RANGE" and the "UPPER RANGE" button allow the user to select exactly the data value range to be scaled to the discrete integer output range. By default, provided the input range is small enough, and doesn't go negative, the scaling will correspond to rounding to the nearest integer. FILE NAME RECORD LEN. PAD 1ST RECORD BIG ENDIAN LOWER RANGE UPPER RANGE SELECT FILE TO CONTAIN DATA LENGTH OF OUTPUT RECORDS (BYTES) PAD RECORDS (IF NECESSARY) NUMBER OF FIRST RECORD FOR DATA OUTPUT "BIG ENDIAN DATA (HP/SGI/SUN) LOWER LIMIT OF SCALING RANGE UPPER LIMIT OF SCALING RANGE Enter name of file to contain data Enter number of bytes to output in a "record" Enter "YES" if under-filled records are to be padded Enter number of first record to the binary image data Enter "YES" for "BIG ENDIAN" (HP/SGI/SUN) integers, "NO" forEnter lower intensity limit ofrange to be output Enter upper intensity limit of range to be output THE SCALING RANGE IS INVALIDBINARY FILE NAMEName of file to contain dump of dataUnacceptable inputMust be within defined limitsRECORD LENGTH (BYTES)Length of fixed length records in file in bytesPAD RECORDSYES to pad records FIRST RECORD FOR OUTPUTNumber of first record to write data from arrayEnter YES or NOBIG ENDIAN FORMAT INTEGERSYES for big endian integer (Sun/HP/SG), NO for little endian (VAX, PC)PROBLEM WITH FILE DIRECTORY PATH (NO DIRECTORY ?)WARNING: Problem with file directory path (directory doesn't exist ?)ERROR IN OPENING FILEWARNING: Error in opening fileERROR IN WRITING OUTPUT FILEUNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_BSL V0.7 01000.bslG99000.bslNAME OF BSL/OTOKO OUTPUT FILEClick on, or enter name of output fileWRITENOTE: The header file name should be of the form Ann000.XXX, where A is any capital letter, nn is a number with two digits, and XXX is a three character file extension.WARNING: Error creating name of output "memory" file, the file name for header file is not valid. WARNING: Error in opening image fileUNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_CDD V0.4 OUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)WARNING: Error in opening fileERROR: This value is too large to be stored.chichiplot.chiWRITEEnter name of output file Enter "YES" or "NO"OUTPUT ROWS"YES" to output a row of data, "NO" for a columnEnter an integer within given rangeNUMBER OF ROW TO OUTPUTEnter number of row to be output to fileNUMBER OF COLUMN TO OUTPUTEnter number of column to be output to fileSubroutine FIO_OUT_CHIPLOT V0.10UNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_FIT2D V0.13.f2dfit2d.f2dUSE is the default file for output in FIT2D format. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR FIT2D STANDARD FORMAT Use the file selection tool to select a directory and an output file to contain the data, storage in FIT2D standard format. Normally such a file ends with the extension ".f2d". OUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)WARNING: Error in opening fileTRUE FALSE$FFF_STARTFIT2D Data File$BIG_ENDIANheaderFIT2D filetitlex_axis_labely_axis_labelz_axis_labelx_pixel_sizey_pixel_size#OVERLOAD_VALUE1.7e38 overload_valuedata_arrayx_axisy_axisvariances_array$FFF_ENDEnd of image dataUNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_GSAS V0.8 .gsasscan.gsasOUTPUT FILE NAMEName of file to contain scan for GSASUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)WARNING: Error in opening fileEnter "YES" or "NO"OUTPUT ROWS"YES" to output a row of data, "NO" for a columnEnter an integer within given rangeNUMBER OF ROW TO OUTPUTEnter number of row to be output to fileNUMBER OF COLUMN TO OUTPUTEnter number of column to be output to fileCONST (see local document for further details)Subroutine FIO_OUT_HUFFMAN V0.5 WARNING: THIS IS ONLY FOR TEST PURPOSES.huftest.hufUSE is the default file for output in FIT2D format. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR HUFFMAN CODING Use the file selection tool to select a directory and an output file to contain the data, storage in compressed form. Normally such a file ends with the extension ".huf". OUTPUT FILE NAMEName of file to contain output dataUnacceptable inputWARNING: Problem with file directory path (directory doesn't exist ?)Enter choice of predictor algorithm: If x is the current pixel, and a, b, c, d are the "previous" pixels as shown: a x c b d 1: predictor = x - a 2: predictor = x - Int ( (a + b) / 2 ) 3: predictor = x - Int ( (a + b + c) / 3) 4: predictor = x - Int ( (a + b + c + d) / 4) (All in integer arithmetic) Enter integer value within given rangePREDICTOR ALGORITHM TO APPLYEnter mode of operation: 0 = Calculate probabilities and Huffman code 1 = Use existing Huffman code (must exist) MODE OF OPERATIONWRITEWARNING: Error in opening fileERROR: Bad output of Huffman coded dataSubroutine FIO_OUT_KLORA V0.1 WRITEHeaderIDEH:000001:000000:000000Image1ByteOrderHighByteFirstLowByteFirstDataTypeFLOATDim_1Dim_2UNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_MAR V0.7 .corfit2d.corBINARY OUTPUT CONTROL VARIABLES FORM This form allows you to control a number of parameters affecting the layout of the binary data written to file. Often the default values will be suitable, but these parameters offer flexibility in the binary format to help input to other programs. The "FILE NAME" button allows the output file to be selected, and changed from the default suggestion. The "RECORD LEN." button allows the record length in bytes to be specified for the output file. The concept of record length does not really exist for Un*x systems, but this can nevertheless be useful in allowing blank "records" to be written at the start of the file, and for writing only partially filled "records". The "BIG ENDIAN" button allows the manner in which integer values are stored to be selected. This allows the output file to be suitable for input into different computer systems regardless of the type of system which is being used. "YES" corresponds to the integer type used on HP, SUN, Silicon Graphics, and most Un*x workstations. "NO" corresponds to the PC and DEC-VAX integer format. The internal array may contain data covering any scaling range, including very large numbers, or only very small numbers, and maybe negative numbers. The output integer format can only cover 65536 different values, so the internal data has to be scaled to this range. The "LOWER RANGE" and the "UPPER RANGE" button allow the user to select exactly the data value range to be scaled to the discrete integer output range. By default, provided the input range is small enough, and doesn't go negative, the scaling will correspond to rounding to the nearest integer. FILE NAME RECORD LEN. BIG ENDIAN LOWER RANGE UPPER RANGE SELECT FILE TO CONTAIN DATA LENGTH OF OUTPUT RECORDS (BYTES) OUTPUT "BIG ENDIAN DATA (HP/SGI/SUN) LOWER LIMIT OF SCALING RANGE UPPER LIMIT OF SCALING RANGE Enter name of file to contain data Enter number of bytes to output in a "record" Enter "YES" for "BIG ENDIAN" (HP/SGI/SUN) integers, "NO" forEnter lower intensity limit ofrange to be output Enter upper intensity limit of range to be output THE SCALING RANGE IS INVALIDOUTPUT FILE NAMEName of file to contain data for later input to DENZOUnacceptable inputMust be within defined limitsRECORD LENGTH (BYTES)Length of fixed length records in file in bytesEnter YES or NOBIG ENDIAN FORMAT INTEGERSYES for big endian integer (Sun/HP/SG), NO for little endian (VAX, PC)PROBLEM WITH FILE DIRECTORY PATH (NO DIRECTORY ?)WARNING: Problem with file directory path (directory doesn't exist ?)ERROR IN OPENING FILEWARNING: Error in opening file**-***-*** **:**:**.** ERROR IN WRITING OUTPUT FILESubroutine FIO_OUT_MCA V0.2 Enter name of output file WRITEEnter real numberSCALING (DIVISION) CONSTANTEnter scaling value by which all data values will be divided.cifpowder.cifWRITEEnter name of output file Enter "YES" or "NO"OUTPUT ROWS"YES" to output a row of data, "NO" for a columnEnter an integer within given rangeNUMBER OF ROW TO OUTPUTEnter number of row to be output to fileNUMBER OF COLUMN TO OUTPUTEnter number of column to be output to fileWAVELENGTHSubroutine FIO_OUT_POWDERCIF V0.3 Subroutine FIO_OUT_SPREAD V0.3 (Much more size efficient output options are available.)Enter "YES" or "NO"OUTPUT FILE"YES" to output data, "NO" to quit option.sprspread.sprSELECT OUTPUT FILE FOR ASCII SPREAD SHEET FORMAT Use the file selection tool to select a directory and an output file to contain the data, storage in TIFF format. Normally such a file ends with the extension ".tif" or ".tiff". Enter name of output file WRITE(1pe12.5, 1x), 1pe12.5)(UNKNOWNDIRECTUNFORMATTEDSubroutine FIO_OUT_TIFF V0.11.tifdata.tifUSE: is the default file for output in TIFF format. If this file is appropriate enter "YES". If you want to use a different file, enter "NO". Enter "YES" or "NO"SELECT OUTPUT FILE FOR TIFF FORMAT Use the file selection tool to select a directory and an output file to contain the data, storage in TIFF format. Normally such a file ends with the extension ".tif" or ".tiff". NAME OF TIFF OUTPUT FILEName of file to contain image data in TIFF formatUnacceptable input1 BYTE UNSIGNED INTEGERS 2 BYTE UNSIGNED INTEGERS Enter data type to output for the pixel data. At present the following options are available: 1 BYTE UNSIGNED INTEGERS: 8 bits per pixel "grey-scale", suitable for "xv" and many other "image" display programs. 2 BYTE UNSIGNED INTEGERS: 16 bits per pixel "grey-scale", suitable for more "scientific" use, not suitable for "xv". DATA TYPE FOR PIXEL VALUESENTER ONE OF AVAILABLE CHOICESnull Enter a valid real numberLOWER LIMIT OF RANGEEnter lowest value to be scaled to output rangeUPPER LIMIT OF RANGEEnter Highest value to be scaled to output rangeWARNING: Problem with file directory path (directory doesn't exist ?)WARNING: Error in opening fileERROR IN OPENING FILEWRITING OUTPUT FILE: PLEASE WAITFIT2D: ISubroutine FIO_OUT_TIFFSHORT V0.2 Subroutine FIO_OUT_TIFFLONG V0.2 Subroutine FIO_OUT_TIFFRAT V0.3 Subroutine FIO_OUT_TIFFCHAR V0.2 Subroutine FIO_IS_ADSC V0.1 READWARNING: Error in opening fileSubroutine FIO_IS_BRUKER V0.1 READWARNING: Error in inputting header lineFORMAT WARNING: The file appears to be a Bruker format file, but the format version number appears to have changed !?!?Subroutine FIO_IS_KLORA V0.3 READWARNING: Error in opening fileSubroutine FIO_FREAD_SEARCHITEM V0.5 Subroutine FIO_INP_2DI2 V0.5 ERROR: Re-binning, transposing on input not yet implementedSubroutine FIO_INP_2DBYTE V0.5 ERROR: Re-binning/transposing on input not yet implementedSubroutine FIO_GUI_IN_DATA V0.5 TYPE AND SIZE OF FILE DATA (need to specify image size) This size form allows you to specifythe type and size of data to be input, The "X-PIXELS" and "Y-PIXELS" buttons allow the number of pixels to be changed. "DATA TYPE" allows the type of values stored for each pixel to be selected X-PIXELS Y-PIXELS DATA TYPE SIGNED BYTE SWAP STARTING BYTE FIRST DIMENSION OF FILE IMAGE SECOND DIMENSION OF FILE IMAGE DATA TYPE OF PIXEL VALUES SIGNED OR UNSIGNED (INTEGERS) SWAP BYTES ON INPUT (INTEGERS) BYTE NUMBER FOR START OF BINARY DATA Enter number of pixels "horizontally" in image Enter number of pixels "vertically" in image Choice type of data stored for pixelvalues Enter "YES" for signed values (integers only) Enter "YES" to swap bytes on input (integers only) Enter byte number for start of binary data (numbering from 1Subroutine FIO_IN_HEADERFILE V0.5 .infoREAD_ASCIIWARNING: No '.info' file, so unknown image size, and pixel sizes (Pixel sizes defaulted to 100 x 100 microns.)INFO: '.info' file has been found and will be used for defaultsWARNING: Problem reading from .info file=ERROR: The image size values are not correct, the '.info' file is wrong or has been corrupted(unsigned) (signed) ERROR: Number of bytes per pixel, or signed/unsigned values is not correct,big endianlittle endianERROR: The endianess of the data is not correctly defined,ERROR: The X pixel size is not correctly defined,ERROR: The Y pixel size is not correctly defined, ERROR: The '.info' file is the wrong file or has been corruptedERROR: The lowest value is not correctly defined, the '.info' file is wrong or has been corruptedSubroutine FIO_INP_2DI4 V0.4 ERROR: Re-binning, transposing on input not yet implementedSubroutine FIO_INP_2DR4 V0.4 ERROR: Re-binning, transposing on input not yet implementedSubroutine FIO_IN_HEADBRUKER V0.2 WARNING: Error in inputting header lineHDRBLKSNOVERFLNPIXELBNROWS NCOLS Subroutine FIO_IN_OVERBRUKER V0.2 ERROR: Error in inputting overflow pixel valueSubroutine FIO_IN_GAS4 V0.4 Subroutine FIO_IN_IQRIMAGE V0.22Subroutine FIO_IN_IQRIMAGE V0.22WARNING: The File does not start with II nor with MM. It is not a correctly defined TIFF file or has been corrupted. (this should equal 42)WARNING: The Image has been compressed. Data Decompression is not presently supported.WARNING: Problem inputting address of start of image. This is probably because there are too many addresses pointing to different parts of the image ("strips").Subroutine FIO_TIFF_IMAGESIZE V0.7 Subroutine FIO_TIFF_IMAGESIZE V0.7 WARNING: Bad TIFF file, the first two bytes of a genuine TIFF file MUST BE either the ASCII characters "II" or "MM". From a PC you would normally find "II". The ASCII value for "I" is 73 and for "M" is 77. The third and fourth byte MUST store the integer value 42. Thus, the values in decimal for the first four bytes in decimal should be either: 73 73 42 0 or 77 77 0 42 After this the next four byte define a pointer to the first "Image File Directory", so any value may be stored, but the integer value 8 may often be found. The first 8 bytes of your input file apparently contain the values: Please check the file type (perhaps it's not TIFF), or possible sources of corruption. (Warning comes from FIO_TIFF_IMAGESIZE.)Subroutine FIO_IN_MAR345 V0.11WARNING: Problem reading in file header('INFO: Image size = ', 2i6, ' Number of overloaded pixels = ', i8) WARNING: The image is bigger than the presently defined program arrays only a part of the image will be input. END OF HEADERDATEINFO: The following information has been extracted from the file header: Date and time of scan = (These values may be changed using the "GEOMETRY" command.)SAMPLE_DISTANCEWARNING: The file contains spiral read-out data and cannot be inputSubroutine FIO_IN_OLDMAR V0.7 WARNING: Problem reading in file header('INFO: Image size = ', 2i6, ' Number of overloaded pixels = ', i8) WARNING: The image is bigger than the presently defined program arrays only a part of the image will be input. INFO: The following information has been extracted from the file header: Date and time of scan = (These values may be changed using the "GEOMETRY" command.)SAMPLE_DISTANCESubroutine FIO_OUT_HEADERFILE V0.4 .infoWRITE(signed) (unsigned)Subroutine FIO_INP_1DOUT V0.3 OUTPUT FILE NAME AND ROW OR COLUMN TO OUTPUT This size form allows you to specifythe output file name and whether to output a row or a column, and which row or column to output. FILE NAME OUTPUT ROWS ROW NUMBER COLUMN NUMBER SELECT FILE TO CONTAIN DATA OUTPUT ROWS (YES) OR COLUMNS (NO) NUMBER OF ROW TO OUTPUT NUMBER OF COLUMN TO OUTPUT Enter name of file to contain data Enter "YES" to output a row, "NO" to output a column Number of row to output Number of column to output Subroutine FIO_ADD_KLORAINTEGER V0.1 Subroutine FIO_ADD_KLORASTRING V0.1 Subroutine FIO_OUT_2DR4 V0.1 Subroutine FIO_IN_KEYBRUKER V0.2 Function Fio_tiff_intentry V0.6 Subroutine FIO_TIFF_INTS V0.4 Subroutine FIO_TREAD_BYTES V0.5 ????Subroutine GS_CLOSE_GRAPHICS V0.2 Subroutine GS_INQ_WINDOWFORMAT V0.1 Subroutine GS_SET_GPP V0.2 Subroutine GS_FPROMPT V0.2 Subroutine GS_INP_MENUCHOICE V0.10MENU CHOICE (GRAPHICAL INPUT)Command not knownINFO: Control returned to graphics window Subroutine GS_INPL V0.5 null CANCEL HELP YES NO Subroutine GS_INQ_GUIREGION V0.1 Subroutine GS_INQ_MESSAGE V0.1 Subroutine GS_MENU V0.7 Subroutine GS_MESSAGE V0.7 O.K. ENTER COMMAND:Enter commandSAVE TEXT FILE NAMEEnter name of file to contain textEnter valid file nameWRITESubroutine GS_PROMPT V0.5 Subroutine GS_SET_IMAGESCALE V0.2 Subroutine GS_SET_MENULAYOUT V0.2 Function GS_UPDATE V0.1 Subroutine GS_COLOURS V0.3 Subroutine GS_INQ_AUTODDR V0.1 Subroutine GS_INQ_DATALOGLIN V0.1 Subroutine GS_INQ_DDR V0.1 Subroutine GS_INQ_LUTCHOICE V0.2 Subroutine GS_SET_AUTODDR V0.1 Subroutine GS_SET_CURVESTYLE V0.1 Subroutine GS_SET_DATALOGLIN V0.1 Subroutine GS_SET_DDR V0.1 Subroutine GS_SET_LUTCHOICE V0.3 Subroutine GS_2DCONTOUR V0.3 Subroutine GS_CLOSE_PS V0.2 % End of PostScript fileSubroutine GS_INP_2DREGION V0.1 Enter a valid real numberX-MINIMUM VALUEEnter minimum X-value for displayed regionY-MINIMUM VALUEEnter minimum Y-value for displayed regionX-MAXIMUM VALUEEnter maximum X-value for displayed regionY-MAXIMUM VALUEEnter maximum Y-value for displayed regionSubroutine GS_INP_ACOLOURS V0.1 GENERAL LINE/TEXT COLOURSubroutine GS_INP_ALABELS V0.1 Enter integer in given rangeNUMBER OF ANNOTATION LABELSEnter total number of annotation labels to outputANNOTATION LABEL NUMBEREnter number of annotation label to defineEnter YES or NODATA COORDINATESYES if label position is in data coordinates, NO page coordinates Enter value in given rangeX-COORDINATEEnter X-coordinate for start of annotation labelY-COORDINATEEnter Y-coordinate for start of annotation labelANNOTATION LABEL TEXTEnter text for annotation labelEnter text and returnOUTPUT ARROWYES if an arrow is to be added ARROW HEAD X-COORDINATEEnter X-coordinate for head of arrowARROW HEAD Y-COORDINATEEnter Y-coordinate for head of arrowARROW TAIL X-COORDINATEEnter X-coordinate for tail of arrowARROW TAIL Y-COORDINATEEnter Y-coordinate for tail of arrowSubroutine GS_INP_ALABELSTYLES V0.1 Enter a valid integer within given rangeNUMBER OF ANNOTATION LABELEnter number of annotation label to set style attributesLABEL FONT INDICEEnter indice for text font for annotation labelANNOTATION LABEL COLOUREnter a valid real within given rangeANNOTATION LABEL CHARACTER HEIGHT SCALE FACTOREnter scale factor for annotation label character heightANNOTATION LABEL CHARACTER WIDTH SCALE FACTOREnter scale factor for annotation label character widthLABEL CHARACTER SPACINGEnter scale factor for annotation label character spacingANGLE (degrees)Enter label direction angle (anti-clockwise)Subroutine GS_INP_ARROWSTYLES V0.1 Enter a valid integer within given rangeNUMBER OF ARROWEnter number of arrow for setting of style attributesARROW LINE TYPE1 = solid, 2 = dashed, 3 = dotted, 4 = dot-dashARROW LINE COLOUREnter a valid real numberLINE WIDTH SCALE FACTORScale factor for thickness of arrow linesARROW HEAD STYLE0 = two straight lines, 1 = filled triangleHEAD LENGTH SCALE FACTORScale factor for length of arrow headHEAD WIDTH SCALE FACTORScale factor for width of arrow headARROW HEAD FILL COLOURSubroutine GS_INP_AXESSTYLES V0.1 Enter a valid integer within given rangeHORIZONTAL AXES LINE TYPE1 = solid, 2 = dashed, 3 = dotted, 4 = dot-dashHORIZONTAL AXES LINE COLOUREnter a valid real numberHORIZONTAL AXES LINE WIDTH SCALE FACTORScale factor for thickness of lineHORIZONTAL AXES LARGE TICK SIZESize in page dimensions of large tick marksHORIZONTAL AXES SMALL TICK SIZESize in page dimensions of small tick marksHORIZONTAL AXES NUMBER OF SMALL TICKSNumber of small tick marks between each pair of large ticksVERTICAL AXES LINE TYPEVERTICAL AXES LINE COLOURVERTICAL AXES LINE WIDTH SCALE FACTORVERTICAL AXES LARGE TICK SIZEVERTICAL AXES SMALL TICK SIZEVERTICAL AXES NUMBER OF SMALL TICKSSubroutine GS_INP_BACKGROUND V0.1 Enter YES or NOFILL BACKGROUNDEnter YES for filled backgroundBACKGROUND COLOURSubroutine GS_INP_CURVESTYLES V0.4 CURVES OUTPUT STYLES CONTROL FORM FIRST CURVE LAST CURVE DRAW LINE DRAW MARKERS DRAW ERRORS FIRST CURVE TO SET OUTPUT STYLE LAST CURVE TO SET OUTPUT STYLE OUTPUT LINE THROUGH COORDINATES DRAW MARKERS AT COORDINATE POINTS DRAW ERRORS BOXES (IF ERRORS DEFINED) Enter number of first curve in range of curves to set output style Enter number of last curve in range of curves to set output style Enter "YES" to set output of lines through coordinates Enter "YES" to set output of markers at coordinates Enter "YES" to set output of error boxes coordinates Curve Output Styles Output styles for many different curves may be set individually or together in a block. The range of curves for which the styles will be set are defined with the "FIRST CURVE" and "LAST CURVE" buttons. For each curve the output of a line through the data coordinates, markers drawn at the data coordinates, and error boxes centred on the data points may be selected. "LAST CURVE" CANNOT BE SMALLER THAN "FIRST CURVE" Enter a valid integer within given rangeNUMBER OF FIRST CURVEEnter first curve in range to set style of curvesNUMBER OF LAST CURVEEnter last curve in range to set style of curvesEnter YES or NODRAW LINEEnter YES for a line drawn between data valuesLINE OUTPUT STYLE LINE TYPE COLOUR WIDTH CLOSE INTERPOLATION LINE TYPE FOR DRAWING THROUGH POINTS COLOUR OF LINES TO DRAW SCALE FACTOR FOR LINE WIDTHS CLOSE LOOPS FROM LAST POINT TO FIRST TYPE OF INTERPOLATION METHOD Enter style used for drawing lines(1 = solid, 2 = dashed, 3 = dotted, 4 = dot-dash) Enter colour to draw lines Enter scale factor for line widths e.g. 2 = double thickness lines Enter "YES" to close figures by drawing at line from the last to first point Enter interpolation type: 0 = Linear, 1 = Cubic Spline, 2 = Piecewise monotonic Control of style of line output The type of line (solid, dashed, dotted, dash-dot) may be selected, together with the colour, and the width. Optionally, curves may be closed by drawing a line from the last data point to the first, and a choice of interpolation methods are available allowing smooth lines to be drawn between the data points LINE TYPE1 = solid, 2 = dashed, 3 = dotted, 4 = dot-dashLINE COLOUREnter a valid real numberLINE WIDTH SCALE FACTORScale factor for thickness of lineLINE CLOSEDYES: if the end points are to be joinedINTERPOLATION METHOD0 = Straight line, 1 = Cubic Spline, 2 = Piecewise monotonicDRAW MARKERSEnter YES to draw markers at data valuesMARKERS OUTPUT STYLE MARKER SIZE FILLED FILL COLOUR MARKER TYPE FOR DRAWING COORDINATES COLOUR OF MARKERS TO DRAW SCALE FACTOR FOR MARKER SIZES LINE WIDTH FOR DRAWING MARKERS FILL INTERIOR OF MARKERS FILL COLOUR FOR MARKER INTERIORS 1 = ., 2 = X, 3 = *, 4 = o, 5 = +, 6 = square, 7 = kite, 8 = triangle, 9 = upside down triangle, 10 = star, 11 = ConvoluEnter colour to draw markers Enter scale factor for marker sizese.g. 2 = twice as large as default Enter scale factor for width of lines used to draw the markers Enter "YES", if the interior of markers (when existent) is to be filled Enter colour used to fill interior of markers (when existent) Control of style of marker output The type of marker (dot, cross, circle, etc.) may be selected, together with the colour, size, and the line width. Optionally, markers defining interiors may be filled with a specified colour. The following choice of markers is available: 1 = . (not scaled), 2 = X, 3 = *, 4 = o, 5 = +, 6 = square 7 = Rotated square (kite), 8 = triangle, 9 = upside down triangle, 10 = six-pointed star, 11 = Convolution sign (circle with diagonal cross), 12 = Circle with horizontal cross, 13 = * (Two coloured cross) Marker types are: 1 = . (not scaled), 2 = X, 3 = *, 4 = o, 5 = +, 6 = square 7 = Rotated square (kite), 8 = triangle, 9 = upside down triangle, 10 = six-pointed star, 11 = Convolution sign (circle with diagonal cross), 12 = Circle with horizontal cross, 13 = * (Two coloured) MARKER TYPEMARKER COLOURMARKER SCALE FACTORScale factor for size of markerMARKER LINE WIDTH SCALE FACTORScale factor for line width used to draw markerMARKER FILL AREAYES if area enclosing markers are to be filledMARKER FILL COLOURDRAW ERROR BOXESEnter YES to draw error boxes around data valuesERROR BOXES OUTPUT STYLE CONTROL FORM BOX TYPE ERROR BOX TYPE FOR COORDINATES LINE TYPE FOR DRAWING ERROR BOXES COLOUR OF ERROR BOXES TO DRAW LINE WIDTH FOR DRAWING ERROR BOXES Error box type: 0 = Cross hair, 1 = Kite, 2 = Rectangle Error box line type: 1 = solid, 2 = dashed, 3 = dotted, 4 = dot-dash Enter scale factor for width of lines used to draw the error boxes Control of style of error box output The type of error boxes (cross-hair, kite, rectangle) may be selected, together with the colour, line type and width. ERROR BOX TYPE0 = Cross hair, 1 = Kite, 2 = RectangleERROR BOX LINE TYPEERROR BOX COLOURERROR BOX LINE WIDTH SCALE FACTORScale factor for thickness of line for error boxesSubroutine GS_INP_ENUMERATIONSTYLE V0.1 Enter YES or NOOUTPUT X-AXES ENUMERATIONYES for X-axes enumerated, NO for no X-axes enumeratedEnter a valid integer within given rangeX-AXES ENUMERATION FONT INDICEEnter indice for text font for X-axes enumerationX-AXES ENUMERATION COLOUR INDEXEnter a valid real within given rangeX-AXES ENUMERATION CHARACTER HEIGHT SCALE FACTOREnter scale factor for X-axes enumeration character heightX-AXES ENUMERATION FIELD LENGTHMaximum number of characters for each enumeration numberX-AXES ENUMERATION FRACTION LENGTHMaximum number of characters in fractional part of each enumeration numberX-AXES ENUMERATION AUTOMATIC SHORTENINGYES if unnecessary characters should be removed from enumeration numbersX-AXES ENUMERATION CONSTANT LENGTHYES if all X-axes numbers should use the same number of charactersOUTPUT Y-AXES ENUMERATIONYES for Y-axes enumerated, NO for no Y-axes enumeratedY-AXES ENUMERATION FONT INDICEEnter indice for text font for Y-axes enumerationY-AXES ENUMERATION COLOUR INDEXY-AXES ENUMERATION CHARACTER HEIGHT SCALE FACTOREnter scale factor for Y-axes enumeration character heightY-AXES ENUMERATION FIELD LENGTHY-AXES ENUMERATION FRACTION LENGTHY-AXES ENUMERATION AUTOMATIC SHORTENINGY-AXES ENUMERATION CONSTANT LENGTHYES if all Y-axes numbers should use the same number of charactersSubroutine GS_INP_FONT V0.1 Enter a valid integer within given rangeTEXT FONT INDICEEnter indice for text font for all text in diagramSubroutine GS_INP_GPP V0.1 Enter a valid real numberX-MINIMUM VALUEEnter minimum X-value for graph page positionY-MINIMUM VALUEEnter minimum Y-value for graph page positionX-MAXIMUM VALUEEnter maximum X-value for graph page positionY-MAXIMUM VALUEEnter maximum Y-value for graph page positionSubroutine GS_INP_GRID V0.1 Enter YES or NOHORIZONTAL COARSE GRIDIs a horizontal coarse grid requiredVERTICAL COARSE GRIDIs a vertical coarse grid requiredHORIZONTAL FINE GRIDIs a horizontal fine grid requiredVERTICAL FINE GRIDIs a vertical fine grid requiredSubroutine GS_INP_GRIDSTYLE V0.1 Enter a valid integer within given rangeHORIZONTAL COARSE GRID LINE TYPE1 = solid, 2 = dashed, 3 = dotted, 4 = dot-dashHORIZONTAL COARSE GRID LINE COLOUREnter a valid real numberHORIZONTAL COARSE GRID LINE WIDTH SCALE FACTORScale factor for thickness of lineVERTICAL COARSE GRID LINE TYPEVERTICAL COARSE GRID LINE COLOURVERTICAL COARSE GRID LINE WIDTH SCALE FACTORHORIZONTAL FINE GRID LINE TYPEHORIZONTAL FINE GRID LINE COLOURHORIZONTAL FINE GRID LINE WIDTH SCALE FACTORVERTICAL FINE GRID LINE TYPEVERTICAL FINE GRID LINE COLOURVERTICAL FINE GRID LINE WIDTH SCALE FACTORSubroutine GS_INP_LAYOUT V0.1 Enter a valid real numberTITLE TO AXIS GAPEnter vertical distance in page coordinatesX-LABEL TO AXIS GAPY-LABEL TO AXIS GAPEnter horizontal distance in page coordinatesX-AXIS ENUMERATION TO AXIS GAPY-AXIS ENUMERATION TO AXIS GAPSubroutine GS_INP_LTICKS V0.2 "YES" if the positions of large tick marks are to be automatically calculated "NO" if user start, interval, and number of tick mark values are to be used Enter "YES" or "NO"X-AXES LARGE TICK POSITIONS AUTOMATICEnter position (in data coordinates) for first large tick mark to be drawn on the X-axes Enter a valid real within given rangeX-AXES FIRST LARGE TICK MARK POSITIONEnter interval (in data coordinates) between large tick marks to be X-AXES LARGE TICK MARK INTERVALEnter number of large tick marks to be drawn on the X-axes Enter a valid integer within given rangeX-AXES NUMBER OF LARGE TICK MARKSY-AXES LARGE TICK POSITIONS AUTOMATICdrawn on the Y-axes Y-AXES FIRST LARGE TICK MARK POSITIONY-AXES LARGE TICK MARK INTERVALEnter number of large tick marks to be drawn on the Y-axes Y-AXES NUMBER OF LARGE TICK MARKSSubroutine GS_INP_LUT V0.3 COLOUR SCHEMEEnter one of available colour table choicesEnter integer within defined rangeNUMBER OF LEVELSEnter number of separate colour levels required in colour tableSubroutine GS_INP_TITLESTYLEV0.1 Enter YES or NOOUTPUT TITLEEnter YES for title on graph, NO for no titleEnter a valid integer within given rangeTITLE FONT INDICEEnter indice for text font for titleTITLE COLOUREnter a valid real within given rangeTITLE CHARACTER HEIGHT SCALE FACTOREnter scale factor for title character heightTITLE CHARACTER WIDTH SCALE FACTOREnter scale factor for title character widthTITLE CHARACTER SPACINGEnter scale factor for title character spacingSubroutine GS_INP_XLABELSTYLE V0.1 Enter YES or NOOUTPUT X-AXIS LABELEnter YES for X-axis label on graph, NO for no X-axis labelEnter a valid integer within given rangeX-AXIS LABEL FONT INDICEEnter indice for text font for X-axis labelX-AXIS LABEL COLOUREnter a valid real within given rangeX-AXIS LABEL CHARACTER HEIGHT SCALE FACTOREnter scale factor for X-axis label character heightX-AXIS LABEL CHARACTER WIDTH SCALE FACTOREnter scale factor for X-axis label character widthX-AXIS LABEL CHARACTER SPACINGEnter scale factor for X-axis label character spacingSubroutine GS_INP_YLABELSTYLE V0.1 Enter YES or NOOUTPUT Y-AXIS LABELEnter YES for Y-axis label on graph, NO for no Y-axis labelEnter a valid integer within given rangeY-AXIS LABEL ORIENTATION1 = rotated vertical, 2 = horizontal Y-AXIS LABEL FONT INDICEEnter indice for text font for Y-axis labelY-AXIS LABEL COLOUREnter a valid real within given rangeY-AXIS LABEL CHARACTER HEIGHT SCALE FACTOREnter scale factor for Y-axis label character heightY-AXIS LABEL CHARACTER WIDTH SCALE FACTOREnter scale factor for Y-axis label character widthY-AXIS LABEL CHARACTER SPACINGEnter scale factor for Y-axis label character spacingSubroutine GS_MSET_PUBLICATION V0.1 Subroutine GS_PLOT V0.2 Subroutine GS_SET_IDR V0.2 Subroutine GS_XYSGRAPH V0.1 Subroutine GS_OPEN_GRAPHICS V0.6 iiii..MMWWSubroutine GS_FMENU V0.1 Subroutine GS_FWARNING V0.1 Subroutine GS_MPLOT V0.5 Subroutine GS_PPROMPT V0.1 Subroutine GS_INP_UNZOOM V0.3 Subroutine GS_INPS_FCOORDINATES V0.2 Subroutine GS_OFF_PRINT V0.1 Subroutine GS_ON_PRINT V0.4 Enter name of PostScript output file or File to store graphicsEnter for no file storageINFO: Writing graphics file: Please waitSubroutine GS_INQ_CURVESTYLE V0.1 Subroutine GS_INPI V0.4 ? HELP WARNING: Input value: cannot convert to a integer numberSubroutine GS_3DSURFACE V0.3 Subroutine GS_CAL_COLOURSV0.3 Subroutine GS_CAL_ZRANGE V0.1 WARNING: The maximum data value is less than the user input minimumWARNING: The minimum data value is greater than the user input maximum Z-value (intensity) Use "Z-SCALE" to change values or scaling modeSubroutine GS_INPR V0.7 ? HELP WARNING: Input value: cannot convert to a real numberSubroutine GS_INQ_3DAXES V0.1 Subroutine GS_INQ_3DSTYLE V0.1 Subroutine GS_INQ_IMAGESCALE V0.1 Subroutine GS_INQ_PIXELLIMITS V0.2 Subroutine GS_SET_3DVIEW V0.1 Subroutine GS_SET_PIXELLIMITS: V0.1 Subroutine GS_SET_PIXELLIMITS V0.1 Subroutine GS_INQ_IASPECT V0.1 Subroutine GS_SET_IASPECT V0.1 Subroutine GS_INQ_DDDR V0.1 Subroutine GS_INQ_GPP V0.1 Subroutine GS_2DIMAGE V0.8 Subroutine GS_SET_DDDR V0.1 Subroutine GS_XYCURVES V0.1 Subroutine GS_XYGRAPH V0.1 Subroutine GS_2DMIMAGE V0.6 Subroutine GS_INP_COORDINATES V0.6 Enter valid integer valueNUMBER OF COORDINATES (GRAPHICAL INPUT)NUMBER COORDINATES (GRAPHICAL INPUT)Enter valid real valueX-COORDINATE (GRAPHICAL INPUT)X-coordinate (GRAPHICAL INPUT)Y-COORDINATE (GRAPHICAL INPUT)Y-coordinate (GRAPHICAL INPUT)(Click here to finish) Subroutine GS_FORM V0.24O.K.O.K.: Return with new valuesCANCELCANCEL: Interrupt operation: No values changed??: Description of button commandsHELPHELP: Specific help information on required form inputINFOINFO: General information on using the formYES NO ...RADIAL 2-THETA Q-SPACE D-SPACINGS null O.K. CANCEL ? INFO HELP Enter integer value within given range Enter valid integer value Enter real value within given range Enter valid real value Enter character string SELECT REQUIRED COLOURClick on scan type MENU ONLY POSSILE FOR FIRST 12 CHOICESClick on variable to change, or 'O.K.'WARNING: Problem in form widget, bad internal error statusSubroutine GS_INQ_POSTSCRIPT V0.1 Subroutine GS_SET_POSTSCRIPT V0.1 Subroutine GS_3DLINES V0.3 WARNING: The hidden line removal algorithm is not perfect, (probably owing to rounding errors) sometimes it is known to draw lines where they should not appear. Subroutine GS_FILESELECTION V0.28 Enter file name Enter valid text FILE NAMEWINDOWS-NT WARNING: Can't find out current directoryWARNING: Problem obtaining list of directories Bad directory name:NOTE: Automatically climbing one directory level Too many directories List of names too long Internal directory change problem*.File Selection O.K. ? : Click on "YES" or "NO"null File Name (Optional)UP UPDATE * !!! FILE DOES NOT EXIST, OR WRONG PATH !!! BAD FILE PATH SYNTAX !!! FILE DOES NOT EXIST !!! !!! FILE MUST NOT ALREADY EXIST !!!CANCEL ? UP DIRWARNING: You can't go above the "root" directoryUPDATEHELP INFO TYPES ENTER FILE EXTENSION TYPE TO SELECTEnter file extension (no .)Enter valid characters FILTER ENTER FILE NAME PATTERN TO MATCHEnter pattern, using asterisks as wild-cards Enter "YES" if the choice is O.K...WARNING: Problem in file selection widget, bad internal error statusWARNING: Problem obtaining list of filesSubroutine GS_SUBFILE V0.1 Subroutine GS_INPS V0.2 Error in macro input of a character string FSubroutine GS_INPS_COORDINATES V0.12Enter valid integer valueNUMBER OF COORDINATES (GRAPHICAL INPUT)NUMBER COORDINATES (GRAPHICAL INPUT)Enter valid real valueX-COORDINATE (GRAPHICAL INPUT)X-coordinate (GRAPHICAL INPUT)Y-COORDINATE (GRAPHICAL INPUT)Y-coordinate (GRAPHICAL INPUT)ONE CLICK TWO CLICK (Click here to finish) Enter valid floating point numberFHELP CANCEL KEYBOARD X-COMPONENT OF COORDINATE TO DEFINEY-COMPONENT OF COORDINATE TO DEFINETWO CLICK ONE CLICK Subroutine GS_MARK V0.2 Subroutine GS_INQ_ERRORBARS V0.1 Subroutine GS_INT_XYEGRAPH V0.8 X/Y GRAPH DISPLAY MENUnull EXIT ? ZOOM IN FULL UN-ZOOM PRINT FINISHED WRITING FILESubroutine GS_SET_ERRORBARS V0.1 Subroutine GS_FILLSTYLE V0.2 Subroutine GS_INQ_DGPP V0.1 Subroutine GS_INQ_DLUTPC V0.1 Subroutine GS_RECTANGLE: V0.1 Subroutine GS_TEXTSTYLE V0.5 Subroutine GS_INPC V0.11Subroutine GS_INQ_LUT V0.1 Subroutine GS_SET_LUT V0.1 Subroutine GS_INP_XYREGION V0.4 CLICK ON OPPOSITE CORNERS OF NEW REGIONClick on 2 X/Y coordinates, to define new regionSubroutine GS_BACKGROUND: V0.4 Subroutine GS_LINESTYLE V0.2 Subroutine GS_XYCLICK V0.3 X = Y = Subroutine GS_INQ_AXESLOGLIN: V0.1 Subroutine GS_INQ_BACKGROUND V0.2 Subroutine GS_INQ_CURVEMARKERS V0.1 Subroutine GS_INQ_MASKCOLOUR V0.1 Subroutine GS_INQ_VAXESSTYLE V0.1 Subroutine GS_MARKERS V0.1 Subroutine GS_SET_BACKGROUND V0.2 Subroutine GS_SET_CURVEMARKERS V0.1 Subroutine GS_SET_DGPP V0.1 Subroutine GS_SET_VAXESSTYLE V0.1 Subroutine GS_TEXT V0.4 Subroutine GS_XYEGRAPH: V0.7 Subroutine GS_XYEGRAPH V0.7 Subroutine GS_CAL_WCTOPIX V0.2 Subroutine GS_INP_CHOICE V0.2 CANCEL ? HELP null ? HELP CANCEL Subroutine GS_LINE: V0.1 Subroutine GS_MARKERSTYLE V0.1 Subroutine GS_INQ_3DSIMAGE V0.1 Subroutine GS_SET_3DAXES V0.1 Subroutine GS_SET_3DSIMAGE V0.1 Subroutine GS_SET_3DSTYLE V0.2 Subroutine GS_DRAW_CHARACTER: V0.3 abcdefghijklmnopqrstuvwxyzWARNING: Letter not available2chiSubroutine GS_SET_CHAR_SCALING V0.1 Subroutine GS_TRIANGLE: V0.1 Subroutine GS_INP_COLOUR V0.2 Enter one of the following available colours: BLACK BLUE BROWN CYAN GREEN GREY MAGENTA ORANGE RED VIOLET WHITE YELLOW (0 INDEX) (1 INDEX) Enter one of the given coloursSubroutine GS_SET_MASKCOLOUR V0.1 Subroutine GS_SET_MESSAGE V0.1 Subroutine GS_INQ_GRID: V0.1 Subroutine GS_SET_GRID: V0.1 Subroutine GS_INP_PC V0.2 Enter valid real valueX-PAGE COORDINATE (GRAPHICAL INPUT)X-page coordinate (GRAPHICAL INPUT)Y-PAGE COORDINATE (GRAPHICAL INPUT)Y-page coordinate (GRAPHICAL INPUT)Subroutine GS_CONTINUE V0.1 Subroutine GS_ARCELLIPSE V0.1 Subroutine GS_RELLIPSE V0.1 Subroutine GS_ARROW: V0.1 Subroutine GS_ARROW V0.1 Subroutine GS_INP_FCOORDINATES V0.1 Subroutine GS_CAL_MENUCHOICE V0.2 Subroutine GS_STRINGBUTTON: V0.2 Subroutine GS_STRINGBUTTON V0.2 Subroutine GS_INQ_MENULAYOUT V0.2 Subroutine GS_INQ_MENUSTYLE V0.2 Subroutine GS_DRAW_MESSAGE V0.7 0.K.SAVESubroutine GS_INP_SCROLLBAR V0.1 Subroutine GS_BUTTON: V0.2 Subroutine GS_BUTTON V0.2 Subroutine GS_CAL_COLOURTABLE V0.1 Subroutine GS_2DCONTLINES V0.1 Subroutine GS_ALABELS: V0.2 Subroutine GS_ARROWS: V0.1 Subroutine GS_ATEXT V0.1 Subroutine GS_AXISFRAME V0.6 Subroutine GS_GRID V0.2 Subroutine GS_TITLE: V0.2 Subroutine GS_XLABEL V0.2 Subroutine GS_YLABEL V0.4 Subroutine GS_INQ_PSFILE V0.1 Subroutine GS_SET_PSFILE V0.1 Subroutine GS_MSET_COLOURSV0.3 Subroutine GS_INQ_ALABEL V0.1 Subroutine GS_INQ_ARROW V0.1 Subroutine GS_INQ_MAXCURVES V0.1 Subroutine GS_SET_ALABEL V0.1 Subroutine GS_SET_ARROW V0.1 Subroutine GS_INQ_ALABELSTYLEV0.1 Subroutine GS_INQ_ALABELSTYLE V0.1 Subroutine GS_SET_ALABELSTYLESV0.1 Subroutine GS_SET_ALABELSTYLE V0.1 Subroutine GS_INQ_ARROWSTYLE V0.1 Subroutine GS_SET_ARROWSTYLE V0.1 Subroutine GS_INQ_HAXESSTYLE V0.1 Subroutine GS_SET_HAXESSTYLE V0.1 Subroutine GS_INQ_CURVEERRORS V0.1 Subroutine GS_INQ_CURVELINES V0.1 Subroutine GS_INQ_CURVELINE V0.1 Subroutine GS_INQ_CURVESOFTMARKERS V0.1 Subroutine GS_SET_CURVEERRORS V0.1 Subroutine GS_SET_CURVELINES V0.1 Subroutine GS_SET_CURVELINE V0.1 Subroutine GS_SET_CURVESOFTMARKERS V0.1 Subroutine GS_INQ_XAXISENUM V0.1 Subroutine GS_INQ_YAXISENUM V0.1 Subroutine GS_SET_XAXISENUM V0.1 Subroutine GS_SET_YAXISENUM V0.1 Subroutine GS_MSET_FONTV0.1 Subroutine GS_INQ_HCOARSEGRID V0.1 Subroutine GS_INQ_HFINEGRID V0.1 Subroutine GS_INQ_VCOARSEGRID V0.1 Subroutine GS_INQ_VFINEGRID V0.1 Subroutine GS_INQ_HCOARSEGRID V0.1 Subroutine GS_SET_HFINEGRID V0.1 Subroutine GS_SET_VCOARSEGRID V0.1 Subroutine GS_SET_VFINEGRID V0.1 Subroutine GS_INQ_GRAPHLAYOUT V0.1 Subroutine GS_SET_GRAPHLAYOUT V0.1 Subroutine GS_CAL_TICKS V0.1 Subroutine GS_INQ_XLTICKS V0.2 Subroutine GS_INQ_YLTICKS V0.2 Subroutine GS_SET_XLTICKS V0.2 Subroutine GS_SET_YLTICKS V0.2 Subroutine GS_INQ_TITLESTYLE V0.1 Subroutine GS_SET_TITLESTYLE V0.1 Subroutine GS_INQ_XLABELSTYLE V0.1 Subroutine GS_SET_XLABELSTYLE V0.1 Subroutine GS_INQ_YLABELORIENTATION V0.1 Subroutine GS_INQ_YLABELSTYLE V0.1 Subroutine GS_SET_YLABELORIENTATION V0.1 Subroutine GS_SET_YLABELSTYLE V0.1 Subroutine GS_SET_AXESLOGLIN: V0.1 Subroutine GS_DEF_COLOURS V0.4 Subroutine GS_DEF_LUTCHOICE V0.1 Subroutine GS_OPEN_NOTERM V0.2 Subroutine GS_WARNING V0.5 Unknown Subroutine GS_OPEN_PS V0.4 ERROR: Failed to open ASCII text file. May be you do not have write permission. (This value is system dependent; see system documentation.)WARNING: Logarithmic scaling demanded of data which is all below zero !Subroutine GS_3SURFACE V0.11Subroutine GS_INQ_3DVIEW V0.1 Subroutine GS_XYCURVE V0.2 Subroutine GS_2DMCELLARRAY V0.4 WARNING: The maximum data value is less than the user input minimumWARNING: The minimum data value is greater than the user input maximum Z-value (intensity) Use "Z-SCALE" to change values or scaling modeSubroutine GS_LUTSCALE V0.8 Subroutine GS_DRAW_FORM V0.8 NO TITLEDESCRIPTIONSVALUESCHANGEClick on variable to change, or 'O.K.'Subroutine GS_GIVE_COLOURNAME V0.2 BLACKBLUEBROWNCYANGREENGREYMAGENTAORANGEREDVIOLETWHITEYELLOW(INDEX 0)(INDEX 1)INVERSESubroutine GS_GUI_COLOUR V0.2 null Subroutine GS_INP_DATATYPE V0.3 null ? HELP Subroutine GS_INP_FORMMENU V0.2 WARNING: Bad form menu datanullSubroutine GS_INP_SCANTYPE V0.1 SELECT TYPE OF OUTPUT SCANnull ? HELP 2-THETA D-SPACINGS Q-SPACE RADIAL Subroutine GS_SET_GUIREGION V0.1 Subroutine GS_SPROMPT V0.1 / Subroutine GS_3DHIDELINES V0.3 Subroutine GS_3DYAXIS V0.1 *Subroutine GS_INQ_AXESSTYLE: V0.3 Subroutine GS_SET_AXESSTYLE: V0.3 Subroutine GS_DRAW_SELECTION V0.7 DIRECTORY: NO SELECTED FILESUP DIRUPDATENO SUB-DIRECTORIESFSubroutine GS_DRAW_SLIST V0.1 Subroutine GS_DRAW_LIST V0.1 Subroutine GS_INP_TWOCLICK V0.2 SECOND CLICK WITHIN "SPY-GLASS" FHELP CANCEL Subroutine GS_SPYGLASS V0.3 Subroutine GS_ELLIPSE V0.2 Subroutine GS_KITE V0.1 Subroutine GS_CAL_DDR V0.3 WARNING: The minimum data value is greater than the user input maximumWARNING: The maximum data value is less than the user input minimum X-value Y-valueSubroutine GS_KEY: V0.1 Subroutine GS_SET_FRAMESTYLE: V0.2 Subroutine GS_INQ_CHAR_SCALING V0.1 Subroutine GS_GIVE_COLOUR V0.2 BLACK BLUE BROWN CYAN GREEN GREY MAGENTA ORANGE RED VIOLET WHITE YELLOW (0 INDEX) (1 INDEX) INVERSE Subroutine GS_INQ_MESSAGESTYLE V0.1 Subroutine GS_SCROLLBAR V0.3 Subroutine GS_CAL_SCROLLBAR V0.1 Subroutine GS_INQ_ATEXT V0.1 Subroutine GS_INQ_ATEXTSTYLE V0.1 Subroutine GS_ALOGAXIS V0.4 Subroutine GS_INQ_FRAMESTYLE: V0.1 Subroutine GS_LINAXIS V0.1 Subroutine GS_ALOGGRID V0.1 Subroutine GS_LINGRID V0.1 Subroutine GS_DEF_GRAPHICS V0.3 Subroutine GS_MSET_OPTIONS V0.4 LANDSCAPE -LANDSCAPE +LANDSCAPE LAND -LAND +LAND -COLOURS+COLOURS-COL+COLWARNING: Bad command line option-DFORM+DFORM-DMENU+DMENUSubroutine GS_DRAW_WARNING V0.1 !!! WARNING !!!O.K.Subroutine GS_3DRMCELLARRAY V0.2 Function GS_3DRMCELLARRAY V0.2 Function GS_3FILLAREA V0.2 Subroutine GS_3LINAXIS V0.3 Subroutine GS_3LINE: V0.1 Function GS_3POLYLINE V0.1 Subroutine GS_CSLINE V0.1 Subroutine GS_PMLINE V0.1 Subroutine GS_XYERRORBARS V0.1 Subroutine GS_INQ_IDR V0.1 Subroutine GS_SET_DLUTPC V0.1 Subroutine GS_CAL_ENUMFIELD V0.1 .Subroutine GS_2DCELLARRAY V0.6 Subroutine GS_INQ_KEY V0.1 Subroutine GS_INQ_KEYLABEL V0.1 Subroutine GS_INQ_KEYSTYLE V0.1 Subroutine GS_ALOGAXENUM V0.5 Subroutine GS_ALOGTICKS V0.1 Subroutine GS_LINAXENUM V0.4 *Subroutine GS_LINTICKS V0.1 Subroutine GS_DEF_3DVIEW V0.1 Subroutine GS_DEF_ATTRIBUTES V0.9 Subroutine GS_DEF_GUIREGION V0.1 Subroutine GS_DEF_IMAGESCALE V0.1 Subroutine GS_DEF_MASKCOLOUR V0.1 Subroutine GS_DEF_MENULAYOUT V0.2 Subroutine GS_DEF_MENUSTYLE V0.2 Subroutine GS_DEF_MESSAGE V0.1 Subroutine GS_DEF_MESSAGESTYLE V0.2 Subroutine GS_DEF_PIXELLIMITS V0.2 Subroutine GS_DEF_POSTSCRIPT V0.1 Subroutine GS_DEF_PSFILE V0.1 Subroutine GS_DEF_WINDOWFORMAT V0.1 Subroutine GS_PROGRESS V0.1 0 %100 %Subroutine GS_SET_PROGRESS V0.1 Subroutine GS_INQ_PROGRESS V0.1 Subroutine GS_MSET_LANDSCAPE V0.1 Subroutine GS_3LINTICKS V0.2 Subroutine GS_3LINAXENUM V0.2 **10ESubroutine GS_3LINTICKS V0.1 Subroutine GS_SPLINE V0.1 Subroutine GS_EXPONT V0.2 *1010 ESubroutine GS_DEF_ALABELS V0.1 Subroutine GS_DEF_ATEXTSTYLE V0.1 Subroutine GS_DEF_ARROWS V0.1 Subroutine GS_DEF_ARROWSTYLES V0.1 Subroutine GS_DEF_ATEXT V0.1 Subroutine GS_DEF_CURVEERRORS V0.1 Subroutine GS_DEF_CURVELINES V0.1 Subroutine GS_DEF_CURVEMARKERSV0.1 Subroutine GS_DEF_CURVESOFTMARKERS V0.1 Subroutine GS_DEF_CURVESTYLES V0.1 Subroutine GS_DEF_GPP V0.1 Subroutine GS_DEF_KEYLABELS V0.1 Subroutine GS_SET_ATEXTSTYLE V0.1 Subroutine GS_SET_KEY V0.1 Subroutine GS_SET_KEYSTYLE V0.1 Subroutine GS_SET_WINDOWFORMAT V0.1 Function GS_3TEXT V0.1 Subroutine LG_WINDOW_TITLE V0.1 Function LG_SET_LOGZSCALING V0.1 ERROR: Light Graphics system is not open (LG_SET_LOGZSCALING)Function LG_INP_RESIZE V0.2 Function LG_INQ_TEXTFONT V0.1 ERROR: Light Graphics system is not open (LG_INQ_TEXTFONT)Subroutine LG_TEXTFONT V0.2 Subroutine LG_X11_TEXTFONT V0.2 Function LG_INQ_IMAGERANGE V0.1 ERROR: Light Graphics system is not open (LG_INQ_IMAGERANGE)Function LG_INQ_LOGZSCALING V0.1 ERROR: Light Graphics system is not open (LG_INQ_LOGZSCALING)Function LG_SET_IMAGERANGE V0.1 ERROR: Light Graphics system is not open (LG_SET_IMAGERANGE)Function LG_DATAWINDOW V0.4 ERROR: Light Graphics system is not open (LG_OPEN_WK)Function LG_VIEWPORT V0.2 ERROR: Light Graphics system is not open (LG_OPEN_WK)Function LG_CLEAR V0.1 Function LG_X11_CLEAR V0.1 Function LG_INQ_COLOURMAPPING V0.1 ERROR: Light Graphics system is not open (LG_INQ_COLOURMAPPING)Function LG_ROTATELUT V0.1 Subroutine LG_COLOURS V0.1 Function LG_TEXT V0.1 Function LG_WC2PC V0.1 ERROR: Light Graphics system is not open (LG_WC2PC)Function LG_PC2WC V0.1 ERROR: Light Graphics system is not open (LG_PC2WC)Function LG_SET_RUBBERBAND V0.1 ERROR: Workstation ID is unknown (LG_SET_RUBBERBAND)WARNING: Rubber-banding is not possible from a Postscript deviceFunction LG_CLIP V0.1 Function LG_CLIPWINDOW V0.1 ERROR: Light Graphics system is not open (LG_CLIPWINDOW)Subroutine LG_POLYLINE V0.2 Function LG_X11_PL V0.2 Subroutine LG_UNITYTRANSFORM V0.1 ERROR: Light Graphics system is not open (LG_OPEN_WK)Function LG_RAS_TRIANGLE V0.5 Function LG_RAS_TRIXLIMITS V0.1 Subroutine LG_MARKERWIDTH V0.2 Function LG_POLYMARKER V0.1 Function LG_X11_PM V0.1 Subroutine LG_CLOSE V0.1 WARNING: Light Graphics system is already closed ! (LG_CLOSE)Subroutine LG_CLOSE_WK V0.2 ERROR: Workstation ID is unknown (LG_CLOSE_WK)Function LG_INP_COORDINATE V0.3 ERROR: Workstation ID is unknown (LG_INP_COORDINATE)WARNING: Coordinate not successfully input from X-11 workstationWARNING: Coordinate input is not possible from a Postscript deviceSubroutine LG_SET_UPDATE V0.1 ERROR: Workstation ID is unknown (LG_SET_UPDATE)WARNING: SET UPDATE wasnot successful for X-11 workstationWARNING: SET UPDATE is not possible on a Postscript deviceFunction LG_UPDATE V0.1 ERROR: Workstation ID is unknown (LG_UPDATE)Subroutine LG_COLOURS V0.1 Subroutine LG_ACTIVATE_WK V0.1 ERROR: Workstation ID is unknown (LG_ACTIVATE_WK)WARNING: Workstation is already active (LG_ACTIVATE_WK)ERROR: Workstation is not open (LG_ACTIVATE_WK)Function LG_INQ_TEXTWIDTH V0.1 ERROR: Light Graphics system is not open (LG_INQ_TEXTWIDTH)WARNING: Light Graphics system is not open (LG_OPEN_WK)WARNING: Maximum number of workstations are already open (LG_OPEN_WK)Subroutine LG_OPEN_WK V0.7 WARNING: Unknown graphics device type (LG_OPEN_WK)WARNING: X-11 workstation not opened successfully (LG_OPEN_WK)Subroutine LG_X11_OPEN V0.7 WARNING: Maximum number of X-11 workstations are already open (LG_OPEN_WK)WARNING: Maximum number of PostScript workstations are already open (LG_OPEN_WK)WARNING: Workstation already open (LG_OPEN_WK)Function LG_SET_COLOURINDICES V0.1 ERROR: Light Graphics system is not open (LG_SET_COLOURINDICES)Function LG_INQ_MAXPC V0.2 ERROR: Light Graphics system is not open (LG_OPEN_WK)Subroutine LG_DEACTIVATE_WK V0.1 ERROR: Workstation ID is unknown (LG_DEACTIVATE_WK)WARNING: Workstation is not active (LG_DEACTIVATE_WK)ERROR: Workstation is not open (LG_DEACTIVATE_WK)Function LG_INQ_SCALING V0.1 ERROR: Light Graphics system is not open (LG_INQ_SCALING)Subroutine LG_BESTCOLOURV0.1 Subroutine LG_SET_RESOLUTION V0.1 Function LG_INP_EVENT V0.3 ERROR: Workstation ID is unknown (LG_INP_EVENT)WARNING: String not successfully input from X-11 workstationWARNING: String input is not possible from a Postscript deviceSubroutine LG_FILLCOLOUR V0.4 Function LG_FILLCOLOUR V0.4 Function LG_FILLAREA V0.3 Subroutine LG_TEXTALIGNMENT V0.3 Subroutine LG_X11_TEXTALIGNMENT V0.3 Subroutine LG_TEXTANGLE V0.3 Subroutine LG_X11_TEXTANGLE V0.3 Subroutine LG_TEXTCOLOUR V0.3 Function LG_X11_TEXTCOLOUR V0.3 Subroutine LG_TEXTHEIGHT V0.3 Subroutine LG_X11_TEXTHEIGHT V0.3 Subroutine LG_LINECOLOUR V0.4 Subroutine LG_X11_LINECOLOUR V0.4 WARNING: The PostScript driver does not support inverse videoSubroutine LG_LINESTYLE V0.2 Subroutine LG_LINEWIDTH V0.2 Subroutine LG_MARKERCOLOUR V0.2 Subroutine LG_MARKERSCALE V0.2 Subroutine LG_MARKERTYPE V0.1 Subroutine LG_OPEN V0.9 WARNING: Light Graphics system is already open ! (LG_OPEN)WINFunction LG_SET_RASTERMODE V0.6 WARNING: Raster mode is already enabledWARNING: Dynamic memory allocation has failed. The internal graphics raster cannot be created, so all graphics output will be direct to the output deviceFunction LG_CELLARRAY V0.6 WARNING: Raster mode is not enabledFunction LG_RMASKCELLARRAY V0.7 ERROR: Function LG_X11_RMCA failed to allocate memory for image displayERROR: Function LG_X11_RMCA failed because of bad data scaling rangeFunction LG_X11_RMCAFunction LG_CELLARRAY V0.1 Function LG_SPYGLASS V0.2 Subroutine LG_3DMIMAGE V0.2 WARNING: Only raster mode output is presently available for 3-d imagesFunction LG_REALCELLARRAY V0.8 Subroutine LG_REALCELLARRAY V0.8 Function LG_PS_TEXTFONT V0.1 tf Function LG_PS_TRANSFORM V0.1 Function LG_PS_CLEAR V0.1 caSubroutine LG_PS_TEXT V0.3 \() txFunction LG_X11_TEXT V0.4 Function LG_PS_CLIP V0.1 cpinitclipFunction LG_PS_PL V0.4 hlvl cl plFunction LG_RAS_PL V0.4 Function LG_INQ_DATAWINDOW V0.1 ERROR: Light Graphics system is not open (LG_OPEN_WK)Function LG_INQ_VIEWPORT V0.1 ERROR: Light Graphics system is not open (LG_OPEN_WK)Function LG_PS_MARKERWIDTH V0.1 mwFunction LG_PS_PM V0.2 pmFunction LG_PS_UPDATE V0.2 showpage0.1 0.1 scaleFunction LG_DEF_COLOURS V0.2 Subroutine LG_PS_OPEN V0.11%!PS-Adobe-2.0%%BoundingBox: 18 23 569 810%%Creator: Produced by the "Light Graphics" system%%Title: "Light Graphics" V1.5 PostScript Output% Copyright 1995 - 2001 Andy Hammersley / ESRF applies % to the prologue. % Definition of variables/fa_r 1 def /fa_g 1 def /fa_b 1 def/fa_g 1 def/tx_r 0 def /tx_g 0 def /tx_b 0 def /tx_h 0 def /tx_v 0 def/tx_g 0 def /tx_h 0 def /tx_v 0 def/tx_a 0 def /c_a 1 def /s_a 0 def% Definition of functions/pc { /pl_b exch def /pl_g exch def /pl_r exch def} def/mc { /pm_b exch def /pm_g exch def /pm_r exch def} def/fc { /fa_b exch def /fa_g exch def /fa_r exch def} def/tc { /tx_b exch def /tx_g exch def /tx_r exch def} def/pc {/pl_g exch def} def/mc {/pm_g exch def} def/fc {/fa_g exch def} def/tc {/tx_g exch def} def/pw { /pl_w exch def } def/pt { /pl_t exch def } def/mt { /pm_t exch def } def/ms { /pm_s exch def } def/mw { /pm_w exch def } def/ta {/tx_v exch def /tx_h exch def} def/td { /tx_a exch def /c_a tx_a cos def /s_a tx_a sin def} def/tf { /fi exch def /size exch deffi 1 eq {/Times-Roman findfont size scalefont setfont} iffi 2 eq {/Courier findfont size scalefont setfont} if} bind def/l_type {0 pl_t eq {[] 0 setdash} if1 pl_t eq {[] 0 setdash} if2 pl_t eq {[dash dash] dash 2 div setdash} if3 pl_t eq {[dot gap] 0 setdash} if4 pl_t eq {[dash gap dot gap] dash 2 div setdash} if} def/pl { /num exch def newpath movetonum 1 sub {lineto} repeatpl_w setlinewidth pl_r pl_g pl_b setrgbcolor l_type stroke} bind defpl_w setlinewidth pl_g setgray l_type stroke} bind def/cl { /num exch def newpath movetonum 1 sub {lineto} repeat closepath/hl { dup 3 -1 roll dup 3 -1 roll newpath moveto 3 -1 roll add exch lineto/vl { dup 3 -1 roll dup 3 -1 roll newpath moveto 3 1 roll add lineto/dt {newpath /y exch def /x exch def x 1 sub y moveto x 1 add y linetostroke} bind def/plus {newpath /y exch def /x exch def x pm_s sub y moveto x pm_s add y linetox y pm_s sub moveto x y pm_s add lineto stroke} bind def/star {newpath /y exch def /x exch def x pm_s sub y moveto x pm_s add y linetox pm_s 0.707 mul sub y pm_s 0.707 mul sub movetox pm_s 0.707 mul add y pm_s 0.707 mul add linetox pm_s 0.707 mul sub y pm_s 0.707 mul add movetox pm_s 0.707 mul add y pm_s 0.707 mul sub lineto/cir {newpath pm_s 0 360 arc stroke} def /cross {newpath /y exch def /x exch def/pm {/num exch def pm_r pm_g pm_b setrgbcolor [] 0 setdash/pm {/num exch def pm_g setgray [] 0 setdashpm_t 1 eq {10 setlinewidth 1 setlinecap num {dt} repeat} ifpm_t 2 eq {pm_w setlinewidth 0 setlinecap num {plus} repeat} ifpm_t 3 eq {pm_w setlinewidth 0 setlinecap num {star} repeat} ifpm_t 4 eq {pm_w setlinewidth 0 setlinecap num {cir} repeat} ifpm_t 5 eq {pm_w setlinewidth 0 setlinecap num {cross} repeat} if/fa { /num exch def newpath movetofa_r fa_g fa_b setrgbcolor fill} bind deffa_g setgray fill} bind def/tx_box {gsave newpath 0 0 moveto true charpath flattenpath pathbboxgrestore} def/tx {/tx_y exch def /tx_x exch def dup stringwidth pop /width exch deftx_r tx_g tx_b setrgbcolortx_g setgray0 tx_h eq { /x_a 0 def } if1 tx_h eq { /x_a 0 def } if2 tx_h eq { /x_a width 2 div def } if3 tx_h eq { /x_a width def } if0 tx_v eq { /y_a 0 def} if1 tx_v eq { (l) tx_box /y_a exch def pop pop pop} if2 tx_v eq { (X) tx_box /y_a exch def pop pop pop} if3 tx_v eq { (Xg) tx_box exch pop add 2 div /y_a exch def pop} if4 tx_v eq { /y_a 0 def} if5 tx_v eq { (g) tx_box pop pop -1 mul /y_a exch def pop} if6 tx_v eq { (X) tx_box exch pop add 2 div /y_a exch def pop} if/tx_x tx_x x_a c_a mul s_a y_a mul sub sub def/tx_y tx_y s_a x_a mul c_a y_a mul add sub deftx_x tx_y moveto gsave tx_a rotate show grestore} bind def/ca {/ymax exch def /xmax exch def /ymin exch def /xmin exch defnewpath xmin ymin moveto xmax ymin lineto xmax ymax lineto xmin ymax linetoclosepath 1 1 1 setrgbcolor fill} bind defclosepath 1 setgray fill} bind def/cp {/ymax exch def /xmax exch def /ymin exch def /xmin exch defclosepath clip} def 0.1 0.1 scale% End of prologue% Define current graphics stateFunction LG_PS_FILLCOLOUR V0.2 ERROR: Fill area colour component red not converted O.K. ERROR: Fill area colour component green not converted O.K.ERROR: Fill area colour component blue not converted O.K.fcERROR: Fill drawing colour component grey not converted O.K. fcFunction LG_PS_FA V0.1 faSubroutine LG_RAS_FA V0.4 Function LG_PS_TEXTALIGNMENT V0.2 taFunction LG_PS_TEXTANGLE V0.1 tdFunction LG_PS_TEXTCOLOUR V0.2 ERROR: Line drawing colour component red not converted O.K. ERROR: Line drawing colour component green not converted O.K.ERROR: Line drawing colour component blue not converted O.K.tcERROR: Text drawing colour component grey not converted O.K. tcWARNING: Attempt to set zero or negative height text charactersFunction LG_PS_TEXTHEIGHT V0.3 tf Function LG_PS_LINECOLOUR V0.2 ERROR: Line drawing colour component red not converted O.K. ERROR: Line drawing colour component green not converted O.K.ERROR: Line drawing colour component blue not converted O.K.pcERROR: Line drawing colour component grey not converted O.K. pcFunction LG_PS_LINESTYLE V0.1 ptFunction LG_PS_LINEWIDTH V0.1 pwFunction LG_PS_MARKERCOLOUR V0.1 ERROR: Marker drawing colour component red not converted O.K. ERROR: Marker drawing colour component green not converted O.K.ERROR: Marker drawing colour component blue not converted O.K.mcERROR: Marker drawing colour component grey not converted O.K. mcFunction LG_PS_MARKERSCALE V0.1 msFunction LG_PS_MARKERTYPE V0.1 mtSubroutine LG_BMAXSETREGION V0.2 Subroutine LG_PS_BCA V0.4 Subrountie LG_PS_BCA V0.4 ctpop pop % Remove status return from stackctpop pop % Remove status return from stackSubroutine LG_PS_RMCA V0.3 Subroutine LG_PS_CA V0.9 Subrountie LG_PS_CA V0.9 ctpop pop % Remove status return from stackSubroutine LG_RAS_3DMIMAGE V0.4 Subroutine LG_3DMIMAGE V0.4 Function LG_PS_WCA V0.1 /colourtable 768 string def/ct {currentfile colourtable readhexstring} def% p2rgb : Convert pixel value to RGB values/p2rgb { % Stack : pixel_string index => pixel_string /index exch def % Save element indexdup % Duplicate 'pixel_string' on stackindex get 3 mul /colourindex exch def % Define base colour index/index index 3 mul def % Calculate string positionrgb_string index colourtable colourindex get put/index index 1 add def % Increment output string index/colourindex colourindex 1 add def % Increment colour index/index index 1 add def % Increment output string index/colourindex colourindex 1 add def % Increment colour index} def% Definition of "ca" operator/ca { /yip exch def /xip exch def /ye exch def /xe exch def/ys exch def /xs exch defgsave xs ys translate xe xs sub 1 add ye ys sub 1 add scalexip yip 8 [xip 0 0 yip 0 0]{currentfile pixel_string readhexstring pop % Input line of pixels0 1 xip 1 sub {p2rgb} for % Convert pixels to RBG valuespop % Take 'pixel_string' off stackrgb_string } % Put RGB string on stackfalse 3 colorimage grestore} def{currentfile pixel_string readhexstring pop} % Input line of pixelsimage grestore} defSubroutine MA_RVALUE V0.1 Subroutine MA_2DPOISSON V0.1 NOT IMPLEMENTED YETSubroutine MA_L1VALUE V0.1 Subroutine MA_RADD V0.1 Subroutine MA_RCOPY V0.1 Subroutine MA_RMULTIPLY V0.1 Subroutine MA_RSUBTRACT V0.1 Subroutine MA_RVARMULT V0.1 Subroutine MA_WAVERAGE V0.1 Subroutine MA_DC2PIXC V0.3 Subroutine MA_2DGAUSSIAN V0.3 Subroutine MA_1DINTERCORR V0.1 Subroutine MA_AUTOCORRELATION V0.3 Subroutine MA_RMOVE V0.1 Subroutine MA_RCMULT V0.1 Subroutine MA_TOPHATCON V0.2 Subroutine MA_TOPHAT2CON V0.2 Subroutine MA_RCADD V0.1 Subroutine MA_RDIVIDE V0.1 Subroutine MA_RFLIP V0.1 Subroutine MA_RMINMAX V0.1 Subroutine MA_LOGARITHM V0.1 Subroutine MA_THRESHOLD V0.1 Subroutine MA_MEDIANFILTER V0.3 Subroutine MA_2DTRANSFORM V0.3 Subroutine MA_CAL_2DTRANSFORMATION V0.2 Subroutine MA_RROTATE V0.3 Subroutine MA_RTRANSFORM V0.2 re-binning into more than three output pixels (X-direction). re-binning into more than three output pixels (Y-direction).Subroutine MA_RMAX V0.1 Subroutine MA_POWER V0.1 Subroutine MA_2DFRFFT V0.1 Subroutine MA_RREBIN V0.1 Subroutine MA_RSCALE V0.1 Subroutine MA_RREFLECT V0.3 Subroutine MA_SCONVOLUTION V0.1 Subroutine MA_STATISTICS V0.2 Subroutine MA_SINTERPOLATE V0.4 WARNING: The required closeness of fit could not be attained. Surface not calculatedSubroutine MA_SYMFUN V0.3 Subroutine MA_RTRANSPOSE V0.1 Subroutine MA_MODELFIT V0.7 ERROR: More variable parameters than unmasked data valuesERROR: Not enough available memoryERROR: The model function has set terminationWARNING: Too many calls to the calculating functionWARNING: 'tolerance' is too small. No further minimisation is possibleWARNING: No further improvement in solution is possibleWARNING: 'RESIDUALS' is orthogonal to the Jacobian (to machine precision)Subroutine MA_1DCHEBYSHEV V0.2 Subroutine MA_1DEXPDECAY V0.1 Subroutine MA_1DGAUSSIAN V0.1 Subroutine MA_1DLORENTZIAN V0.1 Subroutine MA_1DSINUSOIDAL V0.1 Subroutine MA_1DVOIGTIAN V0.1 Subroutine MA_CAL_POLYNOMIAL V0.3 Subroutine MA_SORT V0.1 Subroutine MA_CAL_NBCUBSPLINE V0.1 Subroutine MA_CAL_2DNCUBSPLINE V0.2 Subroutine MA_TRIREBIN V0.4 Subroutine MA_CAL_2DCHEBYSHEV V0.4 Subroutine MA_2DPOLARGAU V0.2 Function Ma_exdigit V0.2 Subroutine MA_RADIAL V0.5 Function Ma_gaussian V0.2 Subroutine MA_ARCSLICE V0.1 Subroutine MA_CAL_CIRCENTRE V0.1 (32X,OF NB01 FAILURE)( + ERROR RETURN FROM GA05 BECAUSE)(32X,iw IS TOO SMALL)(32X,lnd IS TOO SMALL)(32X,THE DATA IS NOT PERIODIC)Subroutine MA_PROJECTION V0.4 WARNING: There is not enough room for the whole of the required projection. The end of the projection will be truncated.Subroutine MA_SATURATED V0.1 Subroutine MA_SLICE V0.1 Subroutine MA_CLOCKWISE V0.1 Subroutine MA_PC2DC V0.1 Subroutine MA_PERINTERSECT V0.1 PANIC: This should not be possibleSubroutine MA_2GAUSSIAN V0.1 Subroutine MA_RMEAN V0.1 Subroutine MA_BESTCENTRE V0.3 Subroutine MA_CENTRE V0.1 Subroutine MA_POLYNOMIAL V0.3 Subroutine MA_LINECIRCLE V0.1 Subroutine MA_SLOPE V0.2 Subroutine MA_2DCHEBYSHEV V0.2 Subroutine MA_EXPNT V0.1 Subroutine MA_FFA8 V0.2 Subroutine MA_FFS8 V0.2 Subroutine MA_DIFZSCALE V0.4 Subroutine MA_REBINMAX V0.1 Subroutine MA_REBINMIN V0.1 Subroutine MA_REBINMINMAX V0.1 Subroutine MA_RMIN V0.1 Subroutine MA_INTERSECT V0.1 Subroutine MA_POINTVECTOR V0.1 Subroutine MA_CUBSPLINE V0.1 Function Ma_poisson V0.1 Subroutine MA_2DIHFFT V0.1 Subroutine MA_2DROTATE90 V0.2 Subroutine MA_SUB2DROT90 V0.1 Subroutine MA_2DROTATE V0.1 Subroutine MA_2DTRANSLATE V0.1 Subroutine MA_TRANSFORM V0.1 Subroutine MA_FRCLFFT V0.2 Subroutine MA_FROWFFT V0.1 Subroutine MA_REFLECT V0.1 Subroutine MA_MODELMIN V0.9 INFO: Iteration = 1Subroutine MA_CAL_TRILINES V0.3 Subroutine MA_CAL_ANGVECTORS V0.2 Subroutine Ma_rand1 V0.3 Subroutine MA_IHCLFFT V0.2 Subroutine MA_IROWFFT V0.1 Subroutine MA_EUCLIDEANNORM V0.1 Subroutine MA_JACOBIAN V0.4 Subroutine MA_MODELRESID V0.5 Subroutine IO_CLOSE_LOGFILE V0.1 Subroutine IO_FREE V0.1 Subroutine IO_LOAD_DATABASE V0.3 READSubroutine IO_MALLOC V0.1 Subroutine IO_MSET_OPTIONS V0.8 -SYM =-SYMBOL u-BVAR -CVAR -FVAR -IVAR -LVAR -RVAR -SVAR ' WARNING: Could not convertvariable value to correct type-mac+mac-MAC+MACfit2d.mac INFO: No macro file name specified; trying 'fit2d.mac'WARNING: Macro file as specified on command file could not be openedSubroutine IO_SAVE_DATABASE V0.2 WRITESubroutine IO_TEXT V0.4 Enter valid integer within given range[A[BUpper of lower cases letters may be input: B = Backwards (Up) one "page" C = Case Sensitive searching, toggles between case sensitive searching or not D = Down (Forwards) one "page" E = End of text, go to end F = Forwards one "page" (default option) H = Help (this text, equivalent to "?") N = Number of lines per "page" User is prompted for a number Q = Quit, exit OUTPUT S = Start of text, return to beginning U = Up (Backwards) one "page" > = Forward search (circular) < = Backwards search (circular) 1, 2, 3, etc. A number followed by may be used to go immediately to that line number. Enter the number of lines of text to be output in a "page" i.e. the number of lines between prompts to continue. e.g. For a normal terminal window with 24 lines, the value 23 displays maximum size "pages" while allowing all lines to be read. The value "0" may be input to disable this facility. NUMBER OF LINES OF TEXT PER "PAGE"> ENTER SEARCH TEXTEnter key word or pattern to search forEnter valid textEnter YES or NO ^SEARCH NEXT OCCURENCEYES to continue search for next example of defined charactersTOKEN NOT FOUNDSubroutine IO_WRITE V0.1 STATUS: The "status" value appears to be good, but an error position hasbeen reported in:This is probably due to incorrect calling argumentsSTATUS: The "status" value is set to the user escape valueIO: Input/Output and Status MA: Mathematics GR: Graphics LG: "Light Graphics" GS: "Graphics System" NAG: NAG mathematics library DS: Data Storage GKS: Graphics Kernel System HDS: Hierarchical Data Storage system PHIGS: Programmers Hierarchical Interactive Graphics System CHIPLOT (CHI): CHIPLOT graphics module FIT2D (F2D): 2-D fitting module HIT: Hammersley Incomplete Transform module monitor (MON): MONITOR module CINDEX: Cell Indexing Module FIO: File Input/Output Module GENERATOR: Software generator module SPECIAL: using standard status values SPECIAL: using non-standard status values UNKNOWN: STATUS: The error was identified in module:STATUS: Position where error condition was identifiedFirst array dimension illegally defined Second array dimension illegally defined Third array dimension illegally defined Fourth or greater array dimension illegally defined First dimension data region illegally defined Second dimension data region illegally defined Third dimension data region illegally defined Fourth or greater dimension data region illegally defined First dimension internal array limit exceeded Second dimension internal array limit exceeded Third dimension internal array limit exceeded Fourth or greater dimension internal array limit exceeded First dimension: illegal relationship between two variables Second dimension: illegal relationship between two variables Third dimension: illegal relationship between two variables Fourth of greater dimension: illegal relationship between two variables First dimension: integer value out of acceptable range Second dimension: integer value out of acceptable range Third dimension: integer value out of acceptable range Fourth or greater dimension: integer value out of acceptable range First dimension: real value out of acceptable range Second dimension: real value out of acceptable range Third dimension: real value out of acceptable range Fourth or greater dimension: real value out of acceptable range First dimension: number of elements is not a power of two Second dimension: number of elements is not a power of two Third dimension: number of elements is not a power of tw